You are on page 1of 457



THENEWHISTORICISM:STUDIESINCULTURALPOETICS GeneralEditor,StephenGreenblatt HolyFeastandHolyFast:TheReligiousSignificanceofFoodtoMedievalWomenbyCarolineWalkerBynum TheGoldStandardandtheLogicofNaturalism:AmericanLiteratureattheTurnoftheCenturybyWalterBennMichaels NationalismandMinorLiterature:JamesClarenceManganandtheEmergenceofIrishCulturalNationalismbyDavidLloyd


FRONTISPIECE.InthisFlemishretableoftheKinshipofSt.Anne fromabout1500wefindfeedingthemesassociatedwithJesus'femalerelatives. InthecenterMarypresentsherchildtoAnne,whooffershimgrapes(a eucharisticsymbol),whileinthelowerleftanotherwomannursesababy. (Anne'slefthandandthegrapeshavebeenrestored.)Worshipersatmasswould haveseenapriestelevatingthehostjustinfrontofthisdepictionofholy womenofferingfood:bothgrapes(wineorblood)andChristhimself(breador flesh).MuseduPareduCinquantenaire,Brussels.CopyrightA.C.L., Brussels.




Disclaimer: SomeimagesintheoriginalversionofthisbookarenotavailableforinclusioninthenetLibraryeBook. UniversityofCaliforniaPress BerkeleyandLosAngeles,California UniversityofCaliforniaPress,Ltd. London,England 1987by TheRegentsoftheUniversityofCalifornia Firstpaperbackprinting1988 LibraryofCongressCataloginginPublicationData Bynum,CarolineWalker. Holyfeastandholyfast. Includesindexes. 1.FoodReligiousaspectsChristianity.2.Women HistoryMiddleAges,5001500.3.FoodhabitsHistory. I.Title. BR253.B961987248.4'68528896 ISBN0520063295(alk.paper) PrintedintheUnitedStatesofAmerica 789 ThepaperusedinthispublicationmeetstheminimumrequirementsofAmericanNationalStandardforInformationSciencesPermanenceofPaperforPrinted LibraryMaterials,ANSIZ39.481984.




ListofPlates Preface Introduction PartI TheBackground 1 ReligiousWomenintheLaterMiddleAges NewOpportunities FemaleSpirituality:DiversitiesandUnity 2 FastandFeast:TheHistoricalBackground FastinginAntiquityandtheHighMiddleAges AMedievalChange:FromBreadofHeaventotheBodyBroken PartII TheEvidence 3 FoodAsaFemaleConcern:TheComplexityoftheEvidence QuantitativeandFragmentaryEvidenceforWomen'sConcernwith Food Men'sLivesandWritings:AComparison 4 FoodintheLivesofWomenSaints TheLowCountries FranceandGermany Italy 5 FoodintheWritingsofWomenMystics HadewijchandBeatriceofNazareth CatherineofSienaandCatherineofGenoa

ix xiii 1


14 23 31

33 48



94 113

115 129 140 150

153 165


PartIII TheExplanation 6 FoodAsControlofSelf WasWomen'sFastingAnorexiaNervosa? FoodAsControlofBody:TheAsceticContextandtheQuestionof Dualism 7 FoodAsControlofCircumstance FoodandFamily FoodPracticesandReligiousRoles FoodPracticesAsRejectionofModeration 8 TheMeaningofFood:FoodAsPhysicality FoodandFleshAsPleasureandPain TheLateMedievalConcernwithPhysicality 9 WomanAsBodyandAsFood WomanAsSymbolofHumanity Woman'sBodyAsFood 10 Women'sSymbols TheMeaningofSymbolicReversal Men'sUseofFemaleSymbols Women'sSymbolsAsContinuity Conclusion Epilogue ListofAbbreviations Notes GeneralIndex IndexofSecondaryAuthors


194 208


220 227 237 245

246 251 260

261 269 277

279 282 288 294 297 303 307 421 435


Frontispiece.RetableoftheKinshipofSt.Anne.MuseduParcduCinquantenaire,Brussels.CopyrightA.C.L.,Brussels. followingp.142 1.RetableoftheMysticalMillcentralpanel.UlmMuseum.CourtesyFotographieIngeborgSchmatz. 2.RetableoftheMysticalMillwingsclosed.UlmMuseum.CourtesyFotographieIngeborgSchmatz. 3.MassofSt.Gregory,bytheMasteroftheHolyKinship.MuseumoftheCatherineconvent,Utrecht.CopyrightStichtingHetCatharijneconvent. 4.ChristwithEarofWheatandGrapeVine,fromthestudioofFriedrichHerlin.Stadtmuseum,Nrdlingen.CourtesyFotohausHirsch. 5.SilkembroideryofChristinthewinepress.GermanischesNationalmuseum,Nrnberg.CopyrightGermanischesNationalmuseum. 6.RetableofMaryandtheUnicorn.TheCathedral,Lbeck.CourtesyHerbertJger. 7.MaryAltarwithsaintsCatherineandBarbara.HolyGhostHospital,Lbeck. followingp.302 8.TheMiracleofSt.Elizabeth,SieneseSchool.Pinacoteca,Perugia.CourtesyAlinari/ArtResource,N.Y. 9.ElizabethofHungarywithroses(namelaterreplacedbythatofRoseof


Viterbo),byBenozzodiLese,calledGozzoli.MuseodiS.Francesco,Montefalco.CourtesyAlinari/ArtResource,N.Y. 10.WoodcutfromJohnBrugman'sVitaalmeVirginisdeSciedam,1498.MuseumoftheCatherineconvent,Utrecht.CopyrightStichtingHetCatharijneconvent. 11.ThreeminiaturesfromaLifeofColettemadebyMasterJehanBonifacebetween1468and1477forMargaretofYork.Manuscript8,fols.34r,68v,75v,ofthe ConventofClaresatGhent. 12.Miniatureofimagomuliebris,frompart2,vision6,ofHildegardofBingen'sScivias.Plate15inHildegardofBingen,Scivias,ed.AdelgundisFhrktterandA. Carlevaris,Corpuschristianorum:continuatiomediaevalis43,2vols.(Turnhout:Brepols,1978),1:228ff.Madefromahandcoloredphotocopy(19271933)ofthe lostoriginal.CourtesyBrepols. 13.Viergeouvrante,closedandopen.TheMetropolitanMuseumofArt,giftofJ.PierpontMorgan,1917. 14.MadonnaandChildbeforeaFirescreen,byRobertCampin.TheNationalGallery,London.CourtesytheTrustees,TheNationalGallery,London. 15.Charity,byLucasCranachtheElder.Mused'Histoireetd'Art,Luxembourg. 16.FountainoftheVirtues,Nrnberg.Photographbyauthor. 17.Ecclesialactansstandingoverthecardinalvirtues,byGiovanniPisano.Detailfromapulpit.TheCathedral,Pisa. 18.DetailoftheRetableofSt.BernardbytheMasterofPalma.SociedadArqueolgicaLuliana,PalmadeMallorca. 19.DetailoftheRetableofSt.IldefonsobytheMasterofOsma.TheCathedral,ElBurgodeOsma,Soria. 20.TheRestontheFlightintoEgypt,byGerardDavid.NationalGalleryofArt,Washington,AndrewW.MellonCollection.CopyrightNationalGalleryofArt. 21.VirginandChildinaLandscape,byJanvanHemessen.NationalMuseum,Stockholm.CourtesyNationalMuseum,Stockholm. 22.TheHolyKinship,byMaertendeVos.MuseumofFineArts,Ghent. 23.VirginandChild,HeuresdeMilan,fol.120r.MuseoCivico,Turin.CopyrightMuseoCivicodiTorinocourtesyAgentFoto,Turin.


24.LuccaMadonna,byJanvanEyck.StdelschesKunstinstitut,Frankfurt. 25.TheSavior,byQuiriziodaMurano.Accademia,Venice.CourtesyO.Bhn. 26.ChristandCharity,byanorthwestGermanmaster.WallrafRichartzMuseum,Cologne. 27.TheManofSorrows,byJacobCornelisz.MayervandenBerghMuseum,Antwerp.CopyrightA.C.L.,Brussels. 28.ChristandtheVirginIntercedingwithGodtheFather,''TurinMilanHours."CabinetdesDessins,MuseduLouvre,Paris.CourtesyDocumentation photographiquedelaRuniondesmusesnationaux. 29.TheLastJudgment,byJanProvost.Groeningemuseum,Bruges. 30.TriptychofAntoniusTsgrootenbyGoswynvanderWeyden.KoninklijkMuseumvoorSchoneKunsten,Antwerp.


PartofthisbookwaswritteninapleasantofficeonthetopflooroftheBuntingInstituteofRadcliffeCollegeinCambridge,Massachusetts.Iamgratefultomy colleaguesattheBunting,manyofwhomreadportionsofthemanuscriptorarguedwithmeaboutmyideas.IwouldespeciallyliketothankLindaGordon,Ellen Bassuk,NancyMiller,EveSedgwick,MarilynMassey,MarthaAckelsberg,BettinaFriedl,AnnBookman,andDebbieMcDowell,whocareddeeplyaboutmywork butneverletmeforgetthatthemedievalwomenIstudiedsoundeddecidedlypeculiartomodernears.IwouldalsoliketothanktheNationalEndowmentforthe HumanitiesforaFellowshipforAdvancedStudyandResearchandtheUniversityofWashingtonforsabbaticalleavein19831984. NotallofthisbookwaswritteninthescholarlyleisureoftheBuntingInstitutenoramidtherichesofHarvardUniversity'sWidenerLibrary.Muchofitwascomposed inacubbyholeonthetopfloorofSuzzalloLibraryattheUniversityofWashington.Otherswhohavestruggledwiththeinevitablylimitedlibraryresourcesofa relativelynewinstitutionwillunderstandhowmuchIowetolibrariansformakingmyresearchpossible.KristiGreenfieldofSuzzalloAcquisitionsandRuthKirkand AnnaMcCauslandofInterlibraryBorrowingServicesfoundbooksforme,overandoveragain,withanenthusiasmthatwentbeyondprideinajobwelldoneand becameprideinscholarshipitself.Withoutthem,thisbookwouldnotexist. Thecolleagues,formerteachers,andfriendswhohaveinfluencedmyideasonthehistoryofspiritualityareafarflungnetwork.IwouldespeciallyliketothankGiles Constable,JohnBoswell,NatalieZ.Davis,LesterLittle,ElizabethA.R.Brown,RichardKieckhefer,PaulMeyvaert,AnnFreeman,CharlesT.Wood,andMarkR. Silkfortheirinspirationandtheirhelp.JoanJacobsBrumbergandRachelJacoffhave


generouslyassistedwithtranslationsandcitations.DavidPinkney,RuthMellinkoff,PatriciaFortiniBrown,WalterCahn,andAnnaKartsonistaughtmehowtotrack downarthistoricalinformation.MaryMartinMcLaughlin,whoseworkhaslongbeenanexampleandaninspirationtome,readtheentiremanuscriptandoffered adviceinbothsmallmattersofdetailandlargemattersofinterpretation.KenRosetypedwithcareandenthusiasm.ElizabethGoolianandmyeditor,SheilaLevine,not onlyhelpedmeputthebooktogetherbutalso,intheprocessofdoingso,offeredmeintellectualstimulationandfriendship. Mydeepestthanksgotothreepeople:JudithVanHerikmyhusband,GuentherRothandPeterBrown.JudithVanHerikhelpedmeworkoutmypositionsbothin relationtotheseveralcurrentsofrecentfeministtheoryandinrelationtopsychoanalyticinterpretationsoffood.GuentherRothspottediconographicalevidenceforme inmuseums,arguedwithmeaboutwhatImeanby"cause,"andsavedmefrommyworstinstinctsinthematterofadjectives.PeterBrownispartlyresponsibleforthe factthatthisstudyexistsatall.NotonlydidheurgemetoletitbecomeabookwhenIwasstrugglingtoforceitintothecompassofafiftypagearticlehealsostarted meonthesearchforaconvincinginterpretationofmedievalasceticismwhenheaskedme,morethanfiveyearsago,atellingquestionaboutthenunsofHelfta. WhileIwasatworkonthisbook,RudolphM.BellofRutgersUniversitywasinvestigatingasimilartopic.Itwasfairlylateintheprocessofourrespectiveresearches thatweeachlearnedoftheother'slabors.Whenwedidexchangeportionsofourmanuscripts,wediscoveredhowdifferentourapproacheswere.ProfessorBell's book,HolyAnorexia(Chicago:UniversityofChicagoPress,1985),coversamorelimitedgeographicalareaandalongertimeperiod.Hissubjectisabstinence, treatedwithoutreferencetothepositivesignificanceoffoodinChristianpractice.Hisresearchismorequantitativethanmine.Hisexplanatorymodelispsychological. WhereasBellhasbeeninterestedinwomen'sfastingbehavior,puttingitintoapsychologicalcontext,Ihaveconcentratedonwomen'suseoffoodassymbol,puttingit intoaculturalcontext.Itismyhope,asitisProfessorBell's,thatreadersofourbookswillfindourworkcomplementary.HolyAnorexia,withitssophisticated statisticalcomparisons,strengthensmyargumentthatfoodpracticesandfoodsymbolscharacterizedwomen'sexperiencemorethanmen's.Iamgrate


fultoagenerousandlivelyfellowscholarwho,ratherthanwarningmeoffhisterritory,sharedhismanuscriptandhisideas. Themethodandthepaceofthisbookalsorequiresomeprefatorycomment.Inmethodthebookisaninterpretativeessayinsocialandreligioushistory.Althoughit makesextensiveuseofhagiographicalmaterial,itisnotatechnicalcontributiontothelongestablishedfieldofhagiography.WherepossibleIhaveusedthebest editionsofmedievaltextsandinvestigatedthemostpressingproblemsrelatingtothereliabilityofhagiographicalaccounts.ButIhavedeliberatelychosennotto provideexhaustivebibliographiesonthewomentreatedhereortofolloweveryscholarlydebateconcerningeithereventsortextsdownthetwistingbywaysofrecent literature.InsomeinstancesIhaveevencitedoldereditionsalongsidenewonestoaidscholarswhodonothavereadyaccesstothelargestandfinestlibraries. Concerningpace,itseemsworthnotingthatthisbookunfoldsslowly.Thetwobackgroundchaptersareleisurelyintheirdevelopment.Thelongmiddlechapters chapters4and5tellmanystoriesandrefertomanynamesandplaces.Thoughthetempoquickensinthefinalchapters,astheanalysisbecomesevermore complicated,Irepeatedlybreaktheflowbycitingexamples.Therearetworeasonsforthispatternofexposition.ThefirstissimplythatIamcommitted,asahistorian, toprovingratherthanmerelyillustratingmycase.Toconvincemodernreadersofthedecidedlybizarrebehaviorofsomemedievalwomen,itisnecessarytogivethe evidence.Butreaderswhoareinterestedonlyinmyexplanationofthatbehaviormightdowelltostartwithchapter6.Thesecondreasonformydeliberatepace, especiallyinthefirsthalfofthebook,isthebreadthandcomplexityoftheanalysisinthesecondhalf.NotonlydoImove,inthelastfivechapters,onseveralanalytical levelsIalsoadvancetheoriesaboutthenatureofasceticismandaboutwomen'suseofsymbolsthatarefarreachingintheirimplicationsforwomen'shistoryandfor thehistoryofreligions.Bothtoknowledgeablemedievalistsandtocommittedfeministsalthoughfordifferentreasonsthesetheorieswillseemtobeaudacious reversalsofreceivedwisdom.Suchtheoriescannotbeconvincingindeed,shouldnotbeconvincingunlesstheyexplainindividualliveswithoutviolatingtheir specificity.Thus,beforesiftingmedievalexperiencethroughthefinemeshofmyanalyticalsieve,Ihavetriedtoletparticularwomensuch


asBeatriceofNazareth,ElizabethofHungary,AngelaofFoligno,LidwinaofSchiedam,DorothyofMontau,andCatherineofSienahaveafewparagraphsoreven afewpagesinwhichtotelltheirstories. Thisbookisdedicatedtothememoryofmymother,MerleWalker.Abrilliantphilosopher,poet,scholar,andteacher,shewasascircumscribedasanyfourteenth centurywomanbyhersociety'sassumptionsaboutfemalenurturingandselfsacrifice.Onlythosewhoknewherwillunderstandfullythewaysinwhichthisbookisa tributetoherandanexplorationofthepainandtriumphofherlife.Butthisbookismore.Forthebooksmymothermighthavewrittenneverappeared.Myactof writingisthereforemypledgetohergranddaughter,AntoniaWalker,andtohergranddaughter'sgenerationthatwomen'screativityshallnotinthefuturebesilenced.It isalsoanexpressionofhopethatthosefuturegenerationsofwomenwillnotlosethecompassion,thealtruism,andthemoralcouragethatmadeMerleWalker'slife notatragedyofselfabnegationbutatriumphovermeaninglessnessandsuffering.


St.BernardcomparedthisSacrament[theeucharist]withthehumanprocessesofeating,whenheusedthesimilesofchewing,swallowing,assimilation,anddigestion.Tosome peoplethiswillseemcrude,butletsuchrefinedpersonsbewareofpride,whichcomesfromthedevilahumblespiritwillnottakeoffenseatsimplethings. JOHNTAULER (FOURTEENTHCENTURY)1

Recentstudiesofthirteenthandfourteenthcenturyspiritualityhavefocusedonpovertyandchastityasthebasicmotifsofreligiouslife.Overthepastfiftyyears, povertyhasbeenstudiednotonlyasthedoctrinalissuethatsplittheFranciscanorderapartbutalsoastheessentialingredientinliteral"imitationofChrist"andasthe basicmetaphorfortherenunciationofwealthandpowerpracticedbytheupperandmiddleclassesofmedievalEurope.2 Chastityhasbeenemphasizedasthesine quanonofreligiousstatus,asthereflectiononearthofthelifeoftheangels,andasarequirementthatlaidaheavyburdenofselfhatredonthoseindividuals especiallywomenwhowereunabletoassertcontrolovertheirownlives.3 Sexandmoney...againandagainmodernscholarshaveemphasizedtheguiltengenderedbytheirseductiveness,theawesomeheroismrequiredfortheir renunciation.YetthismodernfocusmaytellusmoreaboutthetwentiethcenturythanaboutthelateMiddleAges.Inourindustrializedcorneroftheglobe,wherefood suppliesdonotfail,wescarcelynoticegrainormilk,everpresentsupportsoflife,andyearnratheraftermoneyorsexualfavorsassignsofpowerandofsuccess.But evenintoday'sworld,itisnoteverywhereso.Forthehungry,foodforcesitselfforwardasaninsistentfact,aninsistentsymbol.Guidedbyourknowledgeof impoverishedmoderncountries,weshouldnotreallybesurprisedtofindthatfoodwas,inmedievalEurope,afundamental


economicandreligiousconcern.Medievalpeopleoftensawgluttonyasthemajorformoflust,fastingasthemostpainfulrenunciation,andeatingasthemostbasic andliteralwayofencounteringGod.PeterBrownhascommentedthateventhoughPauldiscountedtheimportanceoffoodandfoodpracticesforChristians(Rom. 14:17),"inthestraitenedMediterranean[world],thekingdomofheavenhadtohavesomethingtodowithfoodanddrink."4 IntheEuropeofthelaterthirteenthandfourteenthcenturiesfaminewasontheincreaseagain,afterseveralcenturiesofagriculturalgrowthandrelativeplenty.5 Viciousstoriesoffoodhoardingmerchants,ofcannibalism,ofinfanticide,ofsickadolescentslefttodiewhentheycouldnolongerworksurviveinthesources, suggestingaworldinwhichhungerandevenstarvationwerenotuncommon.6 Thepossibilityofovereatingandofgivingawayfoodtotheunfortunatewasamarkof privilege,ofaristocraticorpatricianstatusaparticularlyvisibleformofwhatwecallconspicuousconsumption,whatmedievalpeoplecalledmagnanimityorlargesse. 7 Smallwonder,then,thatgorgingandvomiting,luxuriatinginfooduntilfoodandbodywerealmostsynonymous,becameinfolkliteratureanimageofunbridled sensualpleasure8 thatmagicvesselsforeverbrimmingoverwithfoodanddrinkwerestaplesofEuropeanfairytalesthatoneofthemostcommoncharitiesenjoined onreligiousorderswastofeedthepoorandill,pilgrimsandwanderersorthatsharingone'sownmeagerfoodwithastranger(whomightturnouttobeanangel,a fairy,agod,orChristhimself)was,inhagiographyandfolktalealike,astandardindicationofheroicorsaintlygenerosity.9 Smallwonder,too,thatselfstarvation,the deliberateandextremerenunciationoffoodanddrink,seemedtomedievalpeoplethemostbasicasceticism,requiringthekindofcourageandholyfoolishnessthat markedthesaints.Torepresseatingandhungerwastocontrolthebodyinadisciplinefarmorebasicthananyachievedbysheddingthelessfrequentandessential gratificationsofsexormoney.AsChristsupposedlysaidinavisiongrantedtoMargaretofCortona(d.1297):"Inthislife,Christianscannotbeperfectunlessthey restraintheirappetitesfromvices,forwithoutabstinencefromfoodanddrinkthewarofthefleshwillneverendandtheyfeelandsuffermostfromtherebellionofthe fleshwhorefusethissavingremedy."10OrasGuntherofPairis,theCistercianhistorianandpoet,saidinatreatiseonprayerandfastingwrittenabout1200:"Fastingis usefulforexpellingdemons,excluding


evilthoughts,remittingsins,mortifyingvices,givingcertainhopeoffuturegoodsandaforetaste[perceptio]ofcelestialjoys."11Inthelatefourteenthcentury, CatherineofSweden'shagiographerattributedtohertheopinionthat"abstinenceprolongslife,preserveschastity,pleasesGod,repulsesdemons,illuminesthe intellect,strengthensthemind,overcomesvices,overpowerstheflesh,andstirsandinflamestheheartwithloveofGod."12Ananonymoussatireonhypocritical monks,probablyfromthehighMiddleAges,statesexplicitlythatfoodanddrinkarehardertorenouncethansex:"Manywhoarenotluredbymoreseriousfaultsare castdownbyoverindulgenceinfoodanddrink....Indeed,thinnedbyfastingorvigilsandrepeatedprayers,thestomachthinksnotofawomanbutoffoodit meditatesnotonlustbutonsleep."13 EatinginlatemedievalEuropewasnotsimplyanactivitythatmarkedofffinecalibrationsofsocialstatusandasourceofpleasuresointenseandsensualthatthe renunciationofitwasatthecoreofreligiousworlddenial.Eatingwasalsoanoccasionforunionwithone'sfellowsandone'sGod,acommensalitygivenparticular intensitybytheprototypicalmeal,theeucharist,whichseemedtohoverinthebackgroundofanybanquet.14BecauseJesushadfedthefaithfulnotmerelyasservant andwaiter,preparerandmultiplierofloavesandfishes,butastheverybreadandwineitself,toeatwasapowerfulverb.Itmeanttoconsume,toassimilate,to becomeGod.ToeatGodintheeucharistwasakindofaudaciousdeification,abecomingofthefleshthat,initsagony,fedandsavedtheworld.Thus,toreligious menandwomen,renunciationofordinaryfoodpreparedthewayforconsuming(i.e.,becoming)Christ,ineucharistandinmysticalunion.MechtildofMagdeburg(d. 1282?),whospokeofecstaticexperiencesas"eatingGod,"saidofthemass:
YetI,leastofallsouls, TakeHiminmyhand EatHimanddrinkHim AnddowithHimwhatIwill!15

IntheanguishorthereposeorthemadnessofLove, ....................... Theheartofeachdevourstheother'sheart. ....................

Page4 AshewhoisLoveitselfshowedus Whenhegaveushimselftoeat ...............'smostintimateunionIs througheating,tasting,andseeinginteriorly.16

ThereisnokindofmatterwhichissoclosetoamanandbecomessomuchapartofhimasthefoodanddrinkheputsintohismouthandsoGodhasfoundthiswonderfulwayof unitingHimselfwithusascloselyaspossibleandbecomingpartofus.17

Itisyourbreasts,OeternalWisdom,thatnourishtheholyinfancyofyourlittleones.18 Itwasnottheleastofthechiefreasonsforyourincarnationthatyourbabesinthechurch,whostillneededyourmilkratherthansolidfood,...mightfindinyouaformnot unfamiliartothemselves.19

Notonlywasfoodamoresignificantmotifinlatemedievalspiritualitythanmosthistorianshaverecognized,foodwasalsoamoreimportantmotifinwomen'spiety thaninmen's.Forcertainlatemedievalwomen,fastingbecameanobsessionsooverwhelmingthatmodernhistorianshavesometimesthoughttheirstoriespreservethe earliestdocumentablecasesofanorexianervosa.WomenalloverEuropeservedChristbyfeedingothers,donatingtothepoorthefoodthathusbandsandfathersfelt proudtobeabletosaveandconsume.Theeucharistandrelateddevotions,suchasthosetothebody,wounds,heart,andbloodofChrist,wereattheverycenterof women'spiety.EatingGodinthehostwasbothasweettastingthatfocusedandtranscendedallhungerandanoccasionforparamysticalphenomenaofthemost bizarreandexuberantsort. InthisbookIexploretheimplicationsoffoodrelatedreligiouspracticesandoffoodimagesinthepietyofmedievalwomen.AlthoughIhavetriedtociteenoughcases todemonstratethecentralityoffoodinbothpracticeandtexts,myconcernhasbeenlesstocollectmetaphorsortocountcasesoffoodasceticism,eucharistic devotion,orfeedingmira


clesthanithasbeentoshowthemanifoldmeaningsoffoodanditspervasivenessinreligioussymbolism.Ratherthanmentioneverywomanwhofastedorsawvisions oftheChristchildinthechalice,Ihaveconcentratedonwomenwhoselifestoriesandwritingssurviveinsufficientdetailforustotrace,acrossthedistancecreatedby manycenturiesandbyvastlydifferentmodernassumptions,therichandparadoxicalmeaningsofeatingandnoteating.AlthoughIamawareofmodernclinical definitionsoffoodobsession,Ihaveavoidedusingthem,atleastinitially,becauseIfindthatmedievalattitudestowardfoodarefarmorediversethanthoseimpliedby themodernconceptsofanorexianervosaandhysteria.Toreligiouswomenfoodwasawayofcontrollingaswellasrenouncingbothselfandenvironment.Butitwas more.Foodwasflesh,andfleshwassufferingandfertility.InrenouncingordinaryfoodanddirectingtheirbeingtowardthefoodthatisChrist,womenmovedtoGod notmerelybyabandoningtheirflawedphysicalitybutalsobybecomingthesufferingandfeedinghumanityofthebodyonthecross,thefoodonthealtar.However absurdorvulgarsomemedievalpracticesandlanguagemayseemtocasualmodernobservers,wedowelltoheedTauler'swarning(quotedabove)nottotake offense.Deeperstudyofthese"simplethings"suggeststhatfoodandbodycanbepowerfulwaysofencounteringsufferingandfecundityaspectsofthehuman conditionfromwhichevenweinthetwentiethcenturycannothidecompletely. BecauseIintendthisbookbothformedievalistsandforreaderswithageneralinterestinthehistoryofwomenorthehistoryofChristianity,Ihaveprovided backgroundmaterialforbothgroups.Thefirstchapterisabriefaccountofthereligiousoptionsavailabletomedievalwomenthesecondexplainsthemajorfood practicesofmedievalChristiansfastingandeucharisticdevotionwithattentiontotheirrootsinearlyChristianity.Bothchapterscontainmuchmaterialthatwillbe familiartospecialists,althoughIhavepresenteditinanewway.Thethirdchapter,whichdiscussesthenatureoftheevidence,isprovidedprimarilyforscholars.It examinessomeoftheproblemsraisedbytheuseofhagiographicalmaterialitalsogivesaclosereadingofseveralmalefigurestostrengthenthecaseforcharacterizing foodpracticesandmetaphorsas"female."Thefourthandfifthchapterspresentthestoriesaboutwomenandthewritingsbythemonwhichthisbookisbased.Ihave chosentotellsomeofthesestoriesasstoriesbeforeturningtoa


moreanalyticaldiscussionbecauseitisonlybyrecountingthestoriesthemselvesthatIcandemonstratetoandevokeforreaderstheextenttowhichmanyfood motifstendtobewovenintoasinglelife.Thelastfivechaptersaretheheartoftheargument.InthemIprovidewhatmightbecalled,respectively,afunctionalistanda phenomenologicalexplanationoftheprominenceoffoodmetaphorsandfoodpracticesinwomen'spiety.Inotherwords,Ishow,first,howwomenwereabletouse foodpracticestoshapetheirexperienceandtheirplaceinbothfamilyandcommunityand,second,whatfoodrelatedbehaviorandsymbolsactuallymeantto medievalwomen.Indoingthis,Isuggestbothanewinterpretationoflatemedievalasceticismandanewunderstandingofthesignificanceofgenderinmedieval religion. Thelastfivechaptersindeedbecomeacomplexrefutationofthestandardinterpretationofasceticismasworldrejectionoraspracticaldualismandofthestandard pictureofmedievalwomenasconstrainedoneverysidebyamisogynytheyinternalizedasselfhatredormasochism.Rather,Iarguethatmedievaleffortstodiscipline andmanipulatethebodyshouldbeinterpretedmoreaselaboratechangesrunguponthepossibilitiesprovidedbyfleshlinessthanasflightsfromphysicality.Ialso demonstratetheextenttowhichreligiouswomenderivedtheirbasicsymbolsfromsuchordinarybiologicalandsocialexperiencesasgivingbirth,lactating,suffering, andpreparinganddistributingfood.Theidentificationofthischaracteristicofwomen'ssymbolswhichcontrastssharplywiththeenthusiasmcontemporarymalesfelt forsymbolsofreversal(especiallytherenunciationofwealthandpower)enablesmetoraisefundamentalquestionsaboutdifferencesinmaleandfemalereligiosity. Threeintroductorycommentsmaybehelpful.Thefirstconcernschronology.Despitethefactthatsomeofthemostspectacularcasesoffastingoreucharisticfrenzy discussedbelowcomefromthefifteenthcentury,Ihavelimitedthebulkofmyanalysisto,andtakenmostofmyexamplesfrom,thethirteenthandfourteenthcenturies. Ihavechosenthischronologicalfocusbecausemygoalistoexplaintheoriginsofaparticularemphasiswithinwomen'spiety.Ihavenottriedtofollowthatpietydown intothesixteenthandseventeenthcenturies,althoughonecouldarguethatitpersistedthatlong(andevenlonger)inEurope,especiallyrural,CatholicEurope.Ishall, however,leavethesubsequenthistorytoothers.Mypurposeistoputtheinceptionofthatpietyintoas


broadacontextaspossible,toshowthattopicssuchaseucharisticdevotion,fasting,andmiraculousbodilychangesshouldnotbediscussedinisolationfromeach other.Todemonstratetheinterconnectionofdevotionalpracticesandsymbolsinoneperiod,Ihadtoavoidcarryingthehistoryofanyofthemtoofarforwardintime. Ihavealsoconcentratedmoreondelineatingtheoverallpatternofsymbolswithintheculturethanonferretingoutchronologicalchange.Ihavefeltthistobenecessary inordertomakethepatternclear,butIhopeIhavenotignoredchangeentirely. Second,IamfullyawarethatmostofthewomenIamdiscussingareexceptional.MaryofOignies(d.1213)andCatherineofSiena(d.1380)arenomoretypicalof religiouswomen(orofwomengenerally)thanTheCanterburyTalesandTheDivineComedyaretypicalofmedievalliteratureorofmedievallife.Indeed,medieval hagiographerspointedoutrepeatedlythatsaintsarenotevenprimarily''models"forordinarymortalsthesaintsarefartoodangerousforthat.LikeChristhimself,they couldnotandshouldnotbeimitatedintheirfullextravaganceandpower.Rather(sotheiradmirerssay),theyshouldbeloved,venerated,andmeditateduponas momentsinwhichtheotherthatisGodbreaksthroughintothemundaneworld,saturatingitwithmeaning.Andyet,inthediscussionthatfollows,Imovefromthese particular,exceptionalwomentotheirreligiousandsocialworlds,explainingthewomenbytheircontextandthecontextbythewomen.Twothings,speakingvery generally,justifythisendeavor.Thefirstisthattheevidencewecangarnerfromchronicles,lawcodes,sermons,andsoonsuggeststhatsomeofthepracticesof exceptionalwomentheirfasting,fooddistribution,psychosomaticchanges,etc.werefoundinordinaryreligiouswomenaswell.Thebehaviorofsaintssuchas ElizabethofHungary(d.1231)orCatherineofGenoafindsdozensofmundaneparallelsinwomensuchasthemotherofPeterofLuxembourg(d.1387),the fourteenthcenturylaywomanMargeryKempe(d.after1438),andthefastinggirlsnoticedinpassingbysixteenthcenturybroadsidewriters.Thesecondjustification isthatthoseholywomenofwhomwehaverecords,especiallythosewhowerecanonizedorwidelyrevered,werechosenbytheircontemporariesasheroines, mirrors,andlessonsaslensesthroughwhichGod'spowerandhumanaspirationswerefocusedtowardeachother.Likeapoemorromancewhosemanuscript traditionatteststhatitwaswidelyread,womensuchasCatherineofSienareflectwhatat


leastsomeoftheircontemporariesfoundvaluableandaweinspiring.Itisthereforenotunwarrantedtotakethestoriesmostcommonlytoldaboutsaintlywomen howeveratypicalorabnormaltheymayappeartomedievalormoderncommonsenseasimportantevidenceabouttheassumptionsofthepeoplewhoadmiredthe saints.20 Finally,itshouldhardlybenecessarytocommentthatIamnotconcernedwithwhethermedievalaccountsofphenomenasuchasstigmata,levitation,miraculous bodilychanges,extendedinedia,visions,andfoodmultiplicationmiraclesare"true."Asaphenomenologistwouldsay,I"bracket"thequestionofcause,eithernatural orsupernatural,forsuchevents.IaminterestedinwhatmedievalpeopleexperiencedandwhileIhaveahistorian'sskepticismaboutallevidence,Ialso,asa historian,prefertostartmystudyofthepastwithwhatpeopleinthepastsaidthemselves.Medievalpeoplehadseveraldifferentmodelsforunderstandingphenomena suchaseucharisticvisionsorextendedandtotalabstinence.Wheretheythemselvessuggestthatwhatsomeseeasamiracleisfraudordemonicpossessionorillness, Iaminterestedintheirmodelswheretheynotethedifferencebetweenmeditationandvision,orbetweenvisionsoftheinnerandtheoutereyes,Iamcuriousabout whytheyfoundsuchdistinctionsimportant.Butwhentheydonotemploycategoriesorexplanationsthatmodernpeoplefindnecessary,Itrytoavoidsuch terminology.ThuswhenIsay,forexample,thatacertainholywomanlivedforyearswithouteating,Idonotmeantoimplythatthisstatementistrue(orfalse)by twentiethcenturystandardsofreportingorofscientificverification.Imeanthatsuchastoryinterestedmedievalpeopleenoughforthemtorecorditandthatit expressedawayoffindingvalueandgivingmeaningthatholywomen,theirchroniclers,andtheiradmirersallshared.21 Myworkhasimplicationsformodernproblemsandobsessionsthatwillnotbelostonmanyofitsreaders.Ihavetouchedontheseinmyepilogue.Ihave,moreover, triedtowriteinamannerthatisaccessibletothosewhoarenotmedievalists.Thisisnonethelessascholarly,notapopular,book.22Itisabookaboutthen,notabout now.Itisanimatedmostfundamentallyneitherbyhorrorattheproblemsofwomeninthemodernworldnorbydelightattheiradvances,whateverImayfeelofboth emotions.Mycommitment,vision,andmethodarehistoricalIintendtorevealthepastinitsstrangenessaswellasitsfamiliarity.My


pointistoarguethatwomen'sbehaviorandwomen'swritingmustbeunderstoodinthecontextofsocial,economic,andecclesiasticalstructures,theologicaland devotionaltraditions,verydifferentfromourown.Ifreadersleavethisbooksimplycondemningthepastaspeculiar,Ishallhavefailed.ButIshallhavefailedjustas profoundlyifreadersdrawdirectanswerstomodernproblemsfromthelivesIchronicle.




1 ReligiousWomenintheLaterMiddleAges
SomeofthesewomendissolvedwithsuchaparticularandmarvelouslovetowardGodthattheylanguishedwithdesireandforyearshadrarelybeenabletorisefromtheirbeds. Theyhadnootherinfirmity,savethattheirsoulsweremeltedwithdesireofhim,and,sweetlyrestingwiththeLord,astheywerecomfortedinspirittheywereweakenedinbody.... Thecheeksofonewereseentowasteaway,whilehersoulwasliquifiedwiththegreatnessofherlove.Manyhadthetasteofhoneysensiblyintheirmouthsbecauseofthegiftof spiritualsweetnessintheirhearts....Another'sflowoftearshadmadevisiblefurrowsdownherface....Othersweredrawnwithsuchintoxicationofspiritthatinsacredsilence theywouldremainquietawholeday....sothattheycouldnotberousedbyclamororfeelablow....Someinreceivingthebreadofhimwhocamedownfromheavenobtainednot onlyrefreshmentintheirheartsbutapalpableconsolationintheirmouthssweeterthanhoneyandthehoneycomb....[They]languishedwithsuchdesireforthesacramentthat theycouldnotbesustained...unlesstheirsoulswerefrequentlyrefreshedbythesweetnessofthisfood.Lettheinfidelhereticsblush,whodonotpartakeofthisfoodeitherbyfaith orbylove. JAMESOFVITRY (EARLYTHIRTEENTHCENTURY)1

ThelaterMiddleAges,especiallytheperiodfromthelatetwelfthtotheearlyfourteenthcentury,witnessedasignificantproliferationofopportunitiesforwomento participateinspecializedreligiousrolesandofthetypeofrolesavailable.Thenumberoffemalesaints,includingmarriedwomensaints,increased.Women'spiety whethermonasticorlaytookoncertaindistinctivecharacteristicsthatpowerfulmales,bothsecularandclerical,noted,sometimeswithaweandsometimeswith


suspicion.Indeed,forthefirsttimeinChristianhistory,wecanidentifyawomen'smovement(thebeguines)andcanspeakofspecificallyfemaleinfluencesonthe developmentofpiety.Ifwearetograspthesignificanceoffoodasanunderlyingthemeinwomen'sspirituality,weneedtounderstandthegeneralchangesinwomen's religiousexperiencethroughouttheperiod.2 NewOpportunities BeinganunwasalmosttheonlyspecializedreligiousroleavailabletowomenintheearlyMiddleAges.(Canonesses,whoappearedintheCarolingianperiod,were similartonunsbuttooklessstrictvowsofpoverty.)Thehistoryofearlymedievalnunsisacomplexone,andrecentresearchsuggeststhattherewasmorevariation overtimethanearlierhistoriansnoticed,bothintheinfluenceofnunneries(andabbesses)onthesurroundingsocietyandinsociety'srespectforthepietyofmarried laywomen3 .Buthoweverpowerfulcertainearlymedievalladiesmayhavebeeneitherasabbessesorassaintlyqueens,specializedreligiousrolesforwomenwere usuallyrestrictedtothehigharistocracy.InthetenthandearlyeleventhcenturiesagrimperiodofwarandhardshipforwesternEuropefewfemalemonasteries werefounded,andreligiousleadersshowedlittleconcernforencouragingwomen'sreligiosity.Themajormonasticreformoftheperiod,Cluny,foundedscoresof malemonasteriesbutonlyonehousefornunsbefore1100,anditspurposewastoprovidearetreatforwomenwhosehusbandswishedtobecomeCluniacmonks.4 AlthoughwehavenoideawhatproportionofthepopulationofmedievalEuropebelongedtoreligioushouses(or,indeed,whatthesizeoftheEuropeanpopulation was),wearecertainthatbefore1200,monksvastlyoutnumberednuns.5 Overthecourseofthetwelfthandthirteenthcenturies,especiallyintheRhinelandandLow Countries,thisratiobegantochange.6 Theproliferationinthelateeleventhandtwelfthcenturiesofwanderingpreacherswhoattractedbandsoffollowersdeterminedto"imitatetheapostoliclife"inpoverty andpenitencehadsuchasignificantimpactonwomenthatcontemporarychroniclerscommentedonthephenomenon,withasmuchtrepidationasadmiration.7 WomenflockedafterwanderingevangelistssuchasNorbertofXanten(d.1134)andRobert


ofArbrissel(d.11161117),andthesepreachersambivalentaboutitinerantpreachingevenforthemselvesandclearlyhostiletoitasaformoffemalepiety foundedmonasteriesforthem.Socalleddoublemonasteries(i.e.,communitieswithbothmaleandfemalehouses,oftensidebyside)emergedagaininEngland,where therewasalsoasignificantincreaseinthenumberoffemalerecluses(womenwhovowedthemselvestoalifeofwithdrawalinlittlecellsattachedtochurches).Onthe continent,twoofthemostprestigiousnewordersofthetwelfthcentury,thePremonstratensiansandtheCistercians,foundthenumberofwomen'shousesintheir ranksgrowingatanalarmingrate.Thestoryoffemaleenthusiasminstitutionalizedasstrictmonasticismrepeateditselfintheearlythirteenthcentury,whenClareof Assisi(d.1253)triedtofollowFrancisinthemendicant(i.e.,begging)lifebutwasforcedtoacceptastrictlycloisteredrole. Womenwerenotonlyfollowers,manipulatedandcircumscribedintheirreligiousidealsbypowerfulclerics,theywerealsoleadersandreformers.Inthethirteenth century,whenBenedictinemonasticismformenwaseclipsedbythemendicantmovement(i.e.,thefriars),anItalianwoman,SantucciaCarabotti,foundedaconvent nearGubbio,enforcedastrictinterpretationoftheBenedictineRulethere,andlaterreformedandsupervisedtwentyfourothermonasteries,takingthemunderher direction.8 IntheearlyfifteenthcenturyColetteofCorbie(d.1447),whobeganherreligiouslifeasahermit,reformedmanyconventsofPoorClaresinFranceand Flandersandfoundedothers.9 Therapidgrowthofwomen'shousesstrainedtheresourcesoftheneworders,whichhadtoprovideclergyforthewomen'sspiritualdirectionandsacramentalneeds. ThePremonstratensianswerethefirsttopasslegislationcurtailingwomen'smonasteriestheCisterciansfollowed.AsR.W.Southernhasmadeusaware,misogyny amalefearoffemalesexualitythatwasaprojectionofmalefearofmalesexualitywassometimesthearticulatedmotiveforsuchrepression.Thenotoriousopinion, attributedtothePremonstratensianabbotConradofMarchtal,that"thewickednessofwomenisgreaterthanallotherwickednessoftheworldand...thepoisonof aspsanddragonsismorecurableandlessdangeroustomenthanthefamiliarityofwomen"maybespurious.Butanumberoftwelfthcenturymonasticleadersfeared thatcelibatemaleswouldbecontaminatedbywomenandwerewillingtolimitwomen'sreligiousopportunitiesinordertoprotectfragilemalevirtue.Bernard


ofClairvaux(d.1153)warnedhismonks:"Tobealwayswithawomanandnottohavesexualrelationswithherismoredifficultthantoraisethedead.Youcannotdo thelessdifficultdoyouthinkIwillbelievethatyoucandowhatismoredifficult?"10 Recentresearchhas,however,shownthatmalereluctanceandoppositiondidlittletoslowthegrowthofwomen'sreligiouslife.11Ineasternareas(suchasFranconia andBavaria),womenevencontinuedtoattachthemselvestothePremonstratensianorder.12TheCisterciandecreeof1228forbiddingtheincorporationofanymore conventsremainedadeadletter,andthroughoutthethirteenthcenturyCisterciannunneriesproliferated(oftenwithsupportfromlocalDominicans)intheLow CountriesandthelowerRhineland.Althoughsomemonks,canons,andfriarsdidresisttakingresponsibilityforthepastoralcareofnuns,somereligiousauthorities, frompopestolocalclergy,andsomeprominentlaymensupportedandendowedwomen'shouses.13BothSantucciaandColettereceivedsignificantsupportfrom popesandpapallegates.Inthethirteenthandearlyfourteenthcenturies,thesewomen'smonasteriesformedinfluentialspiritualnetworksamongthemselvesand producedcollectionsofthesisters'livesandvisionsthatwereoftenreadinbothfemaleandmalehousesasaformofspiritualinstruction.14InsomepartsofEurope, wheremalehousesdeclinedfairlysteadilybothineconomicbaseandinreligiousfervor,nunswereamajorityofthecloisteredreligiousbythefifteenthcentury.15 InthetwelfthandthirteenthcenturiesnewformsofreligiouslifeforwomenappearedalongsidetheoldBenedictinenunneriesandthefemalemonasteriesofthenew orders.Someofthesereligiousopportunitieswereheterodox,andhistoriansarestilldebatingtheextenttowhichwomenwereproportionatelyoverrepresentedinthe majorheresiesofthetwelfththroughthefourteenthcentury.16Althoughtheseheresiessharedmanycharacteristics,scholarsusuallydividethemintothreegroups: dualists,antisacerdotalreformers,andaberrantmystics.Thefirstgroup,knownasCatharsorAlbigensians,appearedprimarilyinthesouthofEuropeandrapidly cametofollowanindependentandalternativereligionbasedonatheologyofabsolutedualism.IncontrasttothemonismoforthodoxChristiantheology,Cathars believedtherewasawarinthecosmosbetweengoodandevilandaparallelwarintheindividualbetweenspiritandflesh.Thesecondgroup,whichincludedsuch movementsastheWaldensians,theHumiliati,theNewApostles


ofGerardSegarelli,andlatertheLollards,werereformerswhosepuritanicalzealbecameanticlericalismandthen,underthepressureofpersecution,denialofthe sacraments.17Thethirdgroup,whichemergedasathreatintheearlyfourteenthcentury,wasknownastheFreeSpirit.18Theseindividualscarriedpersonalmystical experiencetothepointofantinomianism(therejectionofallrulesandexternalreligiouspractices)andselfdeification.Butthecontemporarynotionthattheywerea formalmovement,akindofconspiracy,mayhavebeeninlargepartafantasygeneratedbyorthodoxfearoftheimplicationsofmysticism. Itseemsclearthatwomenwerepowerfullydrawntosuchmovements,atleastuntiltheytoodevelopedhierarchicalstructuresthattendedtoexcludefemaleleadership. Butitalsoseemsclearthatthesemovementswhichwereofteninitiallylabeledheresiesforreasonsofecclesiasticalpolitics,notdoctrineexpressedmanyofthe basicthemesfoundinwomen'sreligiosityinitsorthodoxforms:aconcernforaffectivereligiousresponse,anextremeformofpenitentialasceticism,anemphasisboth onChrist'shumanityandontheinspirationofthespirit,andabypassingofclericalauthority.19Thuswomenmayhaveflockedtotheheresiesnot(assomehave argued)becausetheyfeltneglectedbyoralienatedfromthechurchbutbecausecertainspiritualimpulsesthatcharacterizedbothheterodoxandorthodoxmovements appealedespeciallytowomenandweregeneratedinsignificantpartbythem. Indeed,thesameimpulsesthatissuedinthevarioushereticalmovementswerethesourceofnewquasireligiousrolesforwomenwithinthechurchrolesthatwere notsomuchnovelinstitutionalarrangementsassimplywaysofgivingreligioussignificancetowomen'sordinarylives.InthenorthofEurope(especiallynorthern France,theLowCountries,Switzerland,andtheRhineland),wefindwomencalledbeguines.(Theetymologyofthewordisdebatedbutitmaybeaslur,derived fromAlbigensian,i.e.,heretic.)Thesewomensetthemselvesapartfromtheworldbylivingaustere,poor,chastelivesinwhichmanuallaborandcharitableservice werejoinedtoworship(whichwasnot,however,rigidlyprescribedasitwasinconvents).Initially,atleast,theirpracticecontrastedsharplywithtraditional monasticism,sincetheytooknovowsandhadnocomplexorganizationandrules,noorderlinkingthehouses,nohierarchyofofficials,nowealthyfoundersorleaders. InthesouthofEurope(especiallyItaly),wefind,parallelingthebeguincs,thetertiariesindividualswholivedintheworldbutwereaffiliated


withoneofthegreatmendicantorders(usuallyFranciscanorDominican)andfollowedalifeofpenitentialasceticism,charitableactivity,andprayer.InSpain,women insuchquasireligiousstatuseswereknownasbeatas.And,alloverEurope,evenordinarylaywomensometimesfound,throughpilgrimage,awayoftemporarily settingthemselvesofffromthedemandsoftheworldinaspecialreligiousroleofdevotion,service,andpenitence.20Althoughthereisnowayofestimatingthe numberofwomeninEuropewhoadoptedsuchquasireligiousstatus,statisticsforafewnortherncitiessuggesthowpopularthevocationwas.Thethousandwomen livinginbeguinecommunitiesinColognein1320accountedforabout15percentoftheadultfemalepopulation(andthisfigureexcludesbeguineslivingalone).In StrasbourgandBasel,othercentersofthemovement,beguinesaccountedforabout2.5percentofthetotalpopulationinthesameperiod.21 Earlyinourowncentury,somehistoriansarguedthatthewanderingevangelistsofthetwelfthcentury(heterodoxandorthodox)andthemendicants,tertiaries, beguines,andFreeSpiritsofthethirteenthandfourteenthcenturiesrepresentedmovementsofprotestbythenewurbanlowerclasses.22Thesehistorianssawtertiary andbeguinegroupsasfemaleguilds,withessentiallyeconomicfunctions.Morerecently,scholarshavetakenthereligiousnatureofsuchmovementsseriouslyandhave disprovedtheclaimsofpredominantlylowerclassmembership.Butitseemsclearthatthenewgroupscanbeassociatedwithspecificsocialstatuses.Althoughthe newordersandmovementsofthetwelfthcenturybeganwitharistocraticclericsandrecruitedfrombothtownandcountryside,thirteenthcenturybeguines,tertiaries, andeventosomeextentCisterciannunstendedtobedrawnfromthenewbourgeoisieorfromalowernobilityassociatedwiththetowns.Thuswomenwhojoinedthe newtypesofreligiouslifeavailableinthethirteenthandfourteenthcenturiesoftencamefromsocialgroupsthatwererisingandcanbeshowntohavefeltanxietyabout theirnewwealthandstatus.Theiridealastheirmostdistinguishedhistorian,HerbertGrundmann,pointedoutyearsagowasnotsimplyausteritybut,rather, renunciationofcomfortandwealth.Womenfromtheoldnobilitywereapttojointraditionalmonasticestablishments(Benedictinenunneriesorhousesof canonesses),whichrequiredlargedowriesfromentrants.23 Twoexplanationsfortheemergenceofnewtypesoffemalereligiouslifehaverecentlybeenpopular.Onesuggestsdemographiccauses:reli


giouswomenwerethedaughtersforwhomnohusbandscouldbefound.24Theotherexplanationarguesthatthewomenwhobecamebeguines,tertiaries,orheretics weresimplyareligioussurplus,leftonthefringestoattemptsomekindofquasireligiouslifeafterCistercianandPremonstratensiandoorsclosedandthefriarsshowed reluctancetoexpandtheirpastoratetolargenumbersofnuns.25Bothexplanationsareplausible.Demographicfactorsinfactlaybehindalllatemedievalreligious movements.Thestructureofthemedievalfamilyandofinheritancepatternsnecessitatedalternativestotheroleofmarriageandprocreationforalargeportionofthe population.Andinthethirteenthandfourteenthcenturiesthevalueofdowrieswentupsharply,makingthemarriageofdaughters(oreventheendowingofaplacefor theminoneofthetraditionalmonasteries)sometimesprohibitivelyexpensive.Contemporariesthemselveswereawareofsuchsocialmotives.Adocumentfromearly fourteenthcenturyGhentstatesthat,ahundredyearsearlier,

JeanneandhersisterMargaret,successivecountessesofFlandersandHainault,observedthatthesecountiesteemedwithwomenwhoweredeniedsuitablemarriagesbecauseof theirownsituationorthatoftheirfriends,andthatdaughtersofrespectablemen,ofbothnobleandordinarybirth,desiredtolivechastelyinmonasteriesbut,onaccountofthe numbersofthemorofthepovertyoftheirparents,wereunabletodosoeasily.Furthermore,respectabledemoisellesandimpoverishednoblewomenhadtobegorpursuealife embarrassingtothemselvesandtheirkinunlessaproperremedywasprovided.Thus,underdivineinspiration,orsoitispiouslybelieved,theyroundedinvariouspartsof Flanders,havingfirstsoughtthecounselandapprovalofdiocesanandotherworthyauthorities,spaciousplacescalledbeguinages[quevocanturBeghinarumcurie].Herethese women,girls,ordemoiselleswerereceivedtopreservetheirchastitybyvoworwithoutvowandtoprovidethemselveswithfoodandclothingwithoutembarrassmentto themselvesorthecontrivingoftheirfriends.26

Moreover,themaleresistancetothepastoralcareofreligiouswomenthatisreflectedinthePremonstratensianandCisterciandecreesreferredtoabovecontinuedin thefourteenthandfifteenthcenturies.27 Yetitseemswrongtointerpretthebeguines,tertiaries,andfemalehereticsofthelaterMiddleAgesassurpluswomen,settlingforquasireligiousrolesbecauseneither husbandsnormonasteriescouldbefound.Onthecontrary,saints'livesincludemanycaseswherenoblewomenwho


couldhaveaffordedtoentermonasteriesinsteadchosebeguineortertiarystatus.TherecentresearchofJohnFreedhasdemonstratedthat,farfrominhibitingthe growthofnunneries,friarsandlocalclergyoftenencouragedthem.Itisnotclearthattherewasagreatshortageofplaces,atleastinCistercianconvents.28Itthus appearsthatthebeguineswerelessanunintendedresultofpastoralnegligencethananewandattractivealternativetotraditionalcloisteredlife.Moreover,formany girls,itwasthepresence,nottheabsence,ofaprospectivebridegroomthatactivateddesireforperpetualchastity.Althoughsomeyoungwomenunquestionably desiredtoleavemonasteriestowhichtheyhadbeengiven,therewerealsomanydaughtersforcedintomarriageorthreatenedwithitwhosawtheconventasan escape.Thedangersofchildbirthandthebrutalityofmanymarriagesdisadvantagespointedoutbymedievalmoralistsledsomewomentoprefercelibacy. Virginitywasnot,however,merelyameansofescapefromfamily.Itwasseenbybothmenandwomenasapositiveandcompellingreligiousideal.29Setapartfrom theworldbyintactboundaries,herfleshuntouchedbyordinaryflesh,thevirgin(likeChrist'smother,theperpetualvirgin)wasalsoabride,destinedforahigher consummation.Shescintillatedwithfertilityandpower.Intoherbody,asintotheeucharisticbreadonthealtar,pouredtheinspirationofthespiritandthefullnessof thehumanityofChrist. Theperiodfrom1100to1400sawnotonlythecreationofnewtypesofreligiouslifeforwomenbutalsoanincreaseinthenumberoffemalesaintsaclearindication ofthegrowingprominenceofwomenbothinreflectingandincreatingpiety.Ofcourse,therewasalwaysresistanceonthepartofchurchauthoritiestothe canonizationofwomen.Althoughthenumberofcanonizationinquiriesforwomenrose,aconsistentlysmallerpercentageoffemalesthanofmalesconsideredfor canonizationactuallyachievedit.30Nonetheless,recentscholarlyinvestigations,bothofactuallycanonizedsaintsandofthosewhoweresimplypopularlyrevered, suggestthattheproportionoffemalesaintsrosefromlessthan10percentintheeleventhcenturytoabout28percentinthefifteenth.AccordingtoWeinsteinandBell, thebigrisecamebetweenthetwelfthandthirteenthcenturies,whenthepercentageoffemalesaintsalmostdoubled(from11.8to22.6percent).Thetrendpeakedin thefifteenthcentury(at27.7percent),despitethefactthatthetotalnumberofsaintsdeclined.Inthesixteenthandseventeenthcenturies,when



Notonlydidthepercentageoffemalesaintsclimbbetweenthetwelfthandthirteenthcenturiesthepercentageofmarriedsaintsroseaswell.32Throughouttheperiod, womenrepresentedaconsistentlyhigherpercentageofthemarriedsaintsthandidmen,althoughWeinstein,Bell,andVauchezsuggest,onthebasisofqualitative evidence,thatanewambivalenceaboutmarriageemergedinthefifteenthcentury.33Theriseinthenumberandpercentageofwomensaintscorrelatesalsowitha broadeningoftheclassbaseofsaints(althoughahigherpercentageofsaintlywomenthanofsaintlymenwereupperclass)andwithanincreaseinthepercentages bothofsaintsfromurbanareasandofsaintsaffiliatedwithmendicantorders(althoughthecanonizationofmendicantwomenalwaysmetwithstiffresistance).34 Theriseofthewomansaintcorrelatesmostdramatically,however,withtheriseofthelaysaint.Indeed,bytheendoftheMiddleAgesthelaymalesainthadvirtually disappeared.Nuns(theonly''nonlay"femalerole)continued,ofcourse,tobecanonizedbutbythesixteenthcenturyalmostallthemalescanonizedwereclerics,and themodelofholybehaviorofferedtotheCatholiclaitywasalmostexclusivelyfemale.AccordingtoVauchez,50percentofthelaitycanonizedinthethirteenth century,and71.4percentofthosecanonizedafter1305,werefemale.35 Connectedtotheemergenceofnewquasireligiousopportunitiesforlaywomenandtotheincreasingvenerationofcertainlaywomenasholyweretwoothertrends: thedeclineanddisappearanceofquasiclericalrolesforwomen,andtheincreasedsuspicion,fromtheearlyfourteenthcenturyon,ofexactlythosepropheticand visionarypowersofholywomenthatcontrastedmostsharplywithmaleclericalauthority,basedasitwasonordination.36Inthechurchofthetenthtothetwelfth century,womendidexercisesome"clerical"roles:preaching,hearingconfessionsfromnunsunderthem,bestowingblessings,andsometimesadministeringcommunion tothemselvesinritualsknownas"masseswithoutpriests."37Butsuchthingswereincreasinglycriticizedandsuppressed.ThedecretalistBernardofParma,inhis commentary(ca.1245),arguedthatwhatevermightbefoundinearlierpracticewomencouldnotteachorpreach,touchsacredvessels,veilorabsolvenuns,or exercisejudgmentandthat"ingeneral,theofficeofamanisforbidden


towomen."38ThepowerfulabbessesoftheearlyMiddleAgesareseldomfoundinthelaterperiod.Thosedoublemonasteriesoverwhichwomenruledhadmostly beeneliminatedbythethirteenthcentury.Althoughwomenintheworldwhowerereveredassaintsweremorelikelythansaintlymentocomefromthehighestsocial ranks,thosereveredwithinmonasteriesorbeguinageswereoftennotabbessesorprioressesbut,rather,ordinarysistersblessedwithparamysticalandvisionary experiences.39 Thus,fromthethirteenthcenturyon,wefindreligiouswomenlosingrolesthatparalleledorapedmaleclericalleadershipbutgainingboththepossibilityofshapingtheir ownreligiousexperiencesinlaycommunitiesandaclearalternativethepropheticalternativetothemalerolebasedonthepowerofoffice.Itisworthnotingthat suchatrendparallelsseculardevelopmentsinthesameperiod.Betweenthetwelfthandfourteenthcenturies,aristocraticwomen'sabilitytomanagelargeestatesand toruledeclinedwhileordinarywomenclearlygainedopportunitiesforindependenceandeconomicprofitinthesmallcrafts,shops,andbusinessesofthenew towns.40Suchcomplexchangesinthekindsofopportunitiesandsourcesofauthorityavailabletowomen,aswellasinthekindsofwomenforwhomopportunities wereavailable,makegeneralizationsabout"thestatusofwomen"statementstowhichhistorianshavesometimesbeentemptedpresumptuousandilladvised.41 Thefemalereligiousrolehadonlytobecomeclear,however,tobemetwithsuspicion.Aftertheearlyfourteenthcentury,theformsandthemesofwomen'sreligiosity arousedincreasedhostility.In1310awomanmystic,MargaretPorete,wasaccusedoftheFreeSpiritheresyandburnedinParis.Thebeguinesweresuppressedby theCouncilofViennein13111312,althoughthedecreeremainedunenforcedforseveralyearsand,aftermidcentury,thewomen'smovement(inafarmore "monasticized"i.e.,institutionalizedform)wasonceagainpermitted.Thespiritualfriendshipsandnetworksofthirteenthandearlyfourteenthcenturywomen attenuatedasthefourteenthcenturyworeon.Collectivebiographiesofwomenbywomendisappeared.42Fewerholywomenwrote.Malesuspicionofvisionary womenwasarticulatedinaseriesofinfluentialworks,byJohnGersonandothers,onthetestingofspirits.43Inlatefourteenthandfifteenthcenturyhagiography,holy womenappearmoreandmoreisolatedandmaleoriented.Theirstoriesarenowusuallytoldbytheirconfessors,whomtheydominateasspiritual


mothersandclingtoasvulnerableadvisees,needfulofaguaranteeoforthodoxy.Althoughholywomenwere,bythefourteenthandfifteenthcenturies,morelikelyto belayandmarried,toresideintheworld,andtohaveopportunitiesforsignificantgeographicalmobilitythroughpilgrimage,theywerealsomoresubjecttomale scrutinyandingreaterdangerofbeingaccusedofheresyorwitchcraft.BythetimeofCatherineofSiena,BridgetofSweden,andJoanofArctheinfluenceeventhe survivalofpiouswomendependedalmostwhollyonthesuccess,inecclesiasticalandsecularpolitics,oftheirmaleadherents.44 Suspicionofpropheticwomenreflectedthegeneralfourteenthcenturysuspicionofpopularreligiousmovementsandofmysticism.Theperiodwasoneofdeep hostilitytovisionaryandmysticalmalesaswell.Buttheambivalenceofchurchauthoritiesandtheologiansaboutwomenmysticsalsoreflectedvirulentmisogynya misogynythatissuedbothintheactualwitchaccusationsandinthewitchhuntingtheologyofthefifteenthcentury.By1500,indeed,themodelofthefemalesaint, expressedbothinpopularvenerationandinofficialcanonizations,wasinmanywaysthemirrorimageofsociety'snotionofthewitch.45Eachwasthoughttobe possessed,whetherbyGodorbySataneachseemedabletoreadthemindsandheartsofotherswithuncannyshrewdnesseachwassuspectedofflyingthroughthe air,whetherinsaintlylevitationorbilocation,orinawitches'Sabbath.Moreover,eachboremysteriouswounds,whetherstigmataorthemarksofincubi,onherbody. Thesimilarityofwitchandsaintatleastintheeyesofthetheologians,canonlawyers,inquisitors,andmalehagiographerswhoare,bythefifteenthcentury,almost ouronlysourcesfortheirlivessuggestshowthreateningbothweretoclericalauthorities.46Woman'sreligiousroleasinspiredvesselhadcometoseemutterly differentfromman'sroleaspriest,preacher,andleaderbyvirtueofclericaloffice.Andbecauseitseemedsodifferent,ittitillatedandwasbothencouragedand feared. FemaleSpirituality: DiversitiesandUnity Canonesses,nunsofoldandneworders,beguines,tertiaries,recluses,Cathars,Waldensians,pilgrims,ordinarylaywomeninshopsandkitchensthereweremany kindsofpiouswomeninlatermedievalEurope.Yettheincreasinglysharpcontrastbetweenlayfemalesaintandclerical


malesaintsuggeststhatbehindthewidevarietyofwomen'srolesaunitycanbefound.Andwecaninfactdelineatesomeconsistentdifferencesbetweenmaleand femalereligiousexperiences.47 Atleastsomeofwomen'sformsoflife(e.g.,tertiaries'andbeguines')werelessinstitutionalizedthanmen's.Indeed,thetendencyoflaterhistorianstoidentifypious womenwithaparticularorderhasobscuredtheextenttowhich,especiallyinthethirteenthcentury,institutionalaffiliationandstructurewere,towomen,unimportant orconstantlychanging.48ThethirteenthcenturysaintJulianaofCornillon,forexample,wanderedfromreligioushousetoreligioushousehercontemporary,Christina theAstonishing(ChristinaMirabilis)despitelatereffortstoclaimherasBenedictine,Cistercian,orPremonstratenstratensianwassimplyalaywomanseekingto followChristandthesaintsMargaretofYpres(d.1237),althoughontheedgeofDominicancircles,soughtnotaparticularorderwithitsarticulatedgoalsbutamale protectorwhomshecouldlove.49Theveryfactthatmalechroniclersfelttheyoughttotellthestoryofthefoundingofthebeguinesasifthe"order"hadaleaderanda rulelikethoseofcontemporarymonasticormendicantorderssuggeststhatwomen'smoreinformalarrangementsforgivingreligioussignificancetoordinarylife seemedoddanddangeroustomalesensibilities. Moreover,thelifepatternsofholywomenshowbasicdifferencesfromthoseofmen.Intheirrecentquantitativestudyofsaints'lives,WeinsteinandBellhave demonstratedthatingeneral,women'ssaintlyvocationsgrewslowlythroughchildhoodandintoadolescenceadisproportionatepercentageoffemalesaintswere certainoftheircommitmenttovirginitybeforeageeight.Despitethefactthatbothchastityandmaritalstatusweremoreprominentthemesinthevitae(writtenlives)of womenthanofmen,malesaintsweremorelikelytoundergoabruptadolescentconversions,involvingrenunciationofwealth,power,marriage,andsexuality.Crisis anddecisivechangeweremoresignificantmotifsinmalethaninfemalevitaethroughoutthelaterMiddleAges,50inpartbecausemedievalmenhadmorepowerthan womentodeterminetheshapeoftheirlives.Forexample,MaryofOigniesandClareofAssisi,wishingtorenounceproperty,werevirtuallyforcedtoretainincome andservantsMargaretofCortona,UmilianadeiCerchi(d.1246),andAngelaofFoligno(d.1309)hadtowaitfortheirhusbandsorloverstodiebeforetheycould espousechastitythevisionaryJulianaofCornillonandthe


holyinvalidLidwinaofSchiedam(d.1433)wereascruellypersecutedandneglectedattheendoftheirlivesasduringthechildhoodandadolescentstirringsoftheir vocations.51Indeed,hagiographersoperatedwithasomewhatinconsistentdoublemodelofthefemaleadolescent.Thevirtuousgirlmightdemonstratehervirtue eitherbyheroicallyinsistingonchastity(andtherebyrebellingagainstherfamily)orbyobedientlymarryingatherparent'scommand(andtherebyretreatingfromwhat thechurcharguedtobeahighergood).Frequently,insaints'lives,shedidbothwithnoexplanationofwhatthechangefromonebehaviortotheothermeanttoher orcosther.52 Itisbecausewomenlackedcontrolovertheirwealthandmaritalstatusthattheirlifestoriesshowfewerheroicgesturesofcastingasidemoney,property,andfamily. Butwomen'slivesalsoseemtobecharacterizedbyearliervocationsbycontinuityratherthanchangebecause,asweshallseebelow,menandwomentendedto tellstories,tousesymbols,andtounderstandinnerdevelopmentaccordingtodifferentmodels.Menwereinclinedtotellstorieswithturningpoints,tousesymbolsof reversalandinversion,andtoexternalizemotivesinevents(particularlywhentalkingaboutmen).Womenmoreoftenusedtheirordinaryexperiences(of powerlessness,ofserviceandnurturing,ofdisease,etc.)assymbolsintowhichtheypouredeverdeeperandmoreparadoxicalmeanings.Womentendedtotellstories anddeveloppersonalmodelswithoutcrisesorturningpoints.53Andbothmenandwomensawfemalesaintsasmodelsofsufferingandinnerspirituality,malesaintsas modelsofaction.54 Whenwecomparethewritingsaswellasthevitaeofmenandwomen,wefindnopiouspracticesordevotionalthemesthatareexclusivelyfemaleorexclusively male,althoughtherearecertainmiraclesthatoccuronlytopriests(becausetheyareconnectedtosacerdotalfunctions)andcertainmiracles(e.g.,stigmataorbodily elongation)thatoccurfarmorefrequentlytowomen.55MenandwomenoftenthoughtinthesamemetaphorssincetheyreadthesameScripturesandspiritual treatisesandoftenheardthesamesermonsandevenspiritualthemesthatmoderncommentatorshaveassumedtobegenderspecificarefoundinthevisionsand writingsofbothsexesintheMiddleAges.Forexample,ifwomenmoreoftenhadvisionsofnursingtheChristchild,thereisatleastonemonkwhoreceivedthebaby athisbreastifmenmoreoftennursedfromtheVirgin,somewomentoowerefedwithMary'smilk.56


Butrecentcomparativestudyofvisionliterature,saints'lives,andmysticaltreatisesbywomenandmensuggeststhatthepatternsofmalepietydifferfromthoseof femalepiety. Mysticismwasmoreprominentinwomen'sreligiosityandclaimstosanctitythaninmen'sandparamysticalphenomena(trances,levitation,stigmata,etc.)werefar morecommoninwomen'smysticism.Thereputationsofholywomenweremoreoftenbasedonsupernatural,charismaticauthority,especiallyvisionsandsupernatural signs.Women'sdevotionwasmorecharacterizedbypenitentialasceticism,particularlyselfinflictedsuffering.Women'swritingwas,ingeneral,moreaffective,although malewritingtoobrimsoverwithtearsandsensibilityerotic,nuptialthemes,whichwerefirstarticulatedbymen,weremostfullyelaboratedinwomen'spoetry.And certaindevotionalemphases,particularlydevotiontoChrist'ssufferinghumanityandtotheeucharist(althoughnot,asisoftensaid,totheVirgin),werecharacteristicof women'spracticesandwomen'swords.57(Someofthesedifferencesbecomeimportantinthechaptersthatfollow.) Indeed,recentscholarshipsuggeststhatdifferencesbetweenthesexesoverrideallotherfactors(suchaschronologyorsocialandeconomicstatus)inshaping women'spiety.Apiouspeasantwomanandapiousnobleoneweremorelikeeachotherinreligiositythaneitherwaslikethemalesaintofequalsocialstatus.58But differencesamongwomencanalsobedelineated.Recentwork,forexample,suggestscertainregionalpatterns.ScholarssuchasWeinstein,Bell,Vauchez,and KieckheferagreethatwomensaintsinthenorthofEuropeweremorearistocraticandcontemplative,morelikelytobenunsorreclusesandtofindabasisfortheir sanctityinwithdrawalandprayer.FemalesaintsinthesouthofEurope,particularlyItaly(whichaccountedforaboutathirdofthesaintsofthelaterMiddleAges), tendedtobeurban,middleclass,andmoreactiveinworksofcharity.ReclusesweremorecommoninEnglandmysticalcommunitiesinwhichmanynunsexperienced thesameorsimilarvisionsweremorecommonintheRhineland(especiallyinthethirteenthcentury)charitableservice,particularlycareofthepoorandsick,was especiallycommonamongItalianwomenaffiliatedwiththeDominicanandFranciscanorders.59 Moreover,thereweredifferencesinwomen'sspiritualitythatstemmedfromtheirdifferentreligiousstatusesandlifeexperiences.Astudyofwomen'sownwritings suggeststhatwomenwholivedintheworld


(eitherastertiariesandbeguinesoraslaywomen)andwomenwhoconvertedasadultsdifferedfromnunsraisedinconventsbyhavingasharpersenseofmale/female differences,asenseof"thefemale"closertothenegativestereotypefoundinthemisogynistclericaltradition,andalessintensesenseofcommunity.Theyweremore awareoftheprohibitionofsacramentalfunctionsandteachingtowomen,morelikelytoseethefemaleasweakandvulnerable,moremaleoriented(i.e.,more dependentonconfessorsorpowerfulmalereligiousleaders,nottomentionhusbandsandfathers),andmoreconcernedwithmalepowerandmaleroles(althoughthe concernwasoftenacritique).Forexample,thethirteenthcenturyItaliantertiaryAngelaofFolignospokefarmorefrequentlyofherspiritual"sons"thanofanyfemale companions.Convertedasanadultafterthedeathsofhermother,husband,andchildren,Angelachanneledhermaternalandspiritualimpulsesintocriticizingand advisinglocalfriars.TheGermanbeguineMechtildofMagdeburg,whofledherfamilyandfriendsinyoungadulthood,directedherconsiderablerhetoricalabilities towardcastigatingthelocaldiocesanclergyandfriars.ThetwelfthcenturyrecluseChristinaofMarkyate,whoranawayonherweddingnight,receivedmostofher visionsandpropheciesforthebenefitofpowerfulmales.Andinthefourteenthandfifteenthcenturies,thetertiaryCatherineofSienaandlaywomenasdifferentas BridgetofSweden(lateranun)andJoanofArcwereadvisersandleadersofmen.60 Incontrast,womeninconventsandbeguinages,especiallythosewhohadbeenraisedthere,hadastrongsenseofspiritualnetworksorfamiliesofwomen.Michael Goodichhaspointedoutthatmysticalwomeninthethirteenthandearlyfourteenthcenturies,especiallyinGermanyandtheLowCountries,existedinclusters, whereasmalemysticsweremoreoftenisolatedandlessinfluential.Socommonhadtheclusteringofmysticalwomenbecomebytheearlyfourteenthcenturythat contemporariestendedtoreverehouses,likeTossandEngelthal,ratherthanindividuals.61Forthosewhohadexperiencedsuchcommunity,liketheFlemishbeguine Hadewijch,whowasevictedfromherbeguinage,thegrievingforformercompanionswasintenseandneverhealed.62 Weshouldnot,however,maketoomuchofregionaldiversity,ofcontrastsbetweennunsandquasireligious,orofdifferencesbetweenchildoblatesandadult converts.CertaintownsofthethirteenthcenturyLowCountriesandRhinelandproducedapietymorelikethatofthe


ItalianfemaletertiariesthantheworkofVauchez,Weinstein,andBellsuggests.63Thesharpcontrastbetweenamorecontemplativeandmysticallifefornorthern womenandthemoreactivecharitypracticedinthesouthblurswhenwereadwomen'sownwordsandfindthatastressonserviceandecstaticencounterunderlies bothkindsoflives.64Moreover,howeverquerulousandapologeticsomemedievalwomenoccasionallyseem(andthisqualitybecomesmorepronouncedinthe fifteenthandsixteenthcenturies),theydifferedfromoneanotherrelativelylittleinselfimage,andtheirvulnerabilityseldominhibitedtheconfidencewithwhichthey approachedGod.CloisteredwomenwereaslikelyaswomenintheworldtousegraphicdomesticimagesforselfandGod.65WomensuchasGertrudeofHelfta(d. 1301or1302)whoenteredtheconventastinygirlsequaledwomenintheworld,suchasGertrudevanOosten(d.1358)orMargeryKempe,intheirmaternal tendernesstowardthebabyJesusandtheireroticyearningstowardthebeautifulyoungChrist.66And,whileitistruethatnunsweremorelikelytouseimagery androgynouslyandtoadviseotherswithselfconfidence,tertiariesandlaywomeninfactcastigated,counseled,andcomfortedothersjustaseagerlyandeffectively. Moreover,whatevertheirstatusordegreeofvulnerability,religiouswomenfeltnonecessitytoacquiremetaphoricalmalenessinthecourseoftheirspiritualjourney.67 Malebiographersfrequentlypraisedwomenforspiritual"virility,"andwomensuchasCatherineofSienasometimesurgedotherwomen(andmen)tobehave "manfully."68Butwomen'smostelaborateselfimageswereeitherfemale("mother"tospiritualchildren,"bride"ofChrist)orandrogynous(''child"toaGodwhowas motheraswellasfather,"judge"and"nurse"tothesoulsintheirkeeping). Mostofourinformationonlatemedievalwomencomesfrommalebiographersandchroniclers.Theproblemofperspectiveisthusacute.Someofthestoriesmen lovedtotellaboutwomenreflectednotsomuchwhatwomendidaswhatmenadmiredorabhorred.Forexample,CaesariusofHeisterbach,writinginthethirteenth centuryformaleCistercians,presentedacollectionofexempla(moraltales)organizedaccordingtotypesofChristianvocation.Writingaboutconfessors,Caesarius simplyexplainedwhatexperiences,especiallymiraclesandvisions,happenedtoconfessors(allofwhomweremale).Butwhenheturnedto"theorderofvirgins"(by whichhemeantfemalevirgins),hisaccounttookacuriousturn.Apparentlyunconsciously,heslippedintowriting


notaboutthevisionsandmiraclesthathadoccurredtothevirgins(onlytwostoriesoutofnine)butaboutvirginswhohadappearedinvisionstomen(theremaining sevenstories).ItisalmostasifCaesariuscouldnotimaginethewomenortheirvirginitybeingimportanttothemselves.69 Malebiographersromanticizedandsentimentalizedfemalevirtuefarmorethanmale,especiallybydescribingit(asdoesJamesofVitryinthepassagequotedabove asepigraph)inheightenedanderoticimagery.70Theywerealsofarmorelikelytoattributesexualorbodilytemptationtofemalenaturethantomale(men'ssexual yearningscouldalwaysbeblamedonthepresenceofwomenastemptresses)andtoseewomenstrugglingunsuccessfullytoovercometheflesh.71Forexample,as JohnAnsonhasargued,thecommonstoryofthewomanwhomasqueradesasamaninordertoenteramonasteryappearstoreflectmaleanxietymorefrequently thanitdoeshistoricalreality.72Itisthereforecrucialnottotakeaswomen'sownselfimagethesentimentalizingorthecastigatingofthefemaleinwhichmedievalmen indulged.Ifwewishtounderstandwhatitmeanttomedievalwomentobe"bridesofChrist"orsymbolsofeithermercyorfleshliness,wemustpayparticularattention towhatwomensaidanddid,avoidingtheassumptionthattheysimplyinternalizedtherhetoricoftheologians,confessors,orhusbands. Sortingouttheimagesof"woman"andtheexperiencesofwomeninlatemedievalreligion,withappropriateattentiontothedifferingvantagepointsfromwhichmen andwomenviewedthesematters,isfarfromeasy.Butrecentresearchhasdonemuchtoretrievestoriesofwomenandtodescribewomen'spiety.Ithas,however, tendedtofocusontherenunciationofwealth,privilege,andsexualityinwomen'sreligiosityasinmen's,largelybecauseithasproceededfromtwoperspectivesthat ofthefeministandthatofthetraditionalmedievalist.Feministscholarshiphastendedtoconcentrateonthenegativestereotypingofwomen'ssexualityandonwomen's lackofworldlypowerandsacerdotalauthority.73Ithasdonesobecausetheseissuesareofsuchpressingmodernconcern.Traditionalmedievalists,although attemptingtostartfromthevantagepointofmedievalpeoplethemselves,haveinfacttendedtousemalereligiosityasamodel.Whenstudyingwomen,theyhave tendedtolooksimplyforwomen'sanswerstoquestionsthathavealwaysbeenaskedaboutmenquestionsgeneratedinthefirstplacebyobservingmale religiosity.74Becausemedievalmenweredeeplyconcerned,for


themselvesandforwomen,withtherenunciationofsexualgratificationandofeconomicandpoliticalpower,medievalistshaveseenthesesamerenunciationsascentral inwomen'spiety.Thusrecentworkonmedievalwomenhastendedtohaveeitherpresentistissuesormalemodelsbuiltin.Foodhasbeenignoredchieflybecauseit isnot,inmoderneyes,aprimaryconcern,butalsobecause,tomedievalmen,itwasoneamongmanyreligioussymbolsandpiousrenunciations. Yetfoodwascrucialtothereligiousexperienceofmedievalwomen,inwayssorichandcomplicatedthatitwilltakemeawholebooktoexplainthem.Forfoodwas apowerfulsymbol.Likebody,foodmustbebrokenandspilledforthinordertogivelife.Maceratedbyteethbeforeitcanbeassimilatedtosustainlife,foodmirrors andrecapitulatesbothsufferingandfertility.Thusfood,bywhatitis,seemstosymbolizesacrificeandservice.75And,inChristiandoctrine,thesuffering,broken, crucifiedbodyonthecross,fromwhichspringshumankind'ssalvation,isfood.Butfoodwasnotmerelyapowerfulsymbol.Itwasalsoaparticularlyobviousand accessiblesymboltowomen,whoweremoreintimatelyinvolvedthanmeninthepreparationanddistributionoffood.Women'sbodies,intheactsoflactationandof givingbirth,wereanalogousbothtoordinaryfoodandtothebodyofChrist,asitdiedonthecrossandgavebirthtosalvation. Foodis,ofcourse,onlyonethreadintheskeinofwomen'sspirituality,butbyfollowingitwetouchonmanyaspectsofwomen'sexperiences.Moreover,bystudying thefoodpracticesandimagesofmedievalwomen,webegintoconsidertheirpietynotbyaskinghowitanswersquestionsposedbypresentistconcernsormale perspectivesbutbyallowingthewomenthemselvestogeneratequestionsaswellasanswers.


2 FastandFeast: TheHistoricalBackground
WeordertoyouthisfastofDecember...becauseitconformstopietyandtojusticetorenderthankstoGodafterhavingreceivedthefruitsoftheearthandtoofferhimthesacrifice ofmercywiththeimmolationoffast.Leteachonerejoiceinthecopiousnessoftheharvest...butinsuchawaythateventhepoorrejoiceinitsabundance....Letallmakeaccount oftheirrichesandthosewhohavemoregivemore.Lettheabstinenceofthefaithfulbecomethenourishmentofthepoorandlettheindigentreceivethatwhichothersgiveup. POPELEOTHEGREAT (FIFTHCENTURY)1

FoodsymbolizedmanythingstomedievalChristians.ButthemostimportantChristianfoodpracticeswerefastingandeucharist.Christiansmaleandfemalepaid tributetoGodspowerandacknowledgedtheirownsinfulnessbyrenouncingfood.AndChristiansmaleandfemalereceivedtheirGodmostintimatelyinthatholymeal inwhichhebecamebreadandwine. Therootsoflatemedievaleucharisticpietyandfoodasceticismlieintheearlychurch.WhenthemedievalauthorsBernardofClairvaux,MechtildofMagdeburg, Hadewijch,andJohnTaulerspokeofeatingandbeingeatenbyGod,2 theirlanguageechoedwordsvoicedcenturiesbefore.AugustineofHippo(d.430)andHilary ofPoitiers(d.367)hadsaidthatweareallpresentinthesacrificeandResurrectionofthecross,thatChrist,indying,digestsandassimilatesus,makingusnewfleshin hisflesh.3 WhenAlanofLille(d.1203)wroteinhisSummaforpreachersthatafaster"musttakelittlefoodatmealssothatpartcangototheneedsofhisneighbor", hewasrepeatinginlessresonantandexpansivelanguageLeotheGreat'sexhortationtoChristians(quotedabove)tocoupleabstinencewithalmsgiving.4 when ThomasAquinas(d.1274)


discussedfastingandabstinenceinhisSummatheologiae,hecarefullyexaminedthepatristicnotionthathumankindfellfromparadisethroughthesinofgluttony.5 Thereisatleastsuperficialsimilaritybetweenthefoodmetaphorsemployedbypatristicpoetsandthoseoflatemedievaleucharistichymns.Thehymnusedfor MondayLaudsandattributedtoAmbrose(d.397)reads:

Christusquenobissitcibus, potusquenostersitfides laetibibmussobriam ebrietatemSpiritus. (LetChristbeourfoodandfaithourdrinkletushappilydrinkthesoberinebriationofthespirit.)6

Aveverumcorpus,natum/exMariavirgine, Verepassum,immolatum/incruceprohomine, Cujuslatusperforatum/verofluxitsanguine, Estonobispraegustatum/mortisinexamine. (Hailtruebody,bornofMarytheVirgin,thattrulysufferedandwasofferedassacrificeonthecrossforhumankind,andfromwhosepiercedsidepouredforthrealblood.Betous intheextremityofdeathaforetaste[ofheaven].)7

Downthroughthecenturies,eatingandfastinghavebeentoChristianscomplexsymbolsandcomplexacts. YetthereligioussignificanceoffastandfoodchangedgreatlybetweenthedaysoftheearlychurchandthelaterMiddleAges.Bythefourteenthcenturythegreatfasts thatintheearlydayshadboundthechurchintoacommunitybecamemattersforattenuationanddispensation.Communion,onceacommunalmealandtheheartof themass,becameseparatedfromconsecrationdevotionpivotedincreasinglynotaroundeatingthehostbutaroundthemomentatwhichtheelementsofbreadand winebecame,inthehandsofthepriest,Christ'sbodyandblood.Christ'sfastinthegardenandhissacrificeonthecrosswerespokenoflessaspartofacosmic dramainwhichhellwasforcedtovomitforththeindigestiblebreadofChristthanasmomentsofterriblesufferingthatgavesignificancetoallhumanexperience becausethemanwho


sufferedwasGod.Abstinencewasseenlessasselfcontrol,offeredtoGodinpropitiationforAdam'ssinofgreedanddisobedience,thanasaneversatedphysical hungerthatmirrorsandrecapitulatesinbodilyagonybothChrist'ssufferingonthecrossandthesoul'sunquenchablethirstformysticalunion.Thebreadofheaven, whichtoCyprian(d.258)symbolizedthechurch,8 wasreplacedinlatemedievalhymns,poems,andpaintingsbythefleshofChrist,rippedopenandspillingforth pulsatingstreamsofinsistent,scarletblood,towashandfeedtheindividualhungrysoul. Inordertounderstandwhyfoodwassoimportantasymboltolatemedievalwomen,wemustfirstlookathowthereligioussignificanceoffoodchangedforall WesternChristiansinthehighMiddleAges.Wemustexaminehowfastingchangedinmeaningandcontextandhowboththeritualofthemassandthetheologyofthe eucharistalteredaswell. FastinginAntiquityandtheHighMiddleAges ToaChristianoftheMediterraneanworldinthefourthcentury,feastandfastdefinedthechurch.FastingandSundayeucharistwerewhateveryonehadincommon. Toreceivethebreadandwineofcommunionwasnotonlytobemysticallyandindividuallyfedwiththebreadofheaven,itwasalsotobepresentatasacrificethat wasthevictoryandtriumphofthechurch,adeaththatwassimultaneouslygloryandresurrection.Itwas,inCyprian'swords,tobeunitedwithone'sfellowChristians asthegrainsofwheatareunitedintheloafofbread.TofasteitherinpreparationforthisSundaymeal,inLentenanticipationofthecomingofthebridegroom,orin seasonalresponsetotheharvestwastojoinwithscarcityinorderthatplentymightcome.Tofastwas,asGregorytheGreatexplained,tooffertoGodatitheofthe year.9 Itwastoembracehunger,tojoinwiththevulnerabilitytofaminethatthreatenedalllivingthings,inordertoinducefromthecreatorandproviderofblessingsthe giftsoffertility,plenty,andsalvation.Itwaseven,asLeotheGreatstressed,tojoinoneselfwiththecharityandfertilityofGod:fastingprovidedthealmsthatfedone's neighbor.Indeed,infasting,"Christisfed"(asbothLeoandJohnChrysostomsaid),forwhatonedeniedtooneselfinfastwasgiventoChrist'sownbody,


hischurch.10ThusfastandfeastnotonlyjoinedChristiantoChristiantheyjoinedChristiantotherhythmofnatureaswell. Fastandfeast,inthissense,arefoundinmanyreligions.Anthropologistsandstudentsofcomparativereligion,whooncelookedforasinglecauseormotivefor religiousresponses,arenowcontenttoseemanycomplexstrandsinfastingbehavior.Butitseemsclearthatinpreindustrialsocieties,whereresourcesarelimited, menandwomenfrequentlyrespondtotherhythmofplentyandscarcity,harvestandfamine,bydecidingtocontrolitthroughvoluntaryfastingandbelievethatthey caninthiswaycoercefromthegodsdreamsandvisions,health,goodfortune,orfertility.11Theearliestformsoffastingwereoftenconnectedwithfertilitycults,with goddesses,andwithwomen'sphysiologicalprocesses.12Penitentialorpropitiatoryfastingseemstoarisefromthissenseofnature'srhythm:ifnatureerraticallyand unpredictablyhumblesonethroughhunger,onemaypunishorhumiliateoneselfbeforeGodthroughsimilarhumbling.Thissenseoffoodasasignofvulnerability,a reminder(throughflatulenceandhungerpangs)ofthetollthebodycanexact,canleadtotheasceticimpulsethedesiretodefycorporeallimitsbydenyingbodily needs.Suchanunderstandingoffoodabstentionasinducementoffertility,aspenitence,andasflightfrommatterwaspresentintheMediterraneanworldbeforethe comingofChristianity.13Noristhesenseoffastasanactivitythatbindspeopletooneanotherandtonaturesurprisinginaworldwhoseliferhythmswerestill determinedbytheseasonalrhythmsoftheearth.Nomatterhowlargeandcosmopolitansomeancientcitiesbecame,theywerelessproducersofwealththrough commerceandindustrythangiganticparasitesonthecountryside,asdependentontheharvestasanycountryvillage. TherearereferencestofastinginearlyChristiantexts.TheScripturesthemselves,bothOldandNewTestaments,providedsomemodels.Butfastingasanimportant religiousbehavior,definingtheChristiancommunityandsignalingtheindividual'spurityofheartbeforeGod,didnotemergeclearlyuntilthelatethirdandearlyfourth centuries.14Inearlyreferencestobothindividualandcorporatefasts,manymotivesintermingle.Fasting(e.g.,thefastbeforebaptism)couldbereligiouspreparationit couldbepurificationorexorcismofevilspiritsitcouldexpressmourningforthedepartureofthebridegroom(as,e.g.,inthefastoftwoorthreedaysbeforeEaster). Itwasalsoameritoriouswork


forGodandneighbor.Moreover,fastingcouldbepenitential.AsithadbeenfortheancientHebrews,foodabstentionwasanexpressionofgriefandrepentance,a pleafordeliverancefromsometestorchastisement,asignofconfidenceinGod'smercy,anintercessionandapreparationformeetingGod.Assuch,fastingwas intenselycorporate,acompaniontoprayerandalmsgiving,arecapitulationofaswellasapreparationfortheeucharisticsacrifice.Byfasting,theChristianjoinedwith Christ,who,inthegardenandonthecross,kepttheruleofabstinencethatAdamhadviolatedinparadiseandbecamehimselfsacrificialfood,propitiatingGodand savingsinners.AugustinewroteinaLentensermon:

Alms,inGreek,isthesameasthewordformercy.Andcanoneconceiveofagreatermercythanthatwhichcamedownfromthesky...?EqualtotheFatherineternity,hemade himselfequalwithusinmortality....Breadhimself,heexperiencedhungertotallysatisfied,heexperiencedthirsthealthitself,hemadehimselfweak...andallthistonourishour hunger,irrigateourdryness,succorourinfirmity....Sohecommandsus,throughalms,togivebreadtothosewhohunger...toreceivethestranger,althoughhe[Christ]cameto usandwedidnotreceivehim....Andsoletoursoulspraisehim...letusgivealmsoften.15

Aboveallbemindfulofthepoorsothatyoulayupintheheavenlytreasurywhatyouwithholdfromyourselvesbyamorefrugalmodeoflife.ThehungryChristwillreceivethat fromwhichthefastingChristianabstains.16

Augustine'scontemporaryMaximusofTurin("Whatthefirstmanlostbyeating,thesecondAdamrecoveredbyfasting.Andhekeptinthedesert thelawofabstinencegiveninparadise."17HymnsattributedtoGregorytheGreat(d.604)andstillusedbytheRomanCatholicchurchduringLentexpressthissense of"fruitfulfast,"offastasselfcontrolthatenablesonetopropitiateGodandaidone'sneighbor:

Siccorpusextraconteri donaperabstinentiam, ieiunetutmenssobria alabeprorsuscriminum. Praesta,beataTrinitas, concede,simplexunitas,

Page36 utfructuosasinttuis ieiuniorummunera. (Thusgrantthatthebodybesubjectedfromwithoutbyabstinenceinorderthatthesobermindmayfastcompletelyfromthestainofsin.Grant,blessedTrinityandundivided Unity,thatthesacrificeoffastsmaybefruitfultoyourservants.)18

Intheseventhcentury,IsidoreofSeville,whosummarizedmuchofpatristictradition,spokeoffastingasunionwiththeangels:"Fastisaholything,aheavenlywork, thedoorwaytothekingdom,theformofthefuture,forhewhocarriesitoutinaholywayisunitedtoGod,exiledfromtheworld,andmadespiritual."19 AsthepassagefromIsidoresuggests,thefastoftheearlychurchwasnotmerelythefastofmourning,propitiation,purification,andpenitence.Itwasnotmerelya shadowofthecommunityofheaven.Itwasalsoascetic.PatristicwritersthemselvescitednotonlytheOldTestamentmodelsofDavid,Esther,andJudith,whoby fastingofferedpureheartstoGod,butalsoclassicalstoriesofthewondrousabstentionsofEpimenidesandPythagoras.AsRudolphArbesmannhassaid:"Inthe backgroundtherealways[loomed]thevisionofanidealworldinwhichmanwouldbeabletolivewithoutanyearthlyfood."20Christianwritersdrewsupportfor fastingfrompaganwriters,whohadstressedhygienic,social,andutilitarianmotives.BehindtheChristianpraiseoffastingasawayofmoderatinglust,cleansingthe brainandbody,andpreparingthesoulforGod'sinspirationlayaPythagoreanandneoPlatonicdesiretoescapethebodythatdraggedthespiriteverdownward.In thewordsofClementofAlexandria("Fastingemptiesthesoulofmatterandmakesit,withthebody,clearandlightforthereceptionofdivinetruth."21A workattributedtoabbotNilus(d.430)addstotheideathatAdam'ssinwasgluttonythenotionthatmatterweighsdownspirit:
ItwasthedesireoffoodthatspawneddisobedienceitwasthepleasureoftastethatdroveusfromParadise.Luxuryinfooddelightsthegullet,butitbreedsthewormoflicense thatsleepethnot.Anemptystomachpreparesoneforwatchingandprayerthefulloneinducessleep.22

AmidfourthcenturytreatiseforvirginsbytheauthorwecallpseudoAthanasiusargues:"Fasting...curesdisease,driesupthebodilyhumors,putsdemonstoflight, getsridofimpurethoughts,makesthemind


clearerandtheheartpurer,thebodysanctified,andraisesmantothethroneofGod."23Manypatristicwritersassociatedfoodwithlustandurgedabstinenceasa methodofcurbingsexualdesire.24JohnCassian,writingformonksintheearlyfifthcentury,said:"Itisimpossibletoextinguishthefiresofconcupiscencewithout restrainingthedesiresofthestomach."25Andthatindefatigablepropagandistforasceticism,Jerome(d.420),inaletterofadvicetoawidow,summedupthematter byquotingTerence:"SineCerereetLiberofrigetVenus."26 Fromsuchprecedentsandbeliefscamethegreatcorporatefastsofthechurch.ModeledontheJewishfastsofMondayandThursday,thesocalledstations(the WednesdayandFridayfasts)emergedveryearly,perhapsbeforethesecondcentury.Later,intheWest,SaturdaywasaddedtoFridayasanextrafast(or superpositio)andWednesdayoftendroppedout.ThefastofseveraldaysbeforeEaster,afastofmourningforthosehours"inwhichthespousewastakenaway", alsodevelopedasearlyasthesecondcentury.Lent,orquadragesima,distinctfromthisEasterfastandseenasatimeofpurification,emergedinthefourthcentury duringtheseventhcentury,intheWest,itwasexpandedfromthirtysixtofortydays.AsecondLent(theLentofPentecost,endingonPeterandPaul'sday,June29) emergedintheEastinthefourthcentury.Athirdperiodoffast,beginningNovember14,alsodeveloped,althoughatfirstitwasnotaperiodofanticipationorAdvent, asweknowit,butratheranexpressionofpenitenceofferedattheyear'send.27Fastingwasearlyprescribedasapreparationforbaptismandholycommunionas well,butdirectevidenceforthisusagecomesonlyfromthelatefourthcentury.Thesocalledquarterdays(quattuortempora)latercalledinEnglishEmberDays wereprobablyaddedtothecalendartocounteractandreplacepaganharvestfestivalstheyappearedintheWestinRomeandspreadslowlyduringtheseventh century.28Speciallitaniesandfastsappearedinvariouslocalities,andgraduallytheideaspreadthatthegreatfeastsofthechurchshouldbeprecededbyfasts. Strictlyspeaking,tofastmeanttorefrainfromeating,andtherearestoriesintheearlychurchofmonkssuchasSimeonStylitesgoingwithoutfoodforallofLent.29 ButearlyChristianfoodasceticismwasextremelydiverse.Fastingusuallymeantabstainingentirelyfromcertainfoods(thelistcouldvarygreatly)andlimitingoneselfto asinglemealeachday,takenafterVespers.Abstinencefromparticularfoodsthustendedtofusewithfasting(i.e.,noteating)intoasingleconcept.


Abstinence,strictlyinterpreted,meantsocalleddryeatingi.e.,takingonlybread,salt,andwater,thoughvegetablesandfruitsweresometimespermitted.Some monasticgroupspracticedmoreorlesspermanentabstinenceofthistype.ThemonksofPachomius'smonasteries,forexample,abstainedfrommeat,wine,andfish throughouttheyear.Someindividuals,particularlyhermits,practicedraweatingi.e.,theyatenocookedfood.Strictdryorraweatingneverbecameanelementof ordinaryChristianfastingintheWest,howeverandWesternmonasticrules(withtheexceptionofIrishones)weregenerallylessausterethanEastern.30The BenedictineRule,forexample,permittedamoderateamountofwineandprohibitedonlythemeatoffourleggedanimals,althoughthemonksateonlyonemealaday formorethanhalftheyear.31 ThethirdandfourthcenturiesthuswitnessedtheemergenceoffastingandabstinenceasextensivecorporatepracticesamongChristians.Bothintheperiodsof temporaryfoodrenunciationurgedbypopesandbishopsonallbelieversandinthelivesofpermanentselfdenialundertakenbymonks,foodabstentionwasagroup practice.Butthesamecenturiesalsosawthebeginningsofvirtuosoperformancesbyindividualascetics.Leadersofcenobiticalorhermitgroups(forexample,Basil) sometimespracticedfargreaterausteritythantheylegislatedfortheirfollowers.32Theverynotionofsuperpositio(theaddedonfast)suggeststhatindividualscould multiplymeritbymultiplyingtheirausterities.Preachersmightcontinuetoinsist,asJohnChrysostomdid,thatfastingisabstinencenotfromfoodalonebutalsofromsin andthat''Christdidnotsay:'CometomebecauseIfasted...,'but'becauseIammeekandhumbleofheart.'"33Still,particularlywithinthemonasticcontext, individualswereincreasinglydeterminedtorootoutthepleasureoffoodbyanymeans.GregoryofNyssa(d.395)describedtasteas"themotherofallvice."34 Origen,Cyril,andBasilallsuggestedthatoneshouldinflictpainononeselfinordertodestroypleasureandtoforcethebodytowardvirtue.35Insomequarters, particularlyEgyptandSyriaand,later,Ireland,competitiveasceticismdeveloped.InPalladius'sHistoriaLausiacawhichismoreahistoricalnovelthanafactual accountbutforexactlythatreasonanexcellentreflectionofwhatnonasceticsadmiredintheirasceticheroesandheroineswelearn,forexample,ofoneMacarius ofAlexandria.WhenheheardthatthemonksofTabennisiatenocookedfoodforallofLent,helivedonrawfoodforsevenyears.Whenheheardthatacertain asceticateonlyapoundofbreadaday,heputhisbreadintoanarrowmouthedjarandlivedonwhathecould


pulloutinasinglehandful.Andfinally,whenheheardoftheseverefastingofthehermitsintheThebaid,hedecidedtoeatonlyafewcabbageleavesonSundays.36 Femaleasceticsalsopracticedheroicausterities.JohnChrysostomdescribeswomen"whoevenatatenderagegowithoutfoodandsleepanddrink,mortifyingtheir bodies,crucifyingtheirflesh,sleepingontheground,wearingsackcloth,lockedinnarrowcells,sprinklingthemselveswithashesandwearingchains."37 Butforalltheindividualism,competition,andspiritualathleticismofcertainlateantiquemenandwomen,wemustnotforgetthatfastingwasmostbasicallysomething thatbroughtChristianstogetheringratitudeforGod'sgiftoftheharvestinobediencetoGod'scommandofabstinence,violatedintheGardenofEdenbutfulfilled onthecrossincharitytowardtheneighborswhowouldbenefitfromalmsandinforetasteofunionwiththesaintsinheaven.Itisthissenseoffastingandoffoodthat wefindinRomanostheMelodist'sremarkablecollectionofhymnswrittenforlaygatheringsattheendofthefifthorthebeginningofthesixthcentury. Behindthesehymnsliestherhythmoftheseasons,ofscarcityfollowedbyabundance.WritingofEliasandthewidow(3Kings17),Romanosseesfastofferedin reparationfordisobedience.38Thusfastisajoiningwithfamine,death,andhunger.ItisachoosingoflackthatinducesGodtosendplenty:rain,harvest,andlife. Hungerislessdeprivationorsufferingthanvulnerability,andtheimplicationisthatGodwillrespondtovulnerability,toman'schosenlack,withfood.Writingofthe threechildreninthefieryfurnace,thepoetseesabstinenceascoercingselfdenialfromnature.39Thusfireforgetsitsaccustomedrole,becomesa"spring,""watering thechildreninsteadofconsumingthem,""keepingthemlikeavineherharvest."40Man'schoiceofhungerisachoiceofselfcontrol,anditarousesinnaturean answeringselfcontrol.Theangelsays:
Holychildren,hearmywords.IdoasIhavebeenordered,youdoasyouhavebeentaught.AsIholdbacktheflame,youholdbackyourtongues....Donotfear.Thefirewilldo younoevilitwillturnonyourenemies.Ihavegiventheorderthatitfastasyouhavefastedandthatitdevourgreedilythegluttonswhodonotsingwithyou.41

Hymningthemiracleoftheloavesandfishes,Romanosbeginswithaprayerfordeliveryfromfamine,picturestheassembledcrowdfastinginexpectationofthebread ofangels,andthendescribesthemultiplication


itselfasatypeoftheIncarnation.AstheVirgingavebirthtonewflesh,sothefiveloavesmiraculouslygivebirthtonewbread.42Insharpcontrasttothelatemedieval emphasisonChrist'sbodyasbrokenandbleeding,RomanoswritesoftheIncarnationasfreshbreadthatfeedsthehungrypeopleofGod. WhenRomanosspeaksoftheCrucifixionandResurrection,hisimageis,onceagain,ofbread.Ingraphicallyphysicallanguage,hespeaksofAdamwaitinginhell"as theearthwaitsforrain",whilehellexultsthatithasdevouredChristasitearlierdevouredsinfulhumanity.43ButAdamanswers:

Heenduredmypunishmentforme,bearingmyflesh.Hewhomthecherubimdidnotdaretolookatwaspiercedformeinthesideandthewaterthatpoureddownputoutmy torment.HewhomyoubelieveyouwillholdbecauseheisamanyouwilldevourbecauseheismortalbutasheisGodyouwillvomithimupafterthreedays.44

ThefoodmetaphorsinRomanosareanexpressionofcosmicdrama.Jesusisthe"celestialbread"thathell"cannotdigest".(Inanotherhymn,Jesusforceshelltoempty itsbowelswhenheraisesLazarusfromthedead.)45Insatiable,devouringhungerisevil,desirerunoutofcontrol,thegreedcharacteristicofhellandSatan.Butif humanhungeriscontrolled,itwillbemetwiththebreadofheaven,newfleshtoredeemthefleshofAdam.Thereisherenoneofthelatemedievalsensethatman imitatesthecrossinsuffering,nosenseoflimitlesshungerasametaphorfortheChristiandesireforGod.Butaroundthefastoftheindividualworshipercirclesa fastingcommunity,anaturalorderwithitsowncyclesofwantandplenty,andevenacosmicdramainwhichthebreadthatChristbecameattheLastSupperandon thecrosspurgeshellitself.46Itisthisnatural,corporate,andcosmiccontextthatfellawayfromfastinginthelaterMiddleAges,leavingthefoodasceticismofheroic individualstobecomemoreandmoreextreme. ThroughouttheMiddleAges,theLentenfastsandweeklyfastdays,especiallyFridays,remainedbasicmarksoftheChristian.47Inthethirteenthandfourteenth centuriesaChristianwas,asaminimaldefinition,someonewhoreceivedyearlycommunion,fastedonFridaysandinLent,paidtithes,andhadhisorherchildren baptized.Inthefollowingstoryfromatwelfthcenturychronicle,wecanseethewayinwhichfoodpracticesdefinedtheChristian.OneofthebastardsonsofArnold theElder,founderofthelineofArdres,becamea"Saracen"intheEast.


Hewas,however,acceptedbackintohisfather'shousewhenhereturned.ItwasonlywhenheinsistedoneatingmeatonFridaythatthefullimpactofhisapostasy wasbroughthome,andthefamilykickedhimout.ToviolatetheFridayfastwastheclearest,mostvisiblewayofrejectingthefaith.48 Medievalcookbookssuggestthatthearistocracyobservedfastingstrictly,iflegalistically.Meatdayandfishdayrecipeswerenotseparatedinmedievalrecipe collections,astheywereinlater,betterorganizedcookbooks.Butthemostbasicdishesweregiveninfastdayaswellasordinarydayversions.Forexample,athin splitpeapure,sometimesenrichedwithfishstockoralmondmilk(producedbysimmeringgroundalmondsinwater),replacedmeatbrothonfastdaysandalmond milkwasageneral(andexpensive)substituteforcow'smilk.49 Bythethirteenthcentury,however,theunderstandingoffastandabstinenceputforwardbycanonlawyersandtheologianswasamuchattenuatedversionoftheideals oftheancientwriters.50TheLentenfastwasnowunderstoodtoterminatenotatVespersbutatNonebythefourteenthcenturyitterminatedatmidday,andasmall eveningmealwaspermitted.Abstinencewassometimesunderstoodassimplyabstinencefrommeat,althoughitusuallyincludedcertainanimalproducts(especially milkandeggs)aswell.AuthoritiesdiscussedwhichcategoriesofChristianswereexemptfromfasting.ThomasAquinas,forexample,exemptedchildren,theold, pilgrims,workers,andbeggars,butnotthepoorwhohadroofsovertheirheads.51Dispensationsforcertaingroupsandundercertaincircumstancesbecame common.MedievalcookbookssuggestthatthearistocracydinedsumptuouslyonthefishpermittedinLent."Fish"indeedincludedwhale,dolphin,porpoise,andalso beaver'stailandbarnaclegoose(becausebeaversandgeesewerethoughttostaymostofthetimeinwater).Cooksconcoctedimitationeggsfromfishroeandmade "ham"or"bacon"slicesfromdifferenttypesofgroundorshreddedfish.52ThefoodinsomeBenedictinemonasteriesbecameverylavish.Whereastheaverage twelfthorthirteenthcenturyaristocratatemealsoffourorfivecourses,someblackmonksenjoyedasmanyasthirteentosixteencoursesonmajorfeastdays.53 Awareofsuchlegalisticobservance,ThomasAquinasclearlyfearedthatgluttonymighttainttheabstinenceofsomeChristians.Greed,heobserved,includedeating rich,expensivedishesaswellaseatingtoomuchfoodorfoodprohibitedbythechurch.54 WhilethefastingrequirementsforordinaryChristiansandBenedic


tinemonksgrewlessstringent,however,somenewmonasteriesadoptedextraordinaryrigor.MonasticfastinghadalmostdisappearedinthecentralMiddleAges, withtheadditionofmanyfeastdaystothecalendar,butthenewordersoftheeleventhandtwelfthcenturiesturnedtoincreasedausterities.55Thefoodasceticismof eleventhcenturyItalianhermits,forexample,imitatedandequaledthatoftheearlymonksofSyria,andpropagandistssuchasPeterDamianspreadtheirfame.The newordersnotonlypracticedgreaterausterity,theyalsodefinedanddifferentiatedthemselvesinpartbytheirparticularrulesofabstinence.TheCistercians,for example,addedtotheBenedictineRuleafastofbreadandwateronFridaysinLent.TheCarthusians,whofastedthreetimesaweekonbread,water,andsalt(with permission),cameovertimetodefinetheirperpetualabstinencefrommeat(evenforthesick)assocrucialacharacteristicoftheorderthatviolationofthisprohibition meantexpulsion.Buttheearlyausterityofmanyorders,suchasthePremonstratensiansandDominicans,waslaterrelaxed,sometimestobefollowedafterhundreds ofyearsbyreformmovementsthatreturnedtotheearlierstrictness.(TheTrappistswhoreformedtheCisterciansintheseventeenthcentury,forexample,rejectedthe fourteenthcenturyrelaxation.)56 Whatchangedmostoverthelongperiodfromthesixthtothetwelfthcenturywasthetoneofthediscussionbypreachers,lawyers,andtheologians.Asfoodbecame increasinglyamatteroflegislationanddispensation,concernwiththeabusesoflegalismandliteralismalsogrew.Thirteenthandfourteenthcenturywriters,busy definingexactlywhoshouldfastwhen,urgedspiritualmorethanphysicalabstinence.Theystressedtheneedformoderationinobservance.57Andrenunciation whetheroffoodorofvicewasinvariablyseenasmoresignificantfortheindividualsoulinitsinmostrecessesthanforthecommunity. WefindsuchaninterpretationoffoodasceticisminoneoftheadditionstotheVitismystica(TheMysticalVine)ofBonaventure(d.1274):
Thevirtueofabstinenceisintwoparts.Oneiswithin,inthemindtheotherwithout,inbehavior.Andthatwhichisinthemindistobeobservedalways,butthatwhichisin behavioristobedisplayedaccordingtocircumstances.IndeedJohn,whowasapureman,practicedabstinenceasmuchinmindasinbodyinorderthathenotbedespisedbut Jesus,whoistrulyourhumanity[homonosterverus],whowasincapableofsin,

Page43 usedfoodanddrinkforatime....Norshouldyoubelieveinanywaythatitisagreatervirtuetoabstainfromfoodthantomakeuseoffoodinmoderation.58

ThemonasticwriterPeterofCelle(d.1183),inasermononfasting,alsoexplainedthatonecanfastfromfoodandfromevil.Abstinencefromevilmustneverbe relaxed,butabstinencefromfoodcanbe.Fasting,hewrote,"isrightlydonewhenitisdonetowipeoutvicesforthefullnessoffoodheatsupthebody."59Ina treatiseforpreachers,PetertheChanter(d.1197)explained:

Paulthefirsthermitalwaysfasted,andbreadwassenttohimfromtheskies....AndJeromewascontentwithmeanvegetables,bread,andwater.Butthishardestfastwearenot capableofbecauseofourcorruption.Letourobservanceberational,forwedonotwanttobedespoiledbut,rather,clothed.Forthreethingsarenecessarytotheass[i.e.,the body]:food,thatitbesustainedtherod,lestitbestubbornburdens,thatitmaybeusefultoitsmaster.Concerningthefirst,itissaid:"Noonehateshisownbody"[Eph.5:29], foritiscreatedbyGod,notbythedevil,asManichaeussaid....Butconcerningthesecond,theapostlesaid:"Ichastisemybody..."[ICor.9:27].Andconcerningthethird,he said:"Bearoneanother'sburdens"[Gal.6:2].60

Fastingwasattimesalmostcompletelyallegorizedorspiritualized.Forexample,thegreatmonasticreformerBernardofClairvaux,whohimselfpracticedsevere abstinence,wroteinaLentensermon:
Howcanonebe,Ishallnotsayamonk,butaChristian,whodoesnotfast,whenChristgaveusthepractice?ForifChristfasted,itwastogiveusanexample....ForLentisa sacramentofalltime[andfastingasignofallabstinence].Ifonlythetonguesinned,thenitonlywouldfast,andthatwouldsuffice.Buttheothermemberssin.[Sotheymust fast.]...Theeyesshouldfastfromcuriosity...,theearsfromtalesandrumors,thetonguefromdetractionandmurmuringandfromvainandscurrilouswords,...thehandsfrom lazysignsandfromallunnecessarybusynessbutmostofall,thesoulfromvicesandthewillfromitsowndesire.61


Page44 theessentialpoint,namely,theirdeterminationtodoGod'swillinallthings,painfulorpleasant.ThesemenoffirethoughtitpossibletodotheimpossiblewhenhelpedbyGod.... However,wemustnotforgetthatsomeoftheseancientfathersdidnotpracticeseverebodilyausteritiesandneverthelessattainedgreatholinessoflife.62

Aboveall,wesenseinthetheologiansofthetwelfthtothefourteenthcenturyanefforttogivenotonlyprecisiontorulesbutalsodignityandspiritualsignificancetothe practiceofawidespectrumofChristians.InthechapteronfastinginhisSummaforpreachers,AlanofLillearguedthatabstinencemustbeinnerandouter,thatmere obediencetothelawisnotenough.Simplygoingwithoutfood,asthesickdo,ismorallyindifferent."Fastmaceratestheflesh,elevatesthesoul,restrainsthesparkof concupiscence,andexcitesreason....Forwhatcanitprofitifthemouthrejectsfoodwhilethetonguelapsesintomendacity?"Alanretainssomesensethatpractice bindsChristianstogetherandhassocialsignificance.HearguesthatbyfastingtheChristiangainsheaven,repairsthesinsofhisancestors,preparesforeucharist,and givesalmstothepoor.ButAlan'semphasisisonpersonaldevotionandindividualobservance:

Fastismedicinetosoulandbody.Itpreservesthebodyfromdisease,thesoulfromsin.Aboutitsmedicinaleffects,earthlyandheavenlyphilosophyagree.IfAdamhadfastedin paradise...,hewouldnothavebeenexiledintodamnation.IfEsauhadfasted...,hewouldnothavelosthisbirthright.IfNoahhadfasted...,hewouldnothavelosthis modesty.Therefore,throughfastingthebodyispurgedthatitmayreceivetheeucharistsacramentally,andthespiritthatitmayreceiveitspiritually....Andthreethingsshould informfasting:goodintention,almsgiving,andlove....Ohman,considertheFathers,whoateonlyonceortwiceaweek....Butifyouarenotmovedbyancientexamples,be movedatleastbythetaleofSt.Nicholasthebaby,whotookonlyonebreastontheWednesdayandFridayfasts.Andletnotadultsblushtofastwhentheyseewhatchildren havedone.63

ThomasAquinas'sextendedtreatmentofabstinenceintheSummatheologiae,writtensomeyearslater,soundsasimilarnote.Stressingmoderation,Thomasquotes Jerome,whosaid:"Byeatingandsleepingtoolittleyouareofferingasacrificeofstolengoods....Rationalmanforfeitshisdignityifhesetsfastingbeforechastity,or nightwatchingbe


forethewellbeingofhissenses."AndThomasexplainsthisbysaying:"Rightreasondoesnotrefusefoodtotheextentofrenderingusincapableofdischargingour duties."Thegoaloffastingistobridlelust(whichisparticularlyexcitedbymeat),tomakesatisfactionforsin,andtohelpthemindrisefromearthtoheaven.Like Alan,Thomashassomesenseofthesocialsignificanceoffastingandofitscorporatesetting.ButinhisdiscussionoftheEmberDays(whichPopeLeoIsawasa sacrificeofferedinreturnforanabundantharvest),weseehowmuchthenotionofChristendomhaschanged.ToThomas,fastingisappointedonthequarterdays becausetheyaretimesofordination,atwhich"boththeordainerandthecandidatesforordinationandeventhewholepeople,forwhosegoodtheyareordained," abstaininordertobeready.64ThusthefastunitesnotaChristiancommunitytotherhythmsofnaturebutapeopletoitsleader,thepriest.Andthisleaderstandsfor thepeopleinhiseatingaswellashisnoteating.ThomasAquinas,likeotherthirteenthandfourteenthcenturytheologians,sawthepriestinthemassasreceivingfor thepeopleanideathatbecameoneamongseveraljustificationsforwithdrawingthecupfromthelaity.65 ThissamesenseofthesignificanceofrulesandofaChristiancommunitysubsumedinthepriesthoodreverberatesinthegreathymnsforCorpusChristithatare associatedwithAquinas'sname.Againandagain,thepoetsingsofaChristwho"obeysfullythelawconcerningfood[i.e.,thePassoverritual]andgiveshimselfas foodwithhisownhands,"who"gavehisbrothersthelambandtheunleavenedbread,accordingtothelawofourforefathers.'"66Againandagainhestressesthe comingofthewholeChristtotheindividualChristian,whoseesbyfaiththebodyandbloodinthefragmentofbread.ButevenashepraisesthemagnanimityofaGod whogiveshimselfintothehandsandteethofthelowly,heunderlinesthatthegivingandtheunioncomethroughthepowerofpriests:
Sicsacrificium Istudinstituit, Cujusofficium Committivoluit Solispresbyteris, Quibussiccongruit Utsumantetdentceteris.

Page46 Panisangelicus Fitpanishominum: Datpaniscaelicus Figuristerminum: Oresmirabilis: ManducatDominum Pauper,servus,ethumilis. (Soheinstitutedthesacrificeandwishedittobeperformedonlybypriests,thatpriestsreceiveitthemselvesandgiveittoothers.Thebreadofheavenbecomesman'sbreadthe breadofheavenputsanendtotypes[i.e.,foreshadowings].Ohwhatamarvelousthing!Thepoorman,theservant,thelowlypersoneatsGod.)67

Aglanceattwelfthtofourteenthcenturyexemplamoraltalesusedbypreacherstoeducatebothmonasticandlayaudiencestellsthestoryofattenuatingpractice. OfthirteenexemplaconcerningabstinencelistedinTubach'srecentindex,fivesimplyurgethepractice,twoareattacksonhypocrisy,andthreeurgemoderation.Of thirtythreestoriesthatconcernfasting,onlyfifteenreallyadvocateitorexpressadmirationforasceticfeats(andseveralofthesestoriesaremerelyrepeatedfrom patristictexts).Twotalesstressthedifficultyoffastingsevenurgetheavoidanceofhypocrisyorpreferaninner,spiritualresponsetolegalisticobservancesixadvise moderation.Thereisastrongnoteofwarningagainstnotonlyexcessbutfraudandselfdelusionaswell.Abstinenceisseenasausefultoolforconqueringlustand,in onecase,forconvertingordefeatinghereticsbutnotaleplacesthepracticewithinacosmicdrama,concernsagroupfast(beyondonepatristicstoryofagroupof hermits),speaksofmourningorofthepenitenceoftheChristiancommunity,orsuggeststhatfastingshouldissueinalmsgiving.Practiceisoftenallegorizedor spiritualized.Gossipingissaidtobeworsethanbreakingfastfeedingthepoorisbetterthanobservingit.Weareeventoldofmonkswhobreaktheirfastoutof charityinordernottoscandalizetheirneighborsortaxthembeyondtheirstrength. Amongtheexemplathatdealwithfood,noclearpatternemerges.Afewtalesexpressabhorrenceofstealingorhoardingfood,seefastingasinducingmiracles,or connectholinessandfoodmultiplication.Butwhenwelistentothevoicesofthesepreachers,wehearnoinsistentconcernwitheatingeitherastheactnecessaryfor survivalorasa


metaphorforthewayinwhichGodismet.68Asintreatisesandhymns,sotoointhesemoraltalesforordinaryChristians,weseemtoseeachurchstrainingto enforceminimumobservance.Yetwealsoseeanefforttogivesuchobservanceadignifiedmeaningsensitivetotheneedsofindividuallivesandtemperaments,sothat hypocrisyandselfdelusionmaybeavoided,spiritualgrowthmayabound. Asinthethirdandfourthcenturies,however,therewerethoseinthelaterMiddleAgestowhomsuchcounselseemedweakness.Theyrespondedtothepastoral concernoftheologiansandlawyerswithapassionateconvictionthatevilwasdarkerthanthemoderatessupposedandcouldberootedoutonlybydrasticmeans.The majorityofthesenewvirtuosiwerewomen.Insomewaystheymaybeseenasrespondingtoatwelfthandthirteenthcentury"triumphofChristianity"asstrikingas thetriumphofthefourthcentury.Likeearlyascetics,theyfoundonlycompromiseandfailureinachurchcharacterizedbyanewbureaucracy,anewdefinitionofitself, anewpastoralpolicy,anewability(throughtherequirementofyearlycommunionandconfession)totouchordinaryChristians,andnew,minimalrequirementsfor observance.WordssuchasthoseoftheVitismystica"Norshouldyoubelieveinanywaythatitisagreatervirtuetoabstainfromfoodthantomakeuseoffoodin moderation"musthaveannoyedsomepeopleeveniftheycomfortedothers.SuchChristiansresponded,astheyhadinthefourthcentury,withextravagant asceticism,ahauntingsenseofhumanevilandalienation,andatheologyofsacrificeandselfsacrifice.69Theyrevivedancientmodels,citingJeromeontheconnection betweenfoodandlust,competingwiththeDesertFathersinmarathonfasts.Theyalsostruggledtorecreateintheirliveswhattheycouldnotquitefindin contemporarytheology:thecorporatesenseoftheearlychurch.Althoughlatemedievalwomenremainedindividualandoftenidiosyncraticintheirfastingbehavior, theyconnectedfastwithfeedingandabstinencewithfertilityassurelyasLeotheGreathaddone,inaverydifferentcontext. Butthefoodasceticismoflatemedievalpeopleespeciallywomenwasnotmerelyarevivalofthelifeofthedesertorafranticgraspatpurityinthefaceofachurch withmoderaterequirements.Itwasalsoimitationofthecross.ThebasicsignificanceofChrist,andofChristasfood,hadchangedandintheshadowofthischange abstinencetookonnewmeaning.InordertounderstandthenewsenseofJesusassufferingflesh,wemustconsiderthehistoryofeucharisticdevotion.


AMedievalChange: FromBreadofHeaventotheBodyBroken AlthoughChristiansevolvedafixedliturgyfortheirholymealonlyveryslowly,theeucharistwasby200thecentralactofthechurch:asacrificeofpraiseanda memorialofredemption.ItissignificantthatasinglemealoneconsistingofthetwobasicelementsoftheMediterraneandiet,breadandwinerosetoprominence, fortheolderMediterraneantraditionsoffeastinglastedthroughouttheMiddleAges,invariousformsofcarnival.70NotalltheFathersagreedwithAugustine,who triedtoeliminatebanquetsanddrunkenrevelryfromthefestivalsofthemartyrs.71ThemissionarieswhocarriedChristianitytothenorthernlandspermittedlavish mealsonsaints'days,aslongasthemeatwasnotsacrificedtotheoldgods.72 ButthecentralChristianmealwasnotthecarnival,notthebacchanal,notanexuberantrevelexpressingabundanceandfertility.73Thecentralmeal,thecentral liturgicalact,wasafrugalrepast,evokinglesstheluxurious,proliferatingrichnessofthenaturalworldthanthehumanlifeitsupported.Indeed,Christhadsaiditwas humanlife,wasbodyandblood.Fromtheverybeginningtheeucharisticelementsstoodprimarilynotfornature,forgrainandgrape,butforhumanbeingsboundinto communitybycommensality. EarlyChristianwriterssawtheeucharistasspiritualrefreshmentandasapledgeofthechurch'sunity,asthebreadofheavenandtheonebodyofChrist.74For example,theSyriacwriterEphremofNisibis(d.373)linkedtheeucharistwiththechurchnotsomuchbecauseheexplicitlyidentifiedthechurchwithChrist'sbodyas becausehesawtheeucharistinthechurchunitingChristians:
Andbecausehe[Christ]lovedhisChurchgreatly hedidnotgiveherthemannaofherrival HebecametheBreadofLife forhertoeathim.

LikeCyprianearlierandRomanostheMelodistlater,Ephremsawinbreadapowerfulsymbolofmany(fragments,crumbs,loaves,etc.)unitedintooneandagraphic pledgeoftheresurrection:
Hisbread,beyonddispute, bearswitnesstoourresurrection,

Page49 for[if]heblessedthefood, howmuchmorethosewhoeat! Inthetwelveloaves whichheblessedandmultiplied, heblessedandmultipliedhisTwelve. Andhetookbreadandbrokeit, another,onlyone[loaf], thesymbolofthebody, theOnlybegotten,[born]ofMary.75

TheanthropologistGillianFeeleyHarnikhasrecentlypointedoutthattheearlyChristiansnotonlytookoverJewishnotionsoffoodastheembodimentofGod's wisdombutalsosignaledanexpansionofcommunitybyexpandingcommensality.FromtheChristianpassovernolongeraprivate,domesticmealnonewas excluded.Richandpoor,JewandGentile,cowardandhero,allcelebratedtogether.EatingChrist'sbodywasaninclusiveact,onethatcreatedcommunity.76 Forallthetalkofsignandsacrament,typeandsymbol,noearlywriterdoubtedthatasacredrealitylaybehindthebreadandwineandinthethirdandfourth centuriesincreasingcarewastakenoftheelementsthemselvesasthe''bodyoftheLord."77AsanearlyEasterhymn(fourthtosixthcentury)expressesit:

Adcenamagniprouidi, ........... Cuiussacrumcorpusculum inaracrucistorridum cruorecuiusroseo gustandouiuimusDeo. .......... iampaschanostrumChristusest, quiinmolatusagnusest sinceritatisazyma caroeiusoblataest. ([Weare]lookingforwardtothesupperofthelamb...whosesacredbodyisroastedonthealtarofthecross.Bydrinkinghisrosyblood,welivewithGod....NowChristisour passover,oursacrificiallambHisflesh,theunleavenedbreadofsincerity,isofferedup.)78


Page50 Sanctiuenite,Christicorpussumite, sanctumbibentes,quoredemptisanguinem. saluatiChristicorporeetsanguine, aquorefectilaudesdicamusDeo. hocsacramentocorporisetsanguinis omnesexutiabinfernifaucibus. ............... prouniversisinmolatusDominus ipsesacerdosexstititethostia .............. caelestempanemdatesurientibus, defonteuiuopraebetsitientibus. (Come,holypeople,eatthebodyofChrist,drinkingtheholybloodbywhichyouareredeemed.WehavebeensavedbyChrist'sbodyandbloodhavingfeastedonit,letusgive thankstoGod.Allhavebeenrescuedfromthejawsofhellbythissacramentofbodyandblood....TheLord,offeredassacrificeforusall,wasbothpriestandvictim....He givesthecelestialbreadtothehungryandoffersdrinkfromthelivingfountaintothethirsty.)79

ExactlyhowChristwaspresentinthebreadandwinewasnotaquestionthatanimatedearlytheologians.Betweentheninthandtwelfthcenturies,however,itbecame suchaquestion.PreachersandschoolmenarguedoverwhatsortsofmetaphorswereacceptableforexpressingthenatureofGod'spresence.80Themajorityclearly favoredlanguagethatwasfranklyliteralandphysical.WhentheFourthLateranCouncil(1215)statedinphrasesneitherasscholasticnorasAristotelianasthey mighthavebeenthatChristispresentinsubstanceonthealtarattheconsecration,itwasmerelymakingexplicitwhattheologiansandlayfolkhadassumedfor centuries:

Thereisoneuniversalchurchofthefaithful,outsidewhichnooneatallissaved.Inthischurch,JesusChristhimselfisbothpriestandsacrifice,andhisbodyandbloodarereally containedinthesacramentofthealtarunderthespeciesofbreadandwine,thebreadbeingtransubstantiatedintothebodyandthewineintothebloodbythepowerofGod,so thattocarryoutthemysteryofunityweourselvesreceivefromhimthebodyhehimselfreceivesfromus[accipiamusipsidesuo,quodaccepitipsedenostro].81


Theproliferatingeucharisticmiraclesofthetwelfthandthirteenthcenturiesinwhichthehost,lyingonthepaten,shutawayinthetabernacle,orraisedonhighinthe priest'shands,turnedvisiblyintoChristwerenot(assomehaveargued)theresultofthedoctrineoftransubstantiation.Rather,theywereanexpressionofthesortof pietythatmadesuchdoctrinaldefinitionseemobviouslytrue.82AsPeterofPoitiers(d.1205)putit:Christispresentbeneaththeveilofthespecies"likeahandina glove."PetertheChanterevenwentsofarastoask:"Ifweconcede,withoutreservation,thatthebodyofChristiseaten,asAugustinesays,whynotsayabsolutely thatoneseesGod?"(ButPeterdidnotquitedaretoanswerthat,yes,thefaithfuldoliterallyseeGodthroughtheelementsasthroughatransparentveil.)83 TheconvictionthatGodwaspresentintheeucharistmoreliterallythaninanyothersacrament,thatbehindtheveilofthe"accidents"of"wineredness"or "crumbliness"laythesubstanceofthebodyofGod,raisedcertainproblemsfortheologians.HowcouldthetotusChristusbepresentinphysicalelementsso distressinglyfluidorbreakable?WouldnotthepiousdrawtherisibleconclusionastheyunquestionablydidonoccasionthatlittlebitsofJesusfelloffifcrumbs werespilledorthatonehurtGodbychewingthehost?Desiringtoavoidtheimplication,foundinsomeeleventhandtwelfthcenturysupportersoftherealpresence, thatthefaithfuldoeatlittlepiecesofGod'sflesh,theologianssuchasAquinasaffirmedthatChrist'sentirebodywaspresentineveryparticle.Thushisbodywasnot physicallybrokeninthefractionofthehost.Theyalsoelaboratedthedoctrineof''concomitance"theideathatboththebodyandthebloodofChristarepresentin eachelement.Facedwithgrowingdevotiontothebreadandwinethemselves,exactlybecausethecrumbsanddropsmasked(thinly)thesubstanceofChrist, theologiansstruggledtoretainafirmemphasisonChrist'sbodyasone,becauseonechurchandonehumanityaresavedinit.84IntheCorpusChristihymns associatedwithAquinas,wehearechoingagainandagainnotonlythedoctrineoftransubstantiationbutalsotheinsistenceononeChristintwospecies.Onlythusis totalhumannature(sensualaswellasspiritual)saved:
Verbumcaropanemverumverbocarnemefficit FitquesanguisChristimerumet,sisensusdeficit, Adfirmandumcorsincerumsolafidessufficit.

Page52 (TheWordmadefleshbyawordchangestruebreadintoflesh,andwinebecomesthebloodofChristandifsenseisdeficient[inperceivingthechange],faithalonesufficesto makethesincereheartfirm[inbelievingit].)85 Postagnumtypicum,expletisepulis, Corpusdominicumdatumdiscipulis, Sictotumomnibus,quodtotumsingulis, Ejusfatemurmanibus. (After[theyhadeaten]thelamb,whichisatype[i.e.,aforeshadowing],andwhenthemealwasover,thebodyoftheLordwasgiventothedisciplesinsuchawaythatthewhole wasgiventoallandthewholegiventoeach,andthiswasdonebyhisownhands.)86 Quibussubbinaspecie Carnemdeditetsanguinem Utduplicissubstantiae Totumcibarethominem. ([Tohisdisciples]hegave,undertwospecies,hisfleshandblood,sothatitmightfeedthewholeman,whoisoftwofoldsubstance.)87

Subdiversisspeciebus, Signistantumetnonrebus, Latentreseximiae. Carocibus,sanguispotus, ManettamenChristustotus Subutraquespecie. ........... Fractodemumsacramento Nevacilles,sedmemento Tantumessesubfragmento Quantumtototegitur. (Underthedifferentspecies,whichareonlysigns,notthings[i.e.,realities],liehiddenwonderfulthings.Thefleshisfood,thebloodisdrink,andyetthewholeChristremains undereachspecies....Finally,whenthesacramentisbroken,donotdoubt,butremember:thereisasmuchhiddeninafragmentasinthewhole.)88



implicationsforChristianpractice,asisdemonstratedbyacontroversythateruptedinParisinthelatertwelfthcenturyyearsbeforetransubstantiationwasdefined. ThequestionwaswhetherChristwaspresentfromthemomentofthefirstwordsofinstitution:"Hocestenimcorpusmeum."Sinceabodycannotexistwithoutblood andsincethebloodwasclearlynotyetpresent,thewinenothavingbeenconsecrated,PetertheChanterconcludedthatthebodycouldnotbepresentuntilthewords overthewineweresaid.BothelementswerenecessaryforChristtobepresent.Indeed,Peterheld,bothelementswerenecessaryfortheconsecrationofeitherto occur.If,duringthemass,thepriestdiscoveredthathehadforgottentoputwineinthechalice,hehadtorepeattheentireconsecration. Peter'sargumentmetwithoutragedrebuttalinsermons,intheologicalanalyses,andevenintheglossesprovidedtoaccountsofmiracles.Itannoyedbothlearnedand popularopinion,partlybecauseitranafoulofcommonliturgicalpractice(whichwassimplytofilluptheemptychaliceandgoon)butmostlybecause,asGuyof Orchellessaid,itmadeexistingpietyintoidolatry.Priestandpeoplealikehadbeguntopracticeadorationofthehostfromthemomentofitsconsecration.Ifitwasnot yetChrist,thenthefaithfulwereworshipingflour.WhilenooneinvolveddeniedthattheelementswereinsomesenseChrist'sbodyandblood,theexactmomentof thechangematteredenormouslybecausepeoplewerebehavingasifChristappeared,substantiallyandtotally,inthewaferwhenthewords"Hocestcorpusmeum" weresaid.89 Thisratherminortheologicaldebatereflectsagreatmedievalchange.Bythethirteenthcenturytheeucharist,onceacommunalmealthatboundChristianstogetherand fedthemwiththecomfortofheaven,hadbecomeanobjectofadoration.Thephysicalappearanceoffoodonthealtarwasinfactaveilthroughwhichholyfleshwas spirituallyormysticallyseen.SinceChristarrivedatthemomentofconsecration,notofcommunion,hearrivedinthehandsofthepriestbeforeheappearedonthe tongueoftheindividualbeliever.Whetherornotoneheldortastedthewafer,onecouldmeetChristatthemomentofhisdescentintotheelementsadescentthat paralleledandrecapitulatedtheIncarnation. Despitethenewfocuson"seeing"ratherthan"receiving,"onconsecrationratherthancommunion,medievalmenandwomendidnotlosetheirsenseofthereligious significanceoffoodandhunger,bothasfacts


andasmetaphors.Ifanything,foodbecameayetmorepowerfulandawefulsymbol,forthebreadandwinethatlayonthealtarwerenowevenmoregraphically seentobeGod.Butthemeaningoffoodandhungerchanged.Topatristicpoetsandtheologians,thefoodonthealtarhadsuggestedthatChristhimselfcameas breadtohungryhumankindorthathe"digested"Christians,bindingthemtohimashisbodyi.e.,thechurch.Hungermeanthumanvulnerability,whichGod comfortedwithfood,oritmeanthumanselfcontrol,adoptedinanefforttokeepGod'scommandments.Inthesermonandsong,theologyandstory,ofthehigh MiddleAges,however,thefoodonthealtarwastheGodwhobecamemanitwasbleedingandbrokenflesh.Hungerwasunquenchabledesireitwassuffering.To eatGod,therefore,wasfinallytobecomesufferingfleshwithhissufferingfleshitwastoimitatethecross. Manychangesinpietysomecomingasearlyastheninthcenturyforeshadowed,accompanied,andreflectedtheshiftfromcommuniontoconsecrationasthefocal pointofdevotion.EarlymedievalChristianshadsometimesreservedthesacramentonthealtarinapyx(forcarryingtothesick)andhadcombineditwithor substituteditforrelicsintheconsecrationofchurches.Perhapsasearlyastheeleventhcentury,atBecandatCanterbury,theyvenerateditwithgenuflection,incense, andprocession.Butthecultofthesacrament,ofdevotiontotheconsecratedhostitself,didnotreallybeginuntilthetwelfthcentury.Itthendevelopedrapidly.The pyxesandreliquariesinwhichthehostwasreservedbecamemoreandmoreelaborate,bothtoprotectthehostfromprofanationandtoallowthefaithfultoadoreit outsidethemass.Lampsandcandleswereburnedbeforeit.Small,usuallycircularopenings(oculi),wereplacedintheexteriorwallsoftheapse,sothatthepious couldlookdirectlyintotheeucharisticchestandveneratethehostfromoutsidethechurch.90FromGermanycomestoriesofknightsandpeasantsgallopingupon horsebacksothatthehorsesmightadoreGodalso,inakindofequinecommunionknownastheUmritt.91Perhapsasearlyastheninthcentury,recluseshadtheir cellsinchurchespositionedsotheycouldadorethehosteachday.92Visitstothehostbeganinthetwelfthcenturysomewriterssuggestedthatsuchvisitsmight substituteforgoingoncrusade. ThefirstevidencefortheelevationofthehostafterconsecrationcomesfromParisabout1200.93Thepracticespreadrapidly,andwithittheconvictionthatseeingthe hosthadspiritualvaluethatitwasa


"secondsacrament,"alongsidereceiving.Prayerswerecomposedforthemomentofseeing,whichwashonoredbytheringingofbells,genuflection,andincense.By thethirteenthcenturywefindstoriesofpeopleattendingmassonlyforthemomentofelevation,racingfromchurchtochurchtoseeasmanyconsecrationsaspossible, andshoutingatthepriesttoholdthehostuphigher.94Anaccountevensurvivesofguildmembersbringingchargesagainstapriestforassigningthemplacesinchurch fromwhichtheycouldnotseetheelevatedhost.95WhenJohnMarienwerder,DorothyofMontau'sconfessor,wrotehisaccountofhervisionsandteachings,he especiallyemphasizedthesaint'sdevotionto"seeing"Christ:

Thespouse[ofChrist],compelledbytheodorofthisvivifyingsacrament,hadfromherchildhoodtotheendofherlifethedesiretoseetheblessedhost.Andifshemanagedto viewitahundredtimesinoneday,assometimeshappened,shestillretainedthedesiretoviewitmoreoften.96

Thecultoftheeucharistichostwasfullyestablishedbythelatethirteenthcentury,withtheinstitutionin1264ofthefeastofCorpusChristi(revealedtoJulianaof CornillonandlongworkedforbyJulianaandherfriendsEvaofSt.MartinandIsabelleofHuy).97DespitetheintenseeucharisticenthusiasmoftheareaaroundLige, Juliana'shome,thefeastmadelittleheadwayatfirst,inpartbecausesomearguedthataspecialfestivalforChrist'sbodymightimplylessreverenceforitatevery mass.Butafterthefeastwasrepromulgatedin1311/12,andagainin1317,itspreadrapidly.Inthefourteenthcentury,"showing"wasseparatedentirelyfromthe mass,withtheintroductionofthemonstrance,aspecialvesselfordisplayingtheconsecratedwafer.ThehostwasnowcarrieduncoveredinprocessiononCorpus Christiandleftexposedonthealtarforadoration,sometimesfortheentireoctave.Bythefifteenthcenturycertainfeastsendedwiththeexpositionandbenedictionof theblessedsacrament.EvenbeforethepromulgationofCorpusChristi,ordersandconfraternitiesappearedwhosepurposewastopromotethecultofthehostandto makereparationforthesacrilegeofheretics.Onesuchconfraternity,itselfperhapsnotthefirst,wasthegraypenitentsofAvignon,foundedin1226.98 Elevationofthechaliceemergedmoreslowly.ThefeastsoftheSacredHeartandofthePreciousBloodwereestablishedonlyinmoderntimes.Buttherootsofthese festivalsgobacktotheintensedevotionto


theheartofJesusfoundamongtheSaxonnunsandFlemishholywomenofthethirteenthcentury.99Andasweshallsee,latemedievalspiritualtextswereawashin referencestothebloodofthelamb. Inthemassitself,receptionandconsecrationwereincreasinglyseparated,andtheelementstreatedwithincreasingawe.Moreandmoretherhythmoftheservice itself,theliturgicalpracticessurroundingit,andeventhearchitectureofchurchessuggestedthatGodcame"through"andevenprimarily"to"priests.Intheearlychurch thealtarhadbeenasimpletable,andthepriesthadcelebratedfacingthepeople.Bythetwelfthcenturythealtarstoodagainstthewalloftheapseandwasoften surmountedbyaretable.Across(usuallynotyetacrucifix)andcandlesadornedit.Thepriestcelebratedwithhisbacktothepeople,recitingthecanonofthemassin aninaudiblewhisper,whilethepeopleengagedinallsortsofpersonaldevotions(ordaydreaming)looselyconnectedwiththeceremony.Communionwasgiven before,after,orcompletelyapartfrommass.Monksandnunsmightgotothehighaltarlayfolkusuallyreceivedatthesidealtar,wherethesacramentwassometimes placedbeforehand.Womenhadbeenprohibitedsincethedaysoftheearlychurchfromreceivingintheirbarehands.Fromtheninthcentury,womenandlaymen usuallyreceiveddirectlyonthetongue.BytheeleventhcenturyonlypriestscouldtakeGodintheirhands.100 Moreover,changesinthephysicalelementsthemselvesmadethemseemmoreawesome,magical,andremote.Sincetheninthcenturythewaferhadbeenmadefrom unleavenedbread,perhapsbecauseitadheredmoreeasilytothetonguethandidleavenedbread.Intheearlytwelfthcenturythehostbegantobestampedwith picturesofChristratherthanwiththesimplemonogramscommonearlier.101Inthetwelfthandthirteenthcenturiesthechalicesometimescontainedmerelyadropof thepreciousbloodmixedwithunconsecratedwine(thesocalledlaychalice).Thecupwassometimeswithheldentirely.Inthethirteenthcenturythepeoplewere sometimesofferedsimplyacupofunconsecratedwineforcleansingthemouthaftercommunion.Theinterchangeofthevariouschalicesoftenwentunnoticed,and theologiansarguedoverwhetherthefaithfulshouldbetaughtthattheyreceivedthebodyandbloodinthewaferandmerewineinthechalice,orwhetherthecupofthe laityindeedheldthebloodoftheLord.102ThomasAquinasjustifiedthewithholdingofthecupbypointingoutthatthepriestreceivedbothspecies.103


Thetheorythatthepriestreceivedforthepeoplewaselaboratedgradually.OttoofBamberg(d.1139)saidthattheconvertedPomeraniansshouldcommunicate throughtheirpriestsiftheycouldnotreceivethemselves.BertholdofRegensburg(d.1272)explainedthatthecommunicatingpriest"nourishesusall,"forheisthe mouthandwearethebody.WilliamDurandustheElder(d.1296)suggestedthatthefaithfulreceivethreetimesayear"becauseofsinfulness"but"priests[receive] dailyforusall."LudolfofSaxony(d.1377)arguedthattheeucharistiscalledourdailybreadbecauseministersreceiveitdailyforthewholecommunity.104 NotonlywasthepriestthechannelthroughwhichGoddescended,hewasalsoseenasassimilatedtoChrist(ortheVirginMary)intheactofconsecration,asdeified atthemomentinwhichGodarrivedbetweenhishands."Ohrevereddignityofpriests,inwhosehandstheSonofGodisincarnatedasintheVirgin'swomb,"readsan oftencitedtwelfthcenturytext.105AndthefollowinglineshavebeenattributedtothewanderingpreacherNorbertofXanten,whofoundedanorderofclerics:

Priest,youarenotyou,becauseyouareGod. Youarenotyours,becauseyouareChrist'sservantandminister. Youarenotofyourselfbecauseyouarenothing. Whatthereforeareyou,ohpriest?Nothingandallthings.106

IfitisrighttohonourtheBlessedVirginMarybecausesheborehiminhermostholywombifSt.JohntheBaptisttrembledandwasafraideventotouchChrist'ssacredheadif thetombwherehelayforonlyashorttimeissoveneratedhowholy,andvirtuous,andworthyshouldnotapriestbehetouchesChristwithhisownhands....Apriestreceives himintohisheartandmouthandoffershimtootherstobereceived.107

Astheroleofthepriestwasexalted,thegapbetweenpriestandpeoplewidened.BythelateMiddleAgesinnorthernEurope,elaboratescreenswereconstructedto hidethepriestandthealtar.108Thus,atthepivotalmomentofhiscoming,Christwasseparatedandhiddenfromthecongregationinasanctuarythatenclosed togetherpriestandGod. Insuchanatmosphere,deepambivalencedevelopedaboutthereceptionofcommunion.109Ontheonehand,theologiansandcanonlawyers


encouragedfrequentreception.TherequirementofatleastyearlyconfessionandcommunionestablishedattheFourthLateranCouncil(1215)wasintendedtoset forthaminimumofobservance.Andanumberofthenewmonasticordersrequiredfrequentcommunion.But,ontheotherhand,theologiansfearedthatfrequent receptionmightleadtolossofreverence,tocarelessness,eventoprofanationoftheelements.Familiaritymightbreedcontempt.AlberttheGreat,forexample,who supportedthepracticeofdailycommunion,arguedagainstitforwomen,fearingthatfrequentreceptionwouldtrivializeresponse.110Theologiansoftenassertedthat abstainingoutofawewasequaltoreceivingwithconfidenceandjoy.QuotingAugustine,theyurgedaninteriorseeingandfeeding,whichbecamethenotionof "spiritualcommunion."111 Facedwithsuchambiguousadvice,manypiouspeopleinthelaterMiddleAgesdeveloped,alongwithafrenziedhungerforthehost,anintensefearofreceivingit. MargaretofCortona,forexample,pledfranticallywithherconfessorforfrequentcommunionbut,whengiventheprivilegebyChrist,abstainedoutofterrorather unworthiness.112GertrudetheGreatexpressedasenseofChristandsacramentastrulyawefulwhenshewrote:

You,whoarethesplendorandthecrownofcelestialglory,youappearedtodescendfromtheimperialthroneofyourmajestywithamovementfullofsweetness,andfloodedthe widthoftheskywithasweetliquorsothatthesaintshastenedtodrink... Andyouaddedthisunderstanding[tothevisionjustrecounted]:thatoneoughttoapproachthesacramentofyourbodyandbloodinsuchloveforyourcommunion(even beyondtheloveforyourglory,ifthatispossible)thatonewouldbewillingtoeatthesacramenttoone'sowncondemnation.113

GertrudetookcomfortforherownfeelingsofunworthinessfromwordsthatGodsupposedlysenttoherwhenshetriedtoexplainwhyafriendabstained:"Iheard your[i.e.,God's]blessedresponse:'Itisimpossiblethatanyonereceivingwithsuchanintention[i.e.,theintentiontoabstainfromfear]couldbeirreverent.'"114 Foralltheterrortheeucharistinspired,however,receptionofGodasfoodbetweenone'slipsremainedauniquelyimportantmodeofspiritualencounter.Late medievalsaints,especiallywomen,frequentlyreceived


fromconfessors,oreventhepopehimself,theprivilegeofdailycommunionasanalmostofficialrecognitionoftheirreputationsforsanctity.115Religioussuperiors, bishops,andcanonlawyerslegislatedagainstreceptionduringecstasy,inanefforttocontrolthewavesoffrenzyfortheeucharistthatshookreligioushouses.116The deathbedsofpiouspeoplesometimesbecamethesettingforbitterstrugglebetweenpriestandrecipientoverhowoftentheholyfoodcouldbetaken.117Indeed,as themomentofconsecrationbecameincreasinglyfraughtwithmeaning,asthepowerofpriestsgrewevermoreawesome,asthenotionofeatingGodseemedmore andmoreaudaciousandthedrinkofChrist'sbloodwaspermanentlywithdrawn,someofthedevoutfoundthattheirhunger,seasonedandimpelledbyfear,merely intensified.118Themorechurcharchitecture,liturgicalpractice,andpriestlypowercontrivedtomaketheelementsseemdistant,themoresomepeopleluxuriatedin theminprivate,ecstaticexperiences.JamesofVitry'sdescriptionoftheeucharisticpietyofMaryofOigniescouldbematchedbydozensofsimilardescriptionsfrom thenexttwohundredyears:

Thus[Mary]languishedinexile.Thesoleandhighestremedywasthemannaofcelestialbread,untilshecouldcometothepromisedland[heaven].Init,theanxietyanddesireof herheartweretemperedinit,allhersorrowswereappeased....Inthehighestandmostexcellentsacrament,shepatientlyboreallthehardshipsofherenforcedwandering... Theholybreadstrengthenedherhearttheholywineinebriatedher,rejoicinghermindtheholybodyfattenedherthevitalizingbloodpurifiedherbywashing.Andshecould notbeartoabstainfromsuchsolaceforlong.ForitwasthesametohertoliveastoeatthebodyofChrist,andthisitwastodie,tobeseparatedfromthesacramentbyhavingfor alongtimetoabstain...Indeed,shefeltalldelectationandallsavorofsweetnessinreceivingit,notjustwithinhersoulbuteveninhermouth...Sometimesshehappily acceptedherLordundertheappearanceofachild,sometimesasatasteofhoney,sometimesasasweetsmell,andsometimesinthepureandgorgeouslyembellishedmarriagebed oftheheart.Andwhenshewasnotabletobearanylongerherthirstforthevivifyingblood,sometimesafterthemasswasovershewouldremainforalongtimecontemplating theemptychaliceonthealtar.119

DespitetheauraofmajestythatsurroundedtheeucharistinthelaterMiddleAges,itseemedtothefaithfultoofferitselftotheirsenseswithastonishingfamiliarity.120It rangwiththemusicofbells,glowedwith


light,dissolvedonthetongueintohoneycomborbloodyflesh,andannounceditspresence,whenprofanedorsecretedaway,byleavingatrailofblood.Christ appearedagainandagainonthepatenandinthechaliceasababy,agloriousyouth,orableedinganddyingman.121 Thechangesinliturgy,theology,andevenarchitecturediscussedabovehelpexplainwhysomanyvisionsofChristcameatmass.Inanatmospherewhereconfessors andreligioussuperiorscontrolledaccesstotheeucharistandstressedscrupulousandawefilledpreparation,recipientsnaturallyapproachedtheelementsina spirituallyandpsychologicallyheightenedstate.When,aftermumblinginaudibly,thepriestsuddenlyandtotheaccompanimentofincenseandbellsraisedonhigha thin,shimmeringwaferofunleavenedbreadembossedwiththeimageofChrist,itissmallwonderthatthepioussometimes"saw"Jesus.When,afterhoursofself examinationanddoubt,anxiousnunsorlaypeopletookGodontheirtongues,itissmallwonderthatthebitofbreadsometimesswelled"withmarveloussweetness" tochokethem.Gazingaloftatahangingpyxshapedintheformofadove,somemysticsthoughttheysawtheHolySpiritwingingtowardthem,thewaferinhisbeak. Contemplatingthenewdevotionalobject,thecrucifix,indimanddampchurches,piouspeoplesometimesthoughtitdrippedbloodbecauseoftheirownprivatesins. Deniedthecuporeventhehostbyecclesiasticalregulation,manyofthedevoutthought,whentheyatleastobtainedreleasefromtheirinnerdistressandlonging,that thecomfortofChristwasintheirmouthsorheartsimmediatelywithoutthepriest'senablinghandsorwords. Aglanceatbasicmedievalattitudestowardfoodalsohelpsustounderstandcertainaspectsofeucharisticdevotion.Asculinaryhistorianshaverecentlyobserved,the characteristicmedievalmealwasthefeast,anditwasmoreanaestheticandsocialeventthanagastronomicone.122Thefeastwasabanquetforallthesenses indeed,foodwasalmostanexcuseforindulgingsensesotherthantaste.Medievalchroniclerswhodescribefeastsdonotgivemenus,althoughtheylavishattentionon theentertainmentprovided.Theydescribetheappearanceofdishes,nottheflavorthesequenceofevents,notofcourses.Medievalcookbooksmakeitclearthat visualeffectsweremoreimportanttoamedievaldinerthantasteandthatvividcolors(forexample,greendyefromspinachorleeks,orgoldandsilverleafgarnish) wereoftenappliedattheexpenseofflavor.Insomeaccountsofbanquets,itishardtotellwhetherthelavish


pastryconstructions,scenes,andpuppetshows(knowninEnglishas''sotelties")displayedbetweencoursesweremeanttobeeatenornot.Medievalcookbooks providedetailedinstructionsonhowtoconstructillusionsortricksfortheeye,suchasimitationmeatconcoctedfromfish,orroastfowlsewnbackintoitsplumagein ordertoappearalive,orpies(likethatinthenurseryrhyme)withlivebirdsbakedinside.123 Givensuchassumptionsaboutandexpectationsoffood,itissmallwonderthatmedievalmysticsconsideredsoundsandsightsascrucialtotheeucharisticbanquetas eating,orthattheysometimesfeltthey"ate"or"received"withtheireyesorintheirmindsandhearts.ItisnoaccidentthatChrist'sfeastinvolvedallthesenses,since secularbanquetsdidso.Norisitsurprisingthatonetaste(bread)changedeasilyintoanother(flesh,blood,meat,honey,etc.)inthemouthforordinaryfood,atits mostsumptuousandexciting,wasoftenillusion. Eventhelegalismofmedievalfastingpracticesmightencouragetheassumptionfoundbothincookbooksandintreatisesontransubstantiationthatthingswerenot reallywhattheyseemed.WhenanEnglishdinerinthe1460shadbarnaclegooseservedtohimasfish,hewrotethat"wehadtoeatitasfish,butinmymouthitturned tomeat."124Hisremarkwaspresumablyanironiccommentonhypocrisyorcasuistry,butmysticsusedsimilarphrasessimplyandsincerely.Whenthey"tasted" God'sbody,whattheyfoundwassometimesnotwhattheyanticipated,andtheyencountereditwithmorethanthesenseoftaste.Inaworldwherenotonlypoetsbut ordinaryfolkaswelltreatedthesensesasfarlessdiscretethanwedoandtheitemsofthephenomenalworldasmorefluidinidentityorsignificance,itishardly surprisingthatthosewhoateGod,likethosewhoateblackbirdpie,weresometimesastonished,titillated,ordisturbedbytheexperience. Historiansandtheologians,bothProtestantandCatholic,havecustomarilyseenlatemedievaleucharisticpietyasindividualisticasquietlybutsometimesinsidiously bypassingbothpriestandcommunity.125Suchinterpretationshaveemphasized(andsometimesdeplored)thelossofaliturgicalcontextfordevotiontotheelements andthedisappearanceofanysensethatChristianswereunitedinaholymealorinacommunalsacrificetoGod.Butitisnotquitetruethatlatemedievaleucharistic devotionlostallcorporateelements,narrowingtosimplytheindividual'sinnerexperienceofChrist.ExactlybecausethehostbecamesoinsistentlyChrist'sbody whosefirmoutlineshadbeenviolatedbyRoman(or


Jewish)spearsandnailsitremainedapowerfulcorporatesymbol,asymbolofhumankind,ofChristendom,andofthechurch. Twoconservativetheologiansofthetwelfthcentury,forexample,describedtheeucharistasthesalvationnotmerelyoftheindividualwhoreceivesitbutofall humanity,becauseitrecapitulatestheIncarnation.HildegardofBingen(d.1179)receivedavisioninwhichWomanasEve,symboloffallenhumankind,andasthe church,symbolofsavedhumanitycollectsChrist'sbloodinachaliceandhearsavoicesaying:"EatanddrinkthebodyandbloodofmySontoabolishthe prevaricationofEveandreceiveyourtrueinheritance."Hildegard'svisionwasnotaprivate,sensoryexperiencebutatheologicalstatement.Hermessageisclear: ChristianswhoeatGodeattogether,anditishumankindthatissaved.126Expressingthesamesensibility,RupertofDeutz(d.1135)wrote:

TotheoneandonlySonofGodandSonofMan,asiftoitshead,allthemembersofthebodyarejoinedallarereceivedinthefaithofhissacramentandthefullnessofhis charityandthusonebody,oneperson,oneChrist,theheadwithallitsmembers,ascendsintothesky...[Andheshowshimselftobe]twoinoneflesh.Agreatsacramentis this!ThefleshofChrist...thussatisfies[implevit]thewholeworld,sothatitmakesintoonechurchalltheelectwhohavebeenfromthebeginningsoftheworldorshallbeuntil theendoftime,joiningGodandmaneternally.127

Moreover,someoftheeucharisticvisionsseenbylatemedievalnuns,beguines,orlaywomenhavecorporateelementsorimplications.Forexample,whenMechtildof Hackeborn(d.1298or1299)received"theimprintofresemblance"toGodin"thehourofcommunion,"shereceivedalsoChrist'sheartintheformofacup marvelouslychiseled."Bymyheart,''sheheardhimsay,"youwillpraisemealwaysgo,offertoallthesaintsthedrinkoflifefrommyheartthattheymaybehappily inebriatedwithit."128Mechtild'ssisternunGertrudetheGreatreceivedavisioninwhichthosenunswhomovedtowardGodholdingthehandsofothers(i.e.,trusting intheprayersofothersforthem)werethefirsttoreachthesplendorsoflightfromChrist'sheart.129 Thehostwasapowerfulsymbolnotjustofhumankindorofthemonasticcommunitybutalsoofthechurch.WilliamofSt.Thierryexplainedthatthebodyonthealtar isChristintercedingforus:itisthe


physicalbody,bornofMaryitisalsothemysticalbody,thechurch.BaldwinofFord(d.1190)stressedthatcommunionunitesusnotonlywithJesusbutalsowith thewholechurchincommunity.130ArnoldofBonneval(d.after1156),inoneoftherareeucharisticprayersthatsurvivefromtheperiod,expressestheidentification ofeucharistandchurch(althoughhisemphasisisonthecomplexsignificanceofthesacramentfortheindividualChristian):

Christcallsthissacramentsometimesfleshandblood,sometimesbread,andsometimeshisbody.Itiscalledbreadbecauseitisthenourishmentoflife,fleshandbloodbecauseof thetruthofitsnature,bodybecauseofitsunityofsubstance.Byhisbodyhemeanttoindicatebothhimselfandhischurch,ofwhichheisthehead,andwhichheunitesbythe communionoffleshandblood.Andweindeed,whenweeatthefleshandblood,willnotbereformedinthecorruptandinfirmnatureofourbodyandsoulnorreturnedtolikeness withGodunlessasuitablepoulticeisplacedonsin.131

Indeed,latemedievaleucharisticdevotion,parallelingthetheologicaldiscussionsofconcomitanceandofthetotusChristusineveryparticleofbread,cameto expressanalmostfranticsenseofthewholeness,theinviolability,ofChrist'sbodyandatremendousfearofrendingandbreaking.Tubach'sindexofexemplalistsfifty threemiracleshavingtodowiththehostandonlythreeconcerningthechalice.132Itishardtoavoidtheconclusionthatthisemphasisonthehostreflectedafearthat themysticalbody,thechurch,wouldberentbyitsenemies. Insistentlythehostforceditselfontothesensesofbelieversasfleshwithfirmboundaries.Themanymiraclesofconsecratedwafersoozingorstreamingdropsofblood wereunderstoodtobeannouncingnotjustthesinsofindividualChristiansbutalsoattacksbyoutsiders,especiallyhereticsandJews.Miraclesofbleedinghosts, whichproliferatefromthetwelfthcenturyon,sometimeshavesinisterovertones.Thehostbecomesfleshtoannounceitsviolationthebleedingisanaccusation.When thenunWilburgis(d.1289)tookthehosttoherenclosuretohelpheravoidsexualtemptation,itrevealeditself,inaquitecommonmiracle,asabeautifulbabywho spokethewordsoftheSongofSongs.133Butwhenanothernunhidahostthatshedarednotswallowbecauseshewasinmortalsin,itturnedintoflesh.134The secondmiraclesoundsathreateningnotenotpresentinthefirst.Similarly,PeterDamiantellsofahost


thatprotesteditsabusewhenusedsuperstitiously:awomanwhotriedtoconjurewithitfoundthathalfofitturnedintoflesh.135CaesariusofHeisterbachreportsthat whenanotherwomantriedtousetheconsecratedwaferasalovecharmandthenguiltilyhiditinachurchwall,itturnedtofleshandbled.136Beginninginthelate thirteenthcentury,Jewswerefrequentlychargedwithviolatingthehost,whichannouncedsuchviolationbymiraculousbleeding.LionelRothkrughasrecently underlinedtheconnectionbetweeneucharisticdevotionandantiSemitism.Intheyearsbefore1350anumberofJewsweremurderedforallegeddesecrationsofthe host.137 Moreover,eucharisticmiracleswereexplicitlyseenasvindicationsoforthodoxdoctrine.Eleventh,twelfth,andthirteenthcenturypreacherssuchasPeterDamian, EckbertofSchnau,andAlanofLilleembellishedtheirsermonsagainsttheCatharswithstoriesofbleedinghosts.138Severalthirteenthcenturytheologians,suchas thehagiographersJamesofVitryandThomasofCantimpr,supportedtheincreasingfrenzyofwomen'seucharisticpietyasacountertothehereticaldenialthatGod couldbepresentinmatter.139 TheabstinenceofLutgardofAywires(d.1246)reflectsasimilarfearthatGod'sbodymightbebreachedbyheresy.LutgardbothidentifiedwithChristonthecross byfastingforsevenyearsand,attheVirgin'scommand,offeredherfastasareparationtoGodforthedepredationsoftheAlbigensians.140WhenGertrudetheGreat madetheeucharistichostintomanycrumbsinhermouth,thinkingthateachparticlestoodforasoulintheflamesofpurgatory,sheseemedtobeequatingthe crumblinessofbreadnotwiththeunityofChristians(asdidAugustine)butwiththeirindividualness,theirseparateness,theirsuffering.Gertrude,whooftenfearedto takecommunion,wasawareoftheaudacityofthusviolatingtheintegrityofthebodyofGod.141Asimilarnoteofwarningsoundsinavisionofcrumbsreceivedby FrancisofAssisi.WhenFranciswasorderedtogatherupthecrumbsandmakethemintoonehostforthebrethren,healsosawinvisionthatthosebrotherswhodid notreceivethegiftdevoutlywereafflictedwithleprosy.Thejoiningof"finecrumbs"intoahostheresymbolizesunity,butthehostthenstandsforaRuleandthose whoobserveitimproperlyaremadeillbyit.Thesymbolofunityexcludesassurelyasitjoins.142 Ifbread/body/flesh,withitsfirmboundaries,symbolizedspiritualrefreshmentand,atleasttosomeextent,church,bloodwasanaltogether


morecomplexandambivalentsymbol.AsthelettersofCatherineofSienasuggest,143bloodwaslifeitself,coursingthroughChrist'sveins,leapingforwardfromhis violatedside.Itwasfood,bothbecauseblooditselffeedsfleshandbecauseblood(processedintomilk,accordingtomedievalphysiologicaltheory)144feedsthe young.Itwasapurgingbath.Itwasbloodshed,thepalpablesignofattackonGod.GertrudetheGreatsaidtheeucharistredeems"evenblood,"whichshecalled"the mosthorribleofnaturalobjects."145Itisnotsurprising,therefore,thatbloodbecameamorecommonandinsistentsymbolasthefourteenthcenturyworeon.The increasedclericaldeterminationtowithholdthecup(theblood)fromthelaitymaythushaveadeeperreasonthantheoneusuallycited:fearofprofanationthrough spilling.Toassociatethelaitydirectlywithsuchapowerfulsymbolofviolationaswellasofsalvationmaysimplyhavebeenfraughtwithtoomuchsignificance.Indeed, thedemandoftheUtraquists,whopushedforcommunioninbothkinds(subutraquespecie),mayhaveseemednotonlyadeliberaterejectionofthedoctrineof concomitanceandanationalistprotestagainsttheheadshipoftheRomanchurch(whichitcertainlywas)butalsoadangerousdemocratizationofanextraordinarily potentandcomplexsymbol. Thecorporateimplicationsoflatemedievaleucharisticsymbolismarethusatleastpartlydefensive.WhereasCyprianhadseenthebreadofheavenasasymbolof Christ'schurchpreciselybecausethegrainsofwheatweregatheredintoawhole,latermedievaltheologiansandvisionariessawinChristasbleedingfleshnotonlythe redemptionofhumankindbutalsoanentityunderattack.AndhoweverpowerfullytheentitysometimessuggestedtheChristiancommunity,eitherunitedinloveor violatedbyenemies,itwasbasicallynotacorporatesymbolatall.ThebreadonthealtarwasthesufferingfleshoftheGodmanwhodiedthebloodandwaterthat pouredfromthebrokenbodyfedandcleansedtheindividualChristian.Incertainways,thepriest,nottheeucharist,wasthepowerfulcorporatesymbol.Hewasthe "mouth"ofthechurch,asBertholdofRegensburgsaid.ButasDurandusimplied,healsowasthechurchhereceivedforall.Certaintwelfthcenturytextssuggested thatinsofarasthepriestwasthe"womb"withinwhichChristwasconsecrated,hestoodforallhumanity. Itisthusaccuratetosaythatlatemedievaleucharisticpietywasindividualistic.Theemphasiswasincreasinglyonexperienceontasting,seeing,andmeetingGod. Forthemostpart,theelementsofcosmic


dramafellawayfromeucharistichymnsandstories.Andasencounterwiththeeucharistcametomeanbindinguntooneselfeithertheinebriatingjoysofmysticalunion ortheunspeakablepainofGod'ssuffering,hungerbecameapowerfulmetaphorfordesire.InearlyChristianhymns,hungerseemstomeanhumanvulnerability(either inflictedbynature'srhythmofscarcityandplentyorespouseddeliberatelyinfasting)theimplicationis,therefore,thatthehungrywillbesatisfied.Inthespiritualityof eleventhandtwelfthcenturyEurope,however,hungerbegantomeanacravingthatcanneverbefilled.Thustheauthorofthefamoushymn"DulcisJesumemoria" wrote:

DulcisJesumemoria Dansveracordigaudia: Sedsupermeletomnia Ejusdulcispraesentia. .......... Quitegustant,esuriunt, Quibibunt,adhucsitiunt Desidarenesciunt NisiJesumquemdiligunt. ............ Jesusdecusangelicum, Inauredulcecanticum, Inoremelmirificum Cordepigmentumcaelicum. (SweetistheremembranceofJesusinthetruejoyoftheheart.Buthispresenceissweetbeyondhoneyandallthings...Theywhotasteyou[Jesus]stillhunger,andtheywho drinkyoustillthirst.TheyarenotabletodesireanythingexceptJesus,whomtheylove...Jesus,gloryoftheangels,[youare]asweetsongintheears,inthemouthwonderful honey,thespicedwineofheavenintheheart.)146

Thuslovesalovingsoul...Itsdesireeverincreases.Forhecanneverbesatiatedwhosedesireisonlytodesire.Desireisthehungerofthesoul...Godsays:Theythateatme shallyethunger[Eccles.24:29].OhGod,toloveyouistoeatyou.Yourefreshthosewholoveyousothattheyhungermore,forareyounotsimultaneouslyfoodandhunger?He who

Page67 doesnottasteyouwillnotknowatallhowtohungerforyou.Forthisonlydoyoufeedus,inordertomakeushunger.147

Todieofhungerforher[i.e.,LoveofGod]istofeedandtaste Herdespairisassurance ........... Hertendercareenlargesourwounds ................ Hertableishunger.148

Thus,bythethirteenthandfourteenthcenturies,theemphasisofhymn,sermon,andstorywaslessonthebreadofheaventhanonflesh(i.e.,meat)andblood.Toeat Godwastotakeintoone'sselfthesufferingfleshonthecross.ToeatGodwasimitatiocrucis.ThatwhichoneatewasthephysicalityoftheGodman.Iftheflesh wassweetaswellasbitter,thatwasbecauseallourhumanness,includingourfleshliness,wasredeemedinthefactoftheIncarnation.Iftheagonywasalsoecstasy,it wasbecauseourveryhungerisunionwithChrist'slimitlesssuffering,whichisalsolimitlesslove. ThissenseofGodasfoodpermeatedspiritualityoutsideaswellaswithintheeucharisticcontext.ColetteofCorbie,forexample,receivedonenight,assheprayedto theVirgin,avisionof

adishcompletelyfilledwithcarvedupfleshlikethatofachild.Andsheheardthisreply:"ThisiswhatIrequestofmybelovedonaccountofthehorriblesins,injuries,and offensesthatpeopledoagainsthim,offensesthattearhimintosmallerpiecesthanthefleshcutupuponthisplate."Andbecauseofthisvisionsheboreforalongtimeinher heartsadnessandpain.149

IdaofLouvain(d.1300?)supposedlytastedtheWordasfleshonhertonguewheneversherecited"Verbumcarofactumest"(John1:14).150Incontrasttoearly medievalmonastictexts,whichfrequentlyspeakofreadingandmeditatingaschewingthewordofGodbutlaynoclaimtoaphysicalexperience,151Ida'sbiographer tellsusthattheWordshechewedwaslikehoney,"notaphantasmbutlikeanyotherkindoffood." ThethemeofGodasfoodwasalsoacommoniconographicmotif.Forexample,afifteenthcenturySwabianaltarpiecedepictingtheso


called"mysticalmill"showsMaryemptyingsacksofwheatintoafunnel,fromwhichemergeboththeChristchildandthehost(seeplate1).152Inpaintingsofthe massofSt.Gregory(basedonanearlymedievalstorythatgainedpopularityinlatermedievalart),Christappearsatthemomentofconsecration,sometimesbleeding graphicallyintothechalicetoprovidefoodanddrinkforChristians(seeplate3seealsoplates26,27,and30).153Anevenmorestunningdepiction,fromthestudio ofFriedrichHerlinin1469,showsChristasableedingmanofsorrowswithagrainshoot(representingbread)andavine(representingwine)growingoutofthe woundsinhisfeetandhands(seeplate4).154 Feastandfast,andthemetaphorsinwhichtheywerehymnedandpreached,thuschangedbetweenthetimeoftheearlychurchandthehighMiddleAges.Toearly Christianpreachers,fastandfeastjoinedthebelievertotherhythmoftheseasons.Virtuosoasceticperformancewasadmired,butitwasonlyavariationonthe corporatepracticeofthechurch.TheindividualbelieverreceivedthesweetnessofGod'sbodyinconcertwithotherbelievers,inacommunitysymbolizedqua communitybythebreadofheaven.155BythelaterMiddleAges,despiteeffortstoenforceauniform,moderateobservance,thesettinggiventofastingbypreachers andtheologianswaslesscorporateandcosmicthepracticeofsomeindividualswasincreasinglyidiosyncraticandextreme.DevotiontoGod'sbodywasalsoatleast partlycutloosefromacorporatesetting.Notonlydidreceptionitselffrequentlyoccuraftermassthebelieversometimesencounteredthefleshandbloodthrough privatevisionaswell,atthemomentofelevationorevencompletelyapartfromtheliturgy. Suchchangesmayinpartreflectthemassivesocialandeconomicchangesbetweenantiquityandthemedievalworld.Inthesmall,busy,merchantdominatedcitiesof themedievalurbanrevival,wheretheneweucharisticpietyflourished,foodwasperhapsmoreacommodity,cutofffromtherhythmofvillagelife,thaniteverwasin thevastcitiesoftheRomanEmpire,sodependentonthecountrysideforgrain.Thusitwaseasierforthedaughtersandsonsofthesemerchantsorurbanaristocratsto thinkoffoodasanobjecttobemanipulatedratherthanasanecessityoflifesobasicthatitdefinedandwasdefinedbycommunityexperience.Perhaps,then,itisnot surprisingthatinaperiodofintenseworldrejection,thiscommodityobtrudeditselfasaprivilegetoberenounced.Norisitsurprisingthatvirtuosofastsgrewmore commonasfamine


andmalnourishmentbegan,fromthelaterthirteenthcentury,tobenoticeableaspectsofEuropeanlife. Whatevertheconnectionbetweeneconomicfactsandreligiosity,however(andthereiscertainlynodirectcorrelationbetweentheshiftsinChristianpietyand Europeaneconomicconditions),thesechangesinsensibilityandpracticewerelargechanges.TheytouchedallChristians.Indeed,socrucialafacetofhuman experienceasfoodcouldhardlyhavehadsignificanceforonlyonesocialgrouporonegender.ButcarefulexaminationoftheevidencesuggeststhatinthelaterMiddle Ages,bothfeastandfastweremorecentraltowomen'sspiritualitythantomen's.Againstthebackgroundsketchedhereoffoodpracticesandmetaphorsinthehigh MiddleAges,andtheirrootsinearliertradition,Iwishnowtoexplorewhatfoodmeanttopiouswomenandwhyitmeantwhatitdid.




3 FoodAsaFemaleConcern: TheComplexityoftheEvidence
AndblessedMarysaidto[Alpas]:"...because,dearsister,youborelongstarvationinhumilityandpatience,inhungerandthirst,withoutanymurmuring,Igrantyounowtobe fattenedwithanangelicandspiritualfood.Andaslongasyouareinthislittlebody,corporealfoodanddrinkwillnotbenecessaryforthesustainingofyourbody,norwillyou hungerforbreadoranyotherfood...becauseafteryouhaveoncetastedthecelestialbreadanddrunkofthelivingfountainyouwillremainfattenedforeternity...."Andsoit was....Butinorderthatthetumultofgossipbequieted,sincesomesaidshehadadevilshewhoneitheratenordranktwoorthreetimesaweekshewasaccustomedtoaccept somemorsel.Andshewouldrollitaroundforatimeinhermouth...andthenspititbackwhole....AndIgivethisonmyowntestimonysinceIreceivedinmyownhandalittlebit ofmasticatedfishshespitout....Thus,rejoicingasifpossessed,shefrequentlyvomitedfromtoomuchfood,asifherdrunkennessandinebriationwereincreasedbyanything beyondatinybit.Andthiswashowandofwhatsortherpreservationwas,howandofwhatnaturewerethebeginningsofherconversion,andhowGodunderlinedhermeritsand virtueswithmiracles...bywhichmiraclesmanifestsignsaregiventothereaders[ofthisstory]. LIFEOFALPASOFCUDOT(D.1211)1

InthespiritualityoflatemedievalEurope,eatingandnoteatingwerepowerfulsymbols.Bothmenandwomenfastedoradulteratedwhatfoodtheyateinorderto destroyanypleasuretheymightexperienceinit.BothmenandwomenadoredChristinthebreadandwineonthealtar,receivedeucharisticvisions,andworkedto propagateeu


charisticpiety.Bothmenandwomengavealmsandfoodtothepoor.MensuchasDominic(d.1221),RichardofChicester(d.1253),andVincentFerrer(d.1419) andwomensuchasClareofAssisi,AgnesofMontepulciano(d.1317),andCatherineofSienaweresaidtoperformmiraclesinwhichtheymultipliedfoodforothers orhadtheirsanctityrewardedbymannasentfromheaven.2 Poetsandexegetesbuiltelaborateallegoricalconstructsaroundthethemesofmilkandmeat,honeyand thehoneycomb,breadandwine,feedingornursing.Visionsinwhichinstruction,comfort,grace,andsalvationwereseenasmilkorbloodpouringfromthebreastsof theVirgin,ofChrist,orofreligiousleaderssuchastheapostlePaulorFrancisofAssisiwerereceivedbybothmenandwomenbetweenthethirteenthandfifteenth centuries.3 Butdespitethepervasivenessoffoodassymbol,thereisclearevidencethatitwasmoreimportanttowomenthantomen. Itmayseemsurprisingthatthisfacthasnotbeennotedbefore,especiallysinceboththemorebizarrecasesoffastinggirls4 andthedeepdevotionofwomentothe eucharisthavebeenfairlyfrequentlydiscussedbyscholars.InthelatenineteenthandearlytwentiethcenturiesbothmedicaldoctorsandCatholictheologianswere deeplyinterestedinthephenomenonofwomen(usuallyadolescentgirls)whoclaimedtolivewithouteating.Thisinterestwasforeshadowedintheeighteenthcentury whenPopeBenedictXIV(d.1758)commissionedanappendixforhisgreatworkoncanonizationtoconsiderwhethertheextendedfastsclaimedforcertainCatholic women,severalofthemstigmatics,couldbenatural.5 Bythelate1800sanumberofCatholicscholarswerefascinatedbysuchphenomena,6 andearlierinthis century,CatholicsstimulatedinpartbythecaseofTheresaNeumannofKonnersreuth(d.1962)continuedafairlyheateddiscussionofwhethertheabilitytolive withouteatingneedbeinanysensearesultofsupernaturalpowerand,therefore,asignofsanctity.(Giventhestrangebehaviorofcertainfastinggirls,many theologianswishedtoanswerthatitisnot.)7 NineteenthcenturydoctorssuchasW.A.HammondandRobertFowlerattackedtheclaimsoffastingwomenwith considerablebadtemper8 andtheinterestofthemedicalprofessioninfastingledinthelatenineteenthandearlytwentiethcenturiestofoodfadsandtoscientific experiments,culminatinginatestbytheCarnegieInstitutein1912todeterminehowlonghumanbeingscouldsurvivewithoutfood.9 Theearly1980ssawa


flurryofinterestbothinthepopularpressandamongdoctorsinsocalledfemaleeatingdisorderswithouttheleastawarenessofthereligiouscontextinwhich,until veryrecently,similarbehaviorsoccurred.10 Therolethatthirteenthandfourteenthcenturywomenplayedinthepropagationofeucharisticdevotionhasalsobeennotedbyscholars,oftenratherincidentally.11 Buthistorianshavetendedtocorrelateeucharisticconcernwithfactorsotherthangenderforexample,withreligiousorder(particularlyCistercianorDominican),12 withregion(particularlytheLowCountriesorsouthernGermany),13orwithtypeofreligiouslife(particularlymonasticoranchoritic).14Theoverwhelmingtendency amonghistoriansofspirituality,untilrecently,hasbeentostudyfiguresinthecontextoftheorderswithwhichtheywereaffiliated,thusobscuringbroadertrendsinthe historyofpietyandsometimesleadingtorathersteriledebatesoverprecedence.15Therecentextensiveworkonmedievalsaints,someofitdeeplyinterestedinsocial context,has,withafewexceptions,beenmoreconcernedwithclassorregionaldifferencesthanwithgender.16Ithas,moreover,sometimesbeensoconcernedwith socialorpsychologicalissuesastoloseanyfinegrainedsenseofspiritualthemes.17Thustheextenttowhichwomenofalllifestylesandaffiliationsreveredthe eucharistlaywomen,recluses,tertiaries,beguines,nunsofallorders,andthosewomen(especiallycommonintheearlythirteenthcentury)whowanderedfromone typeoflifetoanotherhasbeenobscured,althoughtheevidencehaslongbeenavailable. Basically,however,women'sconcernwiththereligioussignificanceoffoodhasbeenignoredbecausephenomenasuchaseucharisticdevotion,fasting,food multiplicationmiracles,andlactationvisionshavebeentreatedinisolationfromoneanother.Justasdoctorsandpsychiatriststendtotreatfastingundersuchrubricsas fearofmutilation,rejectionofthemother,andbattleforcontrolforgettingthat,whateverelseitis,itisafoodpracticesotheologiansandhistorianshavefailedto noticethatfoodmiracles,eucharisticpiety,andabstinenceareallfoodpractices.OnceonenoticesthateatingandnoteatingarecentralthemesinmedievalEuropean culture,asinmanycultures,muchofthelongavailableevidenceonspiritualityappearsinnewpatterns,andnewevidencebeginstoemerge.Itisthenthatthereligious significanceoffoodforwomenbecomesclear.


QuantitativeandFragmentaryEvidenceforWomen'sConcernwithFood Anumberofrecentworksonsanctityprovidequantitativeevidencethatfoodisamoreimportantmotifinwomen'spietythaninmen's.DonaldWeinsteinandRudolph Bell,intheirstudyof864saintsfrom1000to1700,demonstrateconclusivelythatalltypesofpenitentialasceticism,includingfasting,aresignificantlymorecommonin femalereligiosity.Althoughonly17.5percentofthosecanonizedorveneratedassaintsfrom1000to1700werewomen,womenaccountedforalmost29percentof thosesaintswhoindulgedinextremeausterities,suchasfasting,flagellation,orsleepdeprivation23.3percentofthosewhodiedfromsuchpracticesand53.2 percentofthoseinwhoselivesillnesswasthecentralfactorinreputationforsanctity.18RichardKieckhefer,inhisexaminationoffastingbyfourteenthcenturysaints, citesalmostasmanyexamplesofwomenasofmen,despitethefactthatfewerthan30percentofthosereveredassaintswerewomen.Kieckheferalsofindsthat,in theperiodhehasstudied,HenrySusoisalmosttheonlymaletoreceiveeucharisticvisions.19AndrVauchez,inhisstudyoflatemedievalcanonizations,suggeststhat fastingwasimportantforonlyonetypeofmalesaintthehermit(whowasoftenalayman)whereasitwasacrucialcomponentofthereputationofholywomen.20 TheolderworkofHerbertThurston,whichattemptsa''scientific"approachnolongerfashionable,nonethelessassemblesawiderangeofcases.Itis,therefore,worth notingthatThurston'sdiscussionof"authentic"foodmultiplicationmiracleslistsalmostasmanyperformedbywomenasbymen.21 PeterBrowe'sworkontheeucharistindicates,moreover,thattheeucharisticmiracleisalmostentirelyafemalegenre.22IfoneacceptsBrowe'scategories(oftwenty typesofeucharisticmiracle),onlytwotypesoccurprimarilytomales,andbothoftheseareassociatedwiththeactofconsecration,whichcouldbeperformedonlyby men.Thetwomaletypesarethemiracleofthespiderinthechalice,traditionallytoldofpriests,andthemiracleoftransformationatthemomentofconsecration,which wasbydefinitionlimitedtopriests.Atleasteighttypesofeucharisticmiracle,however,arepredominantlyorexclusivelyfemale.Fourtypesoccuralmostexclusivelyto women:miraclesinwhichtherecipientbecomesacrystalfilledwithlight,miraclesinwhichtherecipientdistinguishesconsecratedandunconsecratedhosts,miraclesin


whichworthyandunworthyrecipientsandcelebrantsaredistinguished,andmiraclesinwhichtheeucharisthasaspecialeffectonthesenses(smellingsweet,ringing withmusic,fillingthemouthwithhoney,announcingitspresencewhenhiddenawayorhoarded,etc.).Predominantlybutnotexclusivelyfemalearemiraclesinwhich thehostorchalicechangesintoabeautifulbabymiraclesthatsometimes(butnotalways)havehighlyeroticovertonesforbothmenandwomen.Moststrikingofall, thereisonlyonemaleexample(afterthepatristicperiod)ofthecommonstoryofthesaintwholiveslargelyorentirelyontheeucharist.Thereareveryfewmalecases ofthevariousdistributionmiracles,inwhichtheeucharistisbroughtbydovesorangelsorfliesbyitselfthroughtheair,andthesearemostlytoldoflowstatusmales laybrothersoraltarboys.AndthereappearstobeonlyonemalecaseofthemiracleinwhichChristbecomesthepriestandoffershimselfasfoodanactsometimes accomplishedwithfrighteningliteralism,aswhenhetearsoffthefleshfromthepalmofhishandforAdelheidofKatharinental.23Notonlyarethesepatternsstrikingin themselves,itisalsoclearthatthemalemiraclesunderlinethepowerofthepriest,whereasinatleasthalfofthewomen'smiraclesitisthequalityoftheeucharistas foodthatisstressed.24Theeucharistisofferedasfleshorhoneycombitaffectsthetasteitsustainslifeitisvomitedoutifunconsecrated. AcursoryglanceatthehistoryofeucharisticpietyindicatesthatwomenwereprominentinthecreationandspreadofspecialdevotionssuchasthefeastofCorpus Christi(revealedtoJulianaofCornillon)25orthedevotiontotheSacredHeart(foundespeciallyintheFlemishsaintLutgardofAywiresandthemanyvisionsofthe nunsoftheSaxonmonasteryofHelfta).26Soimportantwastheeucharistthatsomethirteenthcenturywomen(e.g.,IdaofNivellesandtheViennesebeguineAgnes Blannbekin)madevocationaldecisionsorchangedordersoutofdesiretoreceiveitmorefrequently.27Storiesofpeoplelevitating,experiencingecstasyduringthe mass,orracingfromchurchtochurchtoattendasmanyeucharisticservicesaspossibleareusuallytoldofwomenforexample,ofHedwigofSilesia(d.1241), DoucelineofMarseilles(d.1274),andseveraloftheFlemishholywomendescribedbyJamesofVitry(seetheepigraphtochapter1above).28TheworkofImbert Gourbeyre,despiteitsscantydocumentationandnotoriouslyuncriticalstance,nonethelessprovidesarevealingideaofwhatthepious


expectedofreligiousheroesandheroines.ImbertGourbeyreculledfromsaints'livesninecasesofmiraculousabstinence,allofthemfemale,andfiftytwocasesof miraculouscommunion(betweenthethirteenthandsixteenthcenturies),ofwhichfortyfivearefemale.29 Eveninaccountswrittenbymedievalmalesformaleaudiences,wefindtheeucharistandtheattendantthemeofthehumanityofChristassociatedespeciallywith women.Forexample,CaesariusofHeisterbach,writingintheearlythirteenthcenturyformalenovicesanddrawingonhisownmaleworld,ingeneraltold overwhelminglymalestories.Inhistreatmentofdying,intheDialogueonMiracles,hegivesfiftyfourstoriesaboutmenandeightaboutwomenonpunishmentofthe dead,hegivesfortysevenmalestoriesandeightfemaleonsuchtopicsaslustanddespair,hepreservesasimilarratio.Butwefindasmanycasesofnunsasof monksreceivingtheinfantJesusinvisions,andtherearemorethanhalfasmanyappearancesofthecrucifixtowomenastomen.Inthesectionontheeucharist,where heturnsfromcelebrant(allmalestories,ofcourse)torecipient,wefindalmostasmanymiraclesoccurringtowomenastomen.30Althoughseveralearlycollectionsof exemplaaddressedtomen(forexample,ConradofEberbach's,PetertheVenerable's,andGeraldofWales's)containstoriesonlyaboutmales,31bothJamesof VitryandThomasofCantimpr,writinginthethirteenthcentury,givefemaleaswellasmaleexamplesofeucharisticmiraclesanddevotion.32Tubach'sindexof exemplaliststhirtytwomiraclesconcerningthehostthatoccurredtomen,twentytowomen.Ofthemalemiracles,twelveoccurredtopriests.33 Exemplaaboutfastingorabstinenceshowasimilarpattern.About10percentofthestoriesinTubach'sindexconcernwomen.34(Thestorieswere,ofcourse,toldby preachersi.e.,bymen.)Women,however,figureinasignificantlyhigherpercentageofthestoriesconcerningfoodpractices.Exemplaaboutabstinencearefew fourteencases,elevenofwhichtellofamanorwomanpracticingabstinence.Nonetheless,oftheeleven,four(36percent)areaboutwomenandsevenaboutmen.35 Moreover,thefourstoriesaboutwomenseemtoexpressanxietyaboutfemalepractice,fortwourgemoderationandtwo(theonlytwowiththismotif)show individualstrickedbythedevilintooroutofabstinence.36Thethirtythreestoriesoffasting(twentysixofwhichareaboutthefoodpracticesofindividuals)are predominantlyaboutmen,althoughcasesoffemalesare19percentofthetotal(fiveoutoftwentysix)stillabove


thepercentageofwomen'sstoriesgenerally.37Whenwelookmorecloselyatthecasesoffasting,however,severalinterestingfactsemerge.Thelongestfastsare thoseofwomen.(Onelastedthirtyyears,anotherthree,whereasthelongestmalefastwasseventyeightweeks).38Womenprovidebothofthecasesoffastinguntil death.39Furthermore,ofthetwentysixstoriesaboutindividuals,onlynineteenareactuallyaboutfasting.(Theothersareaboutfailuretofast.)Sinceallthefemale casesareaboutfasting,womenaccountfor26percent(fiveoutofnineteen)ofthestoriesofpeoplewhofast. Notonlydidpreacherstelladisproportionatenumberofstoriesaboutwomenandfoodpracticestheyalsotendedtoadvisewomenaboutbothfastandfeast.Evenin thepatristicperiod,writerswhoaddressedwomentendedtoassociatefoodandlustandtodevoteaninordinateamountoftherelativelylittlewritingtheydirected towardwomentothesetopics.TwoofJerome'smostextensivediscussionsoffoodasincentivetolicentiousnesswereaddressedtowomen,40andFulgentiusof Ruspe(d.533),adiscipleofAugustine,wroteseverallettersonfastingtowomen,urgingafinebalancebetweenabstinenceandmoderation:

Wemustpracticesuchmoderationinfastingthatourbodyisnotexcitedbythefullsatisfactionoftheappetiteorenfeebledbytoomuchprivation.Itisnecessarythenthatthe fastofvirginsbefollowedbyeatingsuchthatthebodyisnotdrawnbythepleasuresofeatingnorexcitedbyitsfulfillment.41

MedievalpreacherssuchasPetertheChanterrepeatedJerome'sadvicetowomenandcitedpatristicexamplesoffemaleasceticsandfasters.42 InmonasticcirclesinthehighandlaterMiddleAges,wefindsomeevidencethatmoralistsassociatedfoodwithmenmorethanwithwomen.Butthefoodbehavior especiallyassociatedwithmenwasgluttony,notabstinenceorfoodprovidingoreucharisticfervor.Forexample,ashortbutpopularantimonasticparodyfromthe laterMiddleAges,theDemonachiscarnalibus(OnWorldlyMonks),survivesinthreeversions,oneanadaptationfornuns.Althoughthemonks'versionspresenta fairlyunpleasantpictureofthemonkwho"asksnomorethanthathisgutsbefilled,"thenuns'versioneliminatesmostofthefoodreferences,suggestingthatvanity aboutlooksandclothesisagreatertemptationtowomenthanmeals.43Thisconcernwithgreedasaviceofmonks,whichbecomesathemeinmedievalsatire,44 probablyreflectsthefactthatsome


latemedievalmonastichousessetlavishtables.45Ingeneral,malehouseswerebothwealthierandlargerthanfemalehouses,andgluttonywas,infact,agreater possibilityand,therefore,temptation.46 ThroughouttheMiddleAges,however,preachersassociatedreligiousfoodpracticesespeciallycharitablefooddistribution,fasting,andeucharisticfervorwith women.Inthethirteenthandfourteenthcenturies,theologianssuchasAlberttheGreat,DavidofAugsburg,andJohnGersontendedtoworryaboutwomen's eucharisticpietyandtheirfoodasceticism,althoughwriterssuchasJamesofVitry,ThomasofCantimpr,JohnTauler,andGersonhimselfalsofoundtheseaspectsof women'sspiritualityusefulinpolemicagainsthereticsoragainsttheapatheticorthodox.47Gerson,whoperhapsmorethananyothermalewriterstressedtheeucharist asexperientialreceptionofGod,feltthatMaryreceivedmysticaleucharisticexperiencesbeyondthoseofallothermortals.Moreover,hedescribedtheecstasiesof bothmaleandfemalemysticsinstrikingfemininemetaphors:

Inhim[Christ]isthetruevine,whosewinegeneratesvirginsandnotonlygeneratesthembutimpregnatesthem.Lethimgivethatwine,lethimgivethesoberinebriationofthe spiritasdrink.Heintroducesmeintothecellarofthevineyard.Whatdoyouwant,ohmysoul?Alittlewhileagoyousaid(afteraskingforthekissofhismouth):thybreastsare sweeterthanwine....Whydoyounowseekwine?ButIshallanswerforyouthatheisbothwineandmilktoyou....Hecalls:Eat,myfriend,anddrinkandbeintoxicated....He willbesweetfruittoyourthroat.48

Maletheologianswrotemuchontheeucharist,andcertainformaltheologicalconsiderationsofthesacramentwere(likeallscholastictheology)exclusivelymale genres.ButitisstrikinghowmanyimportanttreatisesontheeucharistoronthecloselyconnectedthemeofthehumanityofChristwereaddressedbymentowomen. Onethinks,forexample,oftheworksofJanvanRuysbroeck(d.1381),RichardRolle(d.1349),HenrySuso,andDionysiustheCarthusian(d.1471).49Itisalso noteworthythatmanyofthepreacherswhowerecentralinelaboratingeucharisticpietypreachedmostoftentowomen(forexample,GuiardofLaon[d.1248]and JohnTauler).50Moreover,manyoftheearliesttextsrecommendingfrequentcommunionweredirectedtowomen,although,ingeneral,littletheologicalinjunctionwas writtenforthem.Intheelev


enthcentury,JohnofFcamp,PeterDamian,andPopeGregoryVIIallrecommendedtowomeneucharisticdevotionandfrequentreception.51 Iconographicevidencealsosuggeststhatmedievalpeopleofbothsexesassociatedfoodandfastingwithwomen.Inparticular,theeucharistwasassociatedwith femalesaints.ThecommunionoftheVirgin,ofMaryMagdalen,andofMarytheEgyptianwasafairlycommonthemeinpainting.52Thesaintsmostfrequently depictedoneucharistictabernaclesweretheVirgin,theMagdalen,Christopher,andlittleSaintBarbara,asshewasknownfromtheGoldenLegend.53Dumoutet commentsthatBarbarawasprobablythesaintmostfrequentlyassociatedwiththeeucharistiniconography.(Seeplate7foraretablewithsaintsBarbaraand Catherine.)PopularwisdomheldthatBarbara'sdevoteeswouldnotdiewithoutachancetoreceivethesacramentattheend.54MaryMagdalenwasthesaintmost closelylinkedwithfasting,owingtotheversionofherlegendthatcirculatedintheMiddleAgesandattributedtoherafastofmanyyearsinthedesertnear Marseilles.55AsthecultofthehostgrewinthelaterMiddleAges,tabernaclescametoassociatetheconsecrationwiththeIncarnation,andthereforewiththeVirgin Mary.TheCisterciansgenerallystressedtheassociationofMarywiththesacrament,andatCteauxthepyxwasheldbyanimageoftheVirgin.56Theangel'swords ofsalutationtoMaryweresometimesreproducedontabernacles.57Inhisexplanationofthemass(12851291),WilliamDurandussaidthatthepyxortabernacleor reliquaryinwhichthehostiskeptsignifiesMary'sbody.58ThereisevenanextanttabernaclethatexplicitlyidentifiesthecontainerwithMary.(Itissurmountedby Anne,Mary'smother,andthussuggeststhatitisMaryherself.)59Asretablesdeveloped,theyalsotendedtolinkthemomentofconsecration(sometimesdepictedas theMysticalMillorthebabyChristinthechalice)withtheAnnunciationorsomeotherscenesuggestingtheIncarnationorthereceptionofChristforexample,the Virgincapturingtheunicorn,meetingwithhercousinElizabeth,ornursingtheChristchild(seefrontispieceandplates1,6,and7).60Depictionsoftheiconographic motifsoftheEucharisticManofSorrowsorChristintheWinepress(seeplates1,5,25,26,and30)oftenincludenunsorotherfemalefigures(MaryorCaritas),not onlyasrecipientsoffoodbutalsoasprovidersorcelebrants.61 Quantitativepatterns,therefore,suggestthatfoodpracticesweremorecentraltofemalespiritualitythantomaleinthelaterMiddleAges.Quantitativeevidenceis, however,theleastreliabletypeofevidenceon


thismatter.Thisissonotonlybecausethetotalnumberofrecordedeucharisticmiracles,exempla,saints'lives,causesforcanonization,retablesandpyxes,and treatisesonasceticismissometimestoosmallforpercentagestobetrustworthyindices.Itisalsobecausethestoriesthemselvesaremisleading.Tosaythisisnotto raisethequestionofwhetherthemiraclesreportedinthesewritings"reallyhappened."Mypointhereismerelythatthenumerouspassingreferencestoeucharistic devotionandfoodasceticisminsaints'vitaeandothersourcesmustbeviewedwithskepticism,because,iftheyareonlypassingreferences,thereisadistinct possibilitythattheauthorsthemselvesmaynothavemeantthemliterally.Thereisreasontosuspectthatfastingandvisionsweresometimesdescribedorattributed whereneitherwasexperiencedand,conversely,thattheyweresometimesdiscouragedinindividualswhoweredrivenobsessivelytowardthem.Boththesepoints deserveelaboration. AmongearlyChristianwriters,bothJeromeandCassianhadtaughtthatmeatandwineexcitedsexuallustandthatgluttonywasthebasicsourcefromwhichflowed othersins.62AnumberoftheDesertFathers(forexample,Anthony,Hilarion,SimeonStylites,andGerasimus)weresaidtohavepracticedextremefoodasceticism, combinedwithintenseeucharisticpiety.63Manyhagiographersandsaintsfromtheeleventhtothefifteenthcenturyborethismodelinmind.PeterDamiantoldof ItalianhermitswhomimickedPaulandAnthony.64InthevitaofMaryofOignies,JamesofVitryunderlinedthewaysinwhichMaryimitatedtheDesertFathers,and RaymondofCapuamadethesamepointaboutCatherineofSiena.65PeterofVauxclaimedthatColetteofCorbiesurpassedtheFathersinherfoodasceticism.66 HenrySusopostedthesayingsoftheFathersonthewallsofhiscell,andanumberoftheaphorismshechosedealtwithfasting.67 BythehighMiddleAges,fastingandeucharisticdevotionwereexpectedofsaints,especiallyhermitsaintsandwomen.68Those,suchasRichardRolle,whowerenot abletomaintainfastswerecriticizedfortheirfailureandawriterlikeTaulerwhodidnothavethegiftoffoodasceticismfeltitnecessarytoapologizeforthelack.69 Witnessesincanonizationproceedingsregularlytestifiedtothefastingofcandidatesforsanctity,althoughadditionalevidencesometimessuggeststhatthetestimony wasnottrue.Vauchezcites,forexample,witnesseswhodeposedthatPhilipofBourges(d.1261)andThomasofCantilupe(d.1282)practicedabstinence,although aclericofPhilip'sdioceserefusedtobe


lieveinhissanctitybecausehe"drankandatenormally,"andseveralotherwitnessestestifiedthatThomasdidnottrytobebetterthanothermen.70Atvariouspoints inRaymondofCapua'saccountofCatherineofSienahetellsusthat"afterthis"she"atenothing"butlaterinthenarrativethereisclearevidenceofeatingperhaps evenofbingeeating.Forexample,twowitnessesrecountthatsheoncebrokeafastoffiftyninedaysbyeatinglargeamountsoffoodonthefeastoftheAscension.71 AlpasofCudot'shagiographerreportssimultaneouslythatshelivedwithoutcorporealfoodandthatshesuckedmorselsoffoodthreetimesaweektoquellgossip.72 "Eatingnothing"inhagiographicalaccountsoftenmeans''noteatingnormally."73 Hagiographerswerethusexpectedtoincludeatleastpassingreferencestofoodabstentionandeucharisticpietyintheiraccountsofpiouspeople.Thereis,moreover, somereasontothinkthatwomen'svitaeinthelaterMiddleAgeswereevenmorestereotypicalthanmalevitae.Inpartthismaybebecausewomen'sliveswerein factlessdiverseandbecausewomenoftenlearnedpatternsofpietyfromoneanother.74MichaelGoodichhassuggestedthatreligiouswomen,morethantheirmale counterparts,tendedtobeassociatedingroupsandtocomefromsociallyandgeographicallyhomogeneousbackgrounds.Inthethirteenthcentury,forexample, severalconventsintheLowCountries(Aywires,Ramey,andSalzinnesinNamur),themonasteryofHelftainSaxony,andClare'sconventatSanDamianoeach containedagroupoflearnedandmysticalwomen.Indeed,inthethirteenthandfourteenthcenturiestheisolatedwomanecstaticwasrareusuallythesourcesshowus severalwomeninabeguinage,convent,orhospital,orinagroupsurroundingaparticularlysaintlytertiaryorrecluselearningmysticalpracticestogetherand(albeit veryhesitantly)sharingtheirvisions.SimoneRoisinhaspointedoutthatinthisperiod,thereputationsoffemalemysticshadmoreinfluenceoutsidetheircloistersthan didthereputationsofmalemysticstheirvitaewerefrequentlyreadinmaleaswellasfemalehouses.Thuswomen'svitaeandtheirdailylivesborrowedpatternsfrom eachother.Bythelatethirteenthandfourteenthcenturies,anumberofcollectivebiographieswrittenintheRhinelandthesocalledNonnenbchergivedozensof vignettesofecstatic,visionary,orpiouswomenwhobeararemarkableresemblancetooneanother.Sostandardizedhadtheexpectationsbecomethatinthe fourteenthcenturytheauthorofoneofthesebooks,ChristinaEbner,commentedthatshewaspuzzledby


thepresenceatherhouse,Engelthal,ofanunwhodidnothavevisionsandecstasies.75Bythelatefourteenthandfifteenthcenturies,whenholywomenhadbecome moreisolatedfromeachotherandwereincreasinglydominatedbytheirconfessors,whoweremoreandmorefrequentlytheirbiographers,aprototypicalfemalevita (forexample,thatofCatherineofSiena)wasoftenthemodelaccordingtowhichbiographerswroteandwomenlived.76 Toholypeoplethemselves,fasting,meditation,andeucharisticdevotionwereoftenmerelystepstowardGod,partofthepreparationforcontemplation.Totheir adherents,however,abstinenceortrancesweresignsandsourcesofsupernaturalpower.Thuswesometimesfindthatthefurtheranaccountofasaintisfromthesaint herself,themoreherfoodasceticismorparamysticalphenomenaareemphasized.Forexample,thebiographerofthepeasantsaintAlpas,whosupposedlylivedfor fortyyearsontheeucharistalone,devotesmuchattentiontothesaint'svisionsandspiritualteaching,whereasthecontemporarychroniclersandcollectorsofexempla whopickedupherstoryfocusedalmostexclusivelyonthemiraculousnoneating,includingclinicaldetailsaboutherfailuretoexcreteandtheemptinessofher intestines.77InthesecondbookoftheHeraldofDivineLove,GertrudetheGreatstrainedtoexpressanultimatelyinexpressibleunion,moreorlessignoringthe paramysticalphenomenathatdominatetheotherfourbooks,whichshedidnotwrite.78SimoneRoisinhasfoundthatingeneral,thirteenthcenturysaints'vitaewritten forthelaitycontainmoremiraculouselements,whereasthosecomposedforthecloisteredstressinnerspiritualdevelopmentandmysticalunion.79Cullingreferencesto fastsandeucharistfrombiographiesofholypeoplethustellsusmoreaboutthestereotypesofholinessheldbydifferentaudiencesthanabouttheexactdistributionof asceticorpiouspractices. Ifadherentsencouragedfeatsandmiraclesofabstinence,churchauthoritiesontheotherhandwereoftensuspicious,especiallyoftheabstinenceandpietyofwomen. AsIexplainedinchapter2,thetwelfthandthirteenthcenturiessawthecuriousconjunctionofanewwaveofextremeasceticpracticeswithrepeatedexhortationsto moderation.SpiritualwriterssuchasBernardofClairvauxstressedinnerratherthanoutwardresponse,whiletheologianssuchasPetertheChanterandAquinasurged commonsenseand"rationality."Thesecallsforreasonablenessandinterioritywereclearlyinpartaresponsetosuchalarming


austeritiesaswearingironplates,mutilatingone'sfleshandrubbingliceintothewounds,orevenjumpingintoovensorhangingoneself.80Buttheausteritieswerein partaresponsetotheinjunctionstomoderation.Insuchanenvironment,women'sasceticismoftencameinforparticularcriticism. ThesuspicionofasceticpracticesorofmarvelsthatwefindinmedievaltextssometimesmerelyreflectswhatRichardKieckheferhascalledthe"imitation wonderment"toposinsaints'vitae.81Authorswerefondofexhortingreaderstoadmire(wonderat)ratherthantoemulate(imitate)saintlyasceticism,ortoimitatethe virtuesrevealedinthedeedsofthesaintsbecausethedeedsthemselveswerebeyondthelimitedabilitiesofordinaryfolk.ThusJamesofVitryurgedreadersnotto copybut,rather,toveneratethesaintlywomenwhosestorieshetold.82ThenunwhocompiledGertrudetheGreat'svisionsreportedthatChristhimselfrefused Gertrude'sprayerthatasisterbegivenwonderworkingpowersitwaspreferable,heexplained,thatthepiouslearnfromthespiritualteachingofthosewhohad "tastedthekingdom"inmysticalunionratherthanthattheybeenticedandoverwhelmedbysignsandmiracles.83 Buthostilitytowardwomen'sasceticpracticesoftenwentbeyondtheadviceofpreachersorhagiographersthatthefaithfulshouldadmireratherthanimitate.Abelard inthetwelfthcenturyandHenrySusointhefourteenthwarnedtheirbelovedspiritualdaughtersthatsevereasceticismwasunwiseforthe"weakersex."84Susowrote toElsbetStagel:
Deardaughter...discontinuetheseexcessiveausteritieswhichareunsuitabletoyoursexandunnecessaryforyourdisposition....ThegoodJesusdidnotsay,"Takeupmy cross,"but"Leteveryman[mensch]takeuphiscross."Consequentlyyoushouldaim,notatimitatingtheausteritiesoftheancientfathersorofyourspiritualfather,butat crucifyingyourbadhabitswithoutdetrimenttoyourhealth.85

AndFrancisofAssisiintervenedtogetClaretomodifyherfasts.86Thirteenthandfourteenthcenturytheologianssometimesscoffedatwomen'seucharisticvisions andcurtailedtheiraccesstotheeucharist.AlberttheGreat,forexample,opposeddailycommunionforwomenbecauseoftheir"levity"andcommentedthatnuns' visionsofsucklingJesuswere"silly,"althoughhedefendedthemagainstthedangerouschargeofheresy.87DavidofAugsburgsuggestedthatsomefemalevisions were


merelyindulgenceoferotic"ticklings."88Itistruethatbytheearlyfourteenthcenturycertainmysticalresponsesweredangerousformenaswellasforwomenand thatmenfrequentlyurgedorforcedmentomodifytheirpractices.89Butthirteenthandfourteenthcenturyliteratureofspiritualcounselcontainsaspecificandgrowing suspicionoffemaleasceticismandfemaleecstasiesthatreflectsageneralsuspicionoffemalecharacter.Indeed,WeinsteinandBellsuggest,onthebasisoftheirsurvey oflatemedievalvitae,thatfemalesaintsweredepictedasthemorallyweakersexgenerallyandthathagiographerstendedtoattributethesinsorlapsesofwomento innerfaults,whereasmalelapseswereapttobeattributedto"perniciousoutsideinfluences"(including,ofcourse,women).90 Womensometimesinternalizedsuchsuspicionoftheirpietyorevidencedadeepambivalenceabouttheirownyearningstowardsupernaturalpowerorextraordinary penitentialpractices.ClareofAssisi,herselfapractitionerofextremefooddeprivation,encouragedAgnesofPraguetomildnessandprudenceinfasting.91Angelaof Folignocalledtheideathatshegiveupeatinga"temptation."92BeatriceofNazarethandColumbaofRietifearedthattheireucharisticdevotionandasceticismwere inspiredbythedevil.93LutgardofAywireswasrequiredbyherownabbesstoomitfrequentcommunion,andCatherineofSiena'sfellowtertiariesatonepointurged thatshebedeprivedofreceptionandejectedfromthechurchbecauseofherexuberantecstasies.94MargaretofCortona,thoughrepeatedlyurgedbyChristhimself todailycommunion,wentthroughagoniesofuncertaintythatledherrepeatedlytoabstain.95GertrudetheGreatworriedaboutthedangersofprivaterevelationifshe introducednewprayersontheauthorityofvisionsalone,shereasoned,thenthecommunitywouldhavenoprotectionagainstfalsesisterswhoclaimedsimilar inspiration.96 Medievalpeoplewere,moreover,acutelyattunedtothedangersofconfusingdespair,pride,exhibitionism,orillnesswithpiety.Thebiographersandinquisitorswho investigatedsanctityandprovidedglossesonitstressed,forexample,thatfoodabstinencemustbevoluntary,ameanstoselfabnegation.Taken,alone,itwasnot necessarilygood.Itmightbedisease,depression,ordelusion.CatherineofSienainsistedthatherinabilitytoeatwasaninfirmity,notanasceticpracticeatallina visionsheheardChristcommandhertoreturntothetableandeatwithherfamily.(The"infirmity"hadprogressedsofarthatshewas


unabletodoso.)97EvenCatherine'sbiographer,Raymondwhoemphasizedherfastingpartlybecausehefeltguiltyabouthisownfailuretofast,partlyas propagandafortheObservantreformtowhichhewasdeeplycommittedexhortedhisreadersthattruemeritliesnotinfastsbutincharity.98Awitnessinthe canonizationproceedingsofanextremeascetic,JohntheGood(d.1249),testifiedthatJohnsometimes,inthepresenceofall,"atemorethananyotherbrotherand morequickly,"inordertoprovethathisabstinencewasunderhiscontrol.99ColumbaofRieti,whowascriticizedbothforabstinenceandforfrequentcommunion, defendedherselfbyeatingagrapebeforewitnessestosquelchrumorsthatshelivedonlyontheeucharist.100Thus,justaspopularenthusiasmforfeatsofascetic prowessandtraditionalassumptionsaboutthehermitrolemayhaveledtothewidespreadpresuppositionthatfastingandvisionswentwithholiness,soclerical suspicionofecstasiesandextremeasceticism,particularlyinwomen,mayhaveinducedmanypiouspeopletohideoreventomodifyselfmortificationstowhichthey weredrawn. Tabulatingreferencestopietyinhagiographicalliteraturecan,therefore,bemisleading.Allusionstofastingoreucharisticdevotionwereoftensimplyclichs,and clichscanobscureaswellasrevealdevotionalpractices.Furthermore,asiswellknown,miraclestoldofonesaintwereoftenborrowedandtoldofothers:as GregoryofTourshadsaidcenturiesearlier,thesaintsshareonelifeinGod.101Yetitisdifficulttoavoidtheconclusionthatabstinencefromfoodanddevotiontothe eucharistweremoreimportanttosaintlywomenthantosaintlymen.Indeed,thediscussionabovesuggeststhatmen'sreputationsforabstinenceweremorelikelytobe exaggeratedthanwomen's,whereaswomenweremoreapttodoubttheirasceticpracticesasprideordelusion.Moreover,hagiographicalmaterialsandchronicles frequentlygiveusglimpsesofthemoreordinaryfolkwhosurrounded,admired,anddoubtedthesaints.Theseglimpsessupporttheargumentthatfoodasceticism,like charitablefooddistributionandperformanceoffoodrelatedmiracles,wasparticularlytheroleofwomeninthehighMiddleAges. Thereisnoevidencethatmothersweregenerallymoresupportiveoffuturesaintsthanwerefathers,anditcanbedemonstratedthatdaughters'vocationsmetwith moreparentaloppositionthansons'.102Nonetheless,anumberofsaints'vitaesuggestthatmothersorsurrogatemotherstaughttheirchildrenfastingandeucharistic devotion.AelredofRie


vaulx(d.1167)reportsthatKingDavidofScotland(d.1153)learnedfastingandeucharisticdevotionfromhismother,herselfasaint.103PeterofLuxembourg,one ofthefewmaleswhobrokehishealthwithfasting,hadmodelsofasceticisminbothmotherandfather.ButPeter'sbiographertellsusthathismotherwasmoreactive incharity,providingmealsfortheneedythreetimesaweekandsendingdelicaciesfromherowntabletowomeninchildbirth.Peterlaterfollowedtheexampleofboth parents,givingmoneyandfoodtothepoor.104TheauthorofthevitaofColetteofCorbieimpliesasimilarcontrastbetweenmaleandfemalepracticewhenhenotes thatColette'sfathergavemoneytothepoor,especiallyreformedprostitutes,whereashermotherlivedparsimoniously,undertookmanypenances,meditatedevery dayonthelifeofChrist,andwenttoweeklyconfessionandcommunion.105Itappearstohavebeenaclichofhagiographythatpiousfathersgavealmswhilepious mothersgave(andgaveup)food.Moreover,inpraisingthepatiencedisplayedbysaintlygirlstowardunsympatheticmothers,hagiographersoftenrevealthatthegirls werecarryingtoextremesdevoutpracticeslearnedfromotherwomen.WhenlittleDorothyofMontauwishedtopracticetheseverefastingshesawhermother perform,conflictflaredbetweenmotheranddaughter.106JulianaofCornillon,taughtfastingbythereligiouswomanwhowascaringforher,waspunishedwhilea childfortakingtheteachingtoomuchtoheart.107ElizabethofHungarymayhavefoundamodelforherextremefastingandcompulsivefooddistributioninthe behaviorofherfuturemotherinlawSophia,whoraisedher(althoughsubsequentcommentatorssuggestonlythattherewastensionbetweenElizabethandher surrogatemother).108 Othervignettesfromchroniclesandsaints'vitaesuggestthatfoodabstinencefrequentlycharacterizedwomenwhowerenotconsideredsaints.CatherineofSiena's fastingdevelopedinthecourseofconflictwithherparentsaboutherreligiousvocation,butherbiographertellsofanothergirlinthefamilywhoseselfstarvationbegan inresponsetothedissolutebehaviorofheryounghusband.109TheearlyfifteenthcenturyEnglishlaywomanMargeryKempe,uponChrist'sadvice,manipulatedher husbandintoacceptingcontinencebyofferingtogiveupthepublicfastswithwhichshewasembarrassinghimbeforetheneighbors.110 Becausemedievalpeoplelovedmarvels,chroniclersoftenpreservedstoriesofstrangeeatingbehavior.Mostofthesurvivingtalesareaboutwomen.Ninthcentury chroniclesreport,withoutmuchdetail,twocases


oftwelveyearoldgirlswhorefusedtoeatforthreeyears.111Inoneofthesestories,toldbyEinhardandpickedupbyanumberofotherchroniclers,thegirlbegan herfast"firstfrombreadandthenfromallfoodanddrink"afterreceivingEastercommunionfromthepriest.Readersarethentoldsimplythat,afterthreeyears,she "begantoeatagain.112 FarmoreinterestingaretwohealingmiraclesrecountedintheearliestvitaofWalburga(d.779),writtenbyWolfhard,priestofEichsttt,aboutahundredyearsafter herdeath.113ManyfoodrelatedthemesclusteraboutWalburga'slife.ThatsheherselffastedandsometimesremainedinthechurchafterVesperswhiletheother nunstooksupperintherefectoryisoneoftherelativelyfewdetailsweknowaboutherownpiety.114Shewasalsooneofthemostfamousmyroblytes,oroil producingsaints,curingtheafflictedformorethanathousandyearsafterherdeathwithanaromaticfluidthatflowedfromthestoneonwhichherrelicsrestedsome saidfromherbreastbone.115Thesymbolofearsofcornwithwhichsheisassociatediconographicallyseemstohavebeenborrowed,alongwithotherdetails,froman earlierfertilitycult,thatofWalborgorWalpurg,theearthgoddess.116Notsurprisingly,then,twoofWalburga'searlyposthumousmiracleswerecuresofwhatcan quiteaccuratelybecalled"eatingdisorders."WolfhardrecountsthatamannamedIrchinbaldwasindangerofbecomingagluttonuntilhewassuddenlyseizedwith loathingforfood.Hethenwentfortwentysevenweekswithoutbreadormeat,takingonlyafewvegetablesoralittleeggyolk.Whenhehadbecomeemaciatedand extremelyill,heheardavoicetellinghimtogotoMonheim(towhichsomeofWalburga'srelicshadbeentranslated),topraytoWalburgaandtodrinkfromthe consecratedchalicethatwouldbeofferedtohimbythreenunsstandingnearthealtar.Assoonashedrank,hefelthungryforbread.Asimilarstoryistoldofaservant girlnamedFriderade.But,inhercase,theselfstarvationwasnotcured.Rather,itwaselaboratedintoamiracle.117 Friderade,sothestorygoes,sufferedfromavoraciousappetitesheateuntilshegrewenormouswithgoutordropsy.WhenshevisitedWalburga'sshrineherswollen feetwerecured,butnotherappetite.ShethenconfessedtoasisterDeithildaandreceivedconsecratedbreadfromthepriest.Afterthisshefeltaloathingforallfood excepttheeucharist.Deithilda,whoworriedabouther,persuadedhertodrinkalittlebeer,butitmerelygushedoutagainfromhermouthandnose.Friderade subsequentlypassedthreeyearswithouteating.Apriestwhoobserved


herforthelocalbishoptestifiedthatsheindeedsurvivedwithoutfood.Thus,inthesetwoninthcenturymiracles,aman'sloathingforfoodwascuredbyasacreddrink administeredbynuns,whereasawoman'sgreedwascuredbysacredbreadadministeredbyapriest.Asthehagiographertellsthestory,Irchinbald'stransitionfrom gluttonytostarvationisnaturalitishisreturntoeatingthatisthemiraculouscure.Incontrast,Friderade'slossofappetiteisthemiracle.Theimplicationisthather subsequentreturntoeatingneedsnoexplanation. Bythetwelfthcenturysuchreportsweremorecommon.Oneofthemostinterestingisfound,likeWalburga'scures,inasaint'slifethathasovertonesoffertilitycult.In thevitaofBridgetofKildare(,foodisacentraltheme.Bridgetsupposedlyturnedastoneintobreadintimeoffamine.(Butwhentwoofhernunswere discontent,wantingmeat,thebreadturnedintoserpents.)Shegaveawaybutter.Thecowsshemilkedproducedenormousamounts.Sheisassociated iconographicallywithacowandalargebowl.118LawrenceofDurham,writingaversionofherlifesixhundredyearsafterherdeath,foundinthechapteronher babyhoodanopportunityforinsertingacontemporarymarvel.Bridget,henotes,wasallergictocow'smilk.Onceshewasweanedshecouldnotkeepmilkdown.But shegrewanyway,asifshewereeating.
Althoughherstomachwasindignantandrejectedallfood...,nonethelessherbodygrewandwasbeautiful,asifshehadfood.AndletnoonebesurprisedbecauseIknowof suchathingfromourowntime.TherewasavirginfromthesouthofEnglandwholivedinherfather'shousefortwentyyearswithoutacceptinganyfood,withthisexceptionthat everySundayshefedherbodyonthecommunionoftheLord'sbodyandbecausethemorselcouldhardlypassdownherthroatshewasaccustomedtoacceptalittleholywater tomakethiseasier.Andonfeastdayssheonlytastedthewaterbutdidnotswallow,andthroughthecourseoftheseyearssheneithertookfoodordrinknordidshehaveany appetiteforfoodanddrink.Andherbodythusdestituteofstrength,shelosttheabilitytogrow,buthermindremainedfirmandhermemberswellcoordinatedandshedidnotlose theabilitytospeak.Andsincethisthing,whichismoreremarkable,isprovedbymorewitnessestoitstruththantherewereinhabitantsintheplacewherethegirllived,weshould believesuchathingallthemoreofSt.Bridget,sinceitisalessermarvel.119


Page91 InthatsameyearinthecityofLeicesteracertainreclusediedwho,forsevenyearsbeforeherdeath,hadnevertastedfoodexceptthatshereceivedthebodyandbloodofthe LordincommuniononSundays.WhenthebishopofLincoln,HughofLincoln,heardofthismiracle,hedidnotbelieveit.Completelyincredulous,hethereforehadherstrictly guardedforfifteendaysbypriestsandclericsuntilitwasfoundthatshereallytooknonutrimentforherbodyinallthattime.Andshealwayshadafacewhiterthanalilybutwith arosytint,asasignofhervirginalpurityandmodesty.120

JamesofVitrycoupledwithhisaccountofAlpasareferencetoareclusefromNormandywho"formanyyears""ateanddranknothing,norfromhermouthnorfrom anyoftheothernaturalorgansdidanythinggoout."121CaesariusofHeisterbachalsotoldthestoryofAlpasalongsideanotheraccount,thisoneofawomanwho livedonSundaycommunionalone"withoutbodilyhunger"andpassedthetestofidentifyinganunconsecratedhost.122Alittlelater,RogerBacondescribedawoman ofthedioceseofNorwichwho

didnoteatfortwentyyearsandshewasfatandofgoodstature,emittingnoexcretionfromherbody,asthebishopprovedbycarefulexamination.Norwasthismiraculousbut, rather,aworkofnature,forsomebalance[constellatio]wasatthattimeabletoreducetoastateofalmostcompleteequilibriumtheelementsthatwerebeforethatinherbodyand becausetheirmixturewasfromtheirpropernaturesuitabletoabalancenotfoundinothermakeups,theiralterationhappenedinherbodyasitdoesnotinothers.123

Bythefifteenthcenturysuchcasesservedtheologicalpurposesandwerecarefullytestedbytheauthorities,whooccasionallyunmaskedfrauds.ThomasNetter(d. 1430),inatreatiseagainsttheLollards,toldthestoryofJoantheMeatlessasproofofthedoctrineoftherealpresence:
IfEliascouldliveonalittlebreadandwaterbroughtbyangelsforfortydays,howmuchmorecanpeopleliveonthefleshandbloodofChrist?...Butifanyonedoesnotbelieve this,Iwillciteacasefromourowntimeandexperience.InthenorthernpartofEngland,calledNorfolk,whichisveryrichinbothtemporalandspiritualthings,thererecentlylived adevoutChristiangirlcalledinthevulgartongueJoantheMeatless(thatis,"withoutfood"),becauseitwasproventhatshehadnottasted

Page92 foodordrinkforfifteenyears,butonlyfedwiththegreatestjoyeverySundayonthesacramentoftheLord'sbody.Andwhatisevenmoreremarkable,shecoulddistinguisha consecratedhostfromunconsecratedonesamongathousandbreadsallalikeandcouldnotbedeceivedaboutthetruthofthesacrament.Andwhatmanythoughtwasmore wonderfulstill,shedidthisnotsomuchbydivineinspirationbutbyacertainskillofhersenses,sinceshehadsuchahorrorofallbodilyfoodthatshecouldnottolerateitstaste orsmellandturnedfromitevenatadistance.124

CanonizationinquiriesforColetteofCorbie(d.1447)uncoverednotonlythesaint'sown"miraculous"fastsbutalsostoriesofColetteherselfrejectingafraudulent fasterandcuring,withwaterfromherrelics,anunwhohadnotbeenabletoeatforthirteenyears.125Thereareatleastsevencasesof"fastinggirls"inthesixteenth centurytheirselfstarvationisreportedbothasevidenceforcanonizationandasascientificcuriosity.126Alsofromthesixteenthcenturycomesthefirstcaseinwhich theclaimsofafasterareunmasked,notasfraudbutasdisease.JohnWeyer(d.1588),wellknownforhisskepticismaboutwitchcraft,discoveredthatatenyearold crippledgirl,BarbaraKremers,whosemotherclaimedthatsheneitheratenorexcretedandwhosemarvelousabstinencehadbeencertifiedauthenticbyherlocal towncouncil,wasbeingsecretlyfedbyhertwelveyearoldsister.AfterpersuadingBarbaratoeatnormallyandtogiveuphercrutches,Weyersentherhomeunder ducalprotection.Theoutrageddukeinsisted,however,thatallcertificatesandtestimonialsaboutthemarvelousfastingbeburnedinthemarketplace,andhe reprimandedthetowncouncil.127 BetweentheearlyMiddleAgesandthefifteenthcentury,whentheilliterateSwisshermitNicholasofFle(d.1487)becamefamousforlivingtwentyyearsonthe eucharistalone,suchstoriesarenottoldofmen.128PeterofLuxembourgandJamesOldo(d.1404),whobeganextremefasts,resumedeatingatthecommandof theirsuperiors.129ThemaleexamplesclosesttothesefemalecasesofextendedstarvationarethecaseofayoungmonkintwelfthcenturyEngland,whowentfor morethanayear"eatingverylittle,"130therathersimilaraccountofAelredofRievaulx,131andapassingchroniclereferencetoFacioofCremona(d.1272),who supposedlyneitheratenordrankforseventytwodays,duringwhichtimehetwicereceivedcommunion.132Thereis,atSt.Mary'sinBurySt.Edmonds,theeffigy andtombofoneJohnBaret(d.1463),aboutwhomtraditionholdsthathediedfromimitatingJesus'


fastoffortydaysandsimilartraditionshavebeenattachedtoeffigiesinotherchurches.Butthesestoriesmayhavearisensimplyfromtheemaciatedappearanceofthe carvedcorpse.133 Animpressivearrayofexamplescanthusbecollectedtoshowthatfastingandeucharisticmiraclesweremoreprominentinwomen'sreligiositythaninmen's.Butmy purposeinthisbookisnotsimplytocountcasesofmaleandfemalebehavior.Itis,rather,todemonstratethatfoodwasanobsessiveandoverpoweringconcernin thelivesandwritingsofreligiouswomenbetweenthetwelfthandthefifteenthcentury.Itwaswomen,notmen,whowerereputedtoliveforyearsontheeucharist aloneorwhoseabstinencewentsofarthatnormalbodilyfunctionssuchasexcretionceased.Itwaswomenwhoinstoryafterstorydrankpusorfilthfromthesick theycaredfor,whileabstainingfromordinaryfood.Moreover,itwaswomenwhodevelopedeucharisticpiety,includingthecultoftheSacredHeartandthefeastof CorpusChristiwomenwhoinvisionaftervisionsawChristinthehostorchalicewomenwhogavethefoodfromtheirtablestothesickorthepoor,frequentlyin defianceofhusbandorfamilywomenwhosemiraclesinlifemultipliedfoodforothersandwhosebodiesafterdeathexudedhealingliquid.Finally,itwaswomenwho intheirwritingsrepeatedlyusedbread,blood,hunger,andeatingastheirdominantimagesforunionwithGodandneighborlanguagewhichappearsinmalewriters butisnevercentraltotheirpiety. Quantitativepatternsarethusnomorethanthebeginningofmyinquiry.Indeed,suchpatternsobscureevenwhiletheyelucidate.For,inordertobecounted, phenomenamustbecutapartfromeachotherandputintocountablecategories.Whatisreallyimportanttoanunderstandingofwomen'spiety,however,isnotthe numberoffoodmiraclesorfastsorthefrequencyofeucharisticecstasies,butthewayinwhichfoodasapolysemoussymbolofsufferingandfertilityliesatthecenter ofhowwomenthoughtandhowtheysurvived.Intherestofthisbook,therefore,Ishallbeconcernedwithparticularlivesandparticulartexts,inalltheircomplexityof livedandliterarymetaphor.Ishalltrytodemonstrate,byexploringwomen'sstories,thatfoodwasanoverwhelmingconcern,thatdenialanddevotionfastand feastwereconnectedinbasicandcomplexways,andthatthecausesofwomen'spietyliedeepwithinthestructuresofmedievalassumptionsandmedievalsociety. Inordertodemonstratethis,Ishallfirstbrieflyexaminethemalepietytowhichwomen'sreligiositymustbecompared.


Men'sLivesandWritings: AComparison Theclaimthatfoodandfoodimageryarenotcentraltomalespiritualitymayseemodd,for,aschapter2makesclear,theoriesoffastandfeastintheearlychurch wereformulatedbymen,andmedievaltraditionsoffoodasceticismwentbacktotheDesertFathersofantiquity.AlthoughmedievalwomensometimestookMary MagdalenasamodeloffastingorpenitenceandCatherineofAlexandriaasamodelofwisdomorofecstaticunion,confessorsandhagiographersusuallyclaimedthat bothpiousmenandpiouswomenimitatedmalemodels.134Allstoriesfromtheearlychurchofindividualswhosurvivedontheeucharistaloneweretoldofmen.It wasClementofAlexandriawhointhesecondcenturyelaboratedtheexplicitlyeucharisticimageofChristasamotherfeedingthesoulfromhisbreasts,135andthe directsourceinthelaterMiddleAgesforsuchimagerywasthewritingsofAnselm(d.1109)andofseveraltwelfthcenturyCistercianmonks,amongthemBernard, GuerricofIgny,andWilliamofSt.Thierry.136AsJohnTaulerimplies(inthepassagequotedastheepigraphtotheIntroductionabove),thelocusclassicusof metaphorsoftastinganddevouringwasBernardofClairvaux'scommentaryontheSongofSongs,whichdescribesformationintheimageofChristas''being swallowedanddigestedbyhim."137Whatcanitmean,therefore,toclaimthatfoodsymbolismwasmoreimportanttowomenthantomen? Clearlysuchaclaimdoesnotmeanthatfoodmetaphorsandfoodpracticesweretheexclusivepreserveofpiouswomen.AsVauchezandKieckheferamply demonstrate,malesaintspracticedbothfoodasceticismandpassionateeucharisticdevotion.DodoofHascha(d.1231),LawrenceofSubiaco(d.1243),Johnthe GoodofMantua(d.1249),thepioushermitwhobecamePopeCelestineV(d.1296),PeterofLuxembourg,andJamesOldoareexamplesofdevoutmenknownfor theirfoodausterities.138But,asVauchezhaspointedout,fastsandecstasiesarecharacteristiconlyoftheminorityofmalesaintswhoarelay.Andevenmaleswho belongedtothiscurrentoflay,ofteneremitical,pietybarelyapproachedeithertheeucharisticfrenzyortheselfstarvationoftheirfemalecontemporaries.Menwho usedelaboratefoodmetaphorsintheireucharistictreatisesandsermonsdidnotcarrythoseimagesoverintotheirotherspiritualwritingascentralmetaphorsfor encounterwith


God.Itisinwomen'svitae,notmen's,thateating/noteatingsometimesbecomesboththeleitmotivtyingthestorytogetherandtheunderlyingpsychologicaltheme.In ordertounderstandthis,wemustexplorethevitaeandwritingsofafewlatemedievalmenwhodidfast,displayunusualeucharisticfervor,ordevelopfood metaphorsinacontextofaffectivespirituality.Suchanexplorationshowsverypreciselythatfoodis,atbest,atheme,notthetheme,inmalelivesandsensibilities.For example,FrancisofAssisi,themostinfluentialmalesaintofthelaterMiddleAges,insistedonretaininglaystatusanddisplayedanintenselyaffectivepietybutneither feastnorfastwasacentralconcerninhisdevotion.DespiteFrancis'srepeateddescriptionsofhimselfandofthe"goodfriar"aswomanandmother,139hedidnotin factdisplaytheconcernwithfoodmetaphorssomarkedinthepietyofthirteenthcenturywomen. TheextensivematerialthatsurvivesonFrancisandhisearlyfollowershasgivenrisetoscholarlycontroversiesaboutthebasiccharacteristicsofhisreligiosity.Itis clear,however,thatfastingandabstinencewerenotcentralaspectsofFrancis'sconcernfor"purityofheart."Hedid,ofcourse,practiceharshfoodasceticismhimself, butneitherhisownwritings,thestoriesofthethreecompanions,thevitaeandmiraclecollectionsbyThomasofCelano,norBonaventure'svitaediscussitinmuch detail.140AlltheseaccountsagreethatFrancisrarelyatecookedfoodand,whenhedid,hemixeditwithwaterorashestospoilitsflavor141(apracticelaterimitated byotherFranciscanssuchasFrancisofFabriano[d.1322]).142Hedrankwineonlywhenhewasillandeventooklittlewater.Passingreferencesinthevitae indicatethathesometimesfastedtothepointofweaknessandprobablypermanentlydamagedhishealthbysodoing.143ThomasofCelano,intheFirstLife, describesFrancispretendingtoeatbutdroppingthefoodintohislap.144ButneitherFrancis'sownwritingsnortheearlybiographies,whichpresenthimasan exampleforteachingothers,suggestthatfooddenialwasanimportantpracticetohim.HisRuleof1223saysmerelythatthebrothersaretofastonFridaysandin AdventandLentbut"arenotboundtofastatothertimes."TheymayfastafterEpiphanyiftheywish.But"incaseofmanifestnecessity[they]arenotboundto corporalfast."145TheonlyreferencestofoodpracticesinhisearliestRule(1221)areanadmonitiontothesicknottofeelhesitantaboutseekingmedicines,an injunctionto


thebrotherswhopracticegreaterrigornottodespisethosewhopracticeless,andthereminderthat"incaseofnecessity,thefriars,nomatterwheretheyare,caneat ordinaryfood."146 ThemessageinFrancis'sownwritingsisclearandfarclosertothetoneoftheNewTestamentthantothatoftheDesertFathersofthethirdandfourthcenturies. Francis'sdeepestconcerniswithdetachment,whichhecallspurityofheart,andwithteachingbytheexampleofone'sownlife.Thegoodfriarmustbetrulypoor,as thenewurbanpoorarepoorhemusthavenosecurity,noguaranteeforthemorrow.Thepatternofhislifemustcomfortratherthanscandalizeitmustdisplay Christ'sloveinthemidstoftheneedy.ThusFrancis'stwoRulesquoteRomans14:3,"Letnothimthateatethdespisehimthateatethnotandhethateatethnot,lethim notjudgehimthateateth,"andLuke10:8,"Eatwhatissetbeforeyou."147ThesefragmentaryRulesargueagainstcarryingasceticismtoextremes,lestthebodybe harmed,lesthypocrisybeencouraged,lestthosewhocannotbeargreatasceticismbemadetofeelinferiorbythosewhocan.Likethetwelfthcenturypreachersof moderation,Francishimselflinksactualandmetaphoricalfastinginhislettertothefaithfulhemerelyenjoinsthat"wearealsoboundtofastandavoidviceandsin, takingcarenottogivewaytoexcessinfoodanddrink."148Indeed,sinceFrancis'scentralconcernisforapovertythatmeanscompletevulnerabilitytocircumstance, itisnotsurprisingthatcorporateorevenindividualisticfoodasceticismshouldhavelittleimportancetohim.Periodicrenunciationofcertainfoodsormealsdepends, afterall,upontheregularityofthesustenanceandcommensalitybeingrenounced.InatonethatechoesPaulandJesus,Francisdenigratesnoteatingasamarkof religiouscommitment,substitutinginsteadavulnerabilitytowantandhungerthatjoinstheonewhobegstothelowliestoftheworld. InFrancis'sownwords,therefore,foodisnotthechiefsymbolfortheworldonerenounces,norishungeranimageofdetachment.Rather,theirregularitywithwhich foodcomestoabeggarisoneofthemarksofthe"poverty"and"nakedness"thatareFrancis'smajorimages.ThusitisnotsurprisingthatdespiteFrancis'spersonal abstinence,mostoftheearlystoriesabouthisfoodpracticesdealwithhiseating.ThematerialthatprobablyderivesfromBrotherLeoandwasreworkedinThomas ofCelano'sandBonaventure'svitaeofFrancisnotonlystatesexplicitlythatFranciswas"prudent"withhisfriarsyet"austere"himself,149italso


instructsbyhisexample,first,thatwemustneveruseourasceticismtocensorothersand,second,thatwemustalwayshavefaiththatGodwillfeedusinourneed. InonestoryabrotherwakesinthenightveryhungryandFranciseatswithhiminordertoshowthat"weareboundtobewareofsuperfluityoffood...butwemust shuntoogreatabstinenceevenmore."150InanotherstoryFranciseatsgrapesinordertoinduceasickbrothertofollowhisexample.151Inyetanotherstorythe friarslayaverypoortableforavisitingdoctorbutinresponsetoFrancis'strustinGodawealthyladyarriveswithafeastfortheassembledcompany.152When Francishimselfissick,wearetold,fish,parsley,wine,andevenmarzipanmiraculouslyappear.153Storiesoffoodsentforthehungrybrothersrecordnotexactly feedingmiraclesperformedbyFrancisbut,rather,occasionsonwhichhebothpredictsthefutureandoffershisconfidenceinGodasamodelforothers. SometimesFrancis'seatingispresentedprimarilyasawarningagainsthypocrisyagainwithanalmostNewTestamentcondemnationofprideinreligiousobservance. OntwooccasionswhenFranciswasveryill,forexample,heatethemeatorlardheneededtosurvive.Oncerecovered,heconfessedtheeatinginextravagantself denigrationincludingstrippinghimselfnakedandaskingabrothertoleadhimbyaropebeforethepeople.Suchdisplayswereintended,apparently,togivean examplebothofhumilityandoftakingfoodinnecessity.154ThomasofCelanosaysthatFrancischaracterizedhypocritesaspeoplewho"sellthepallorofthefaceof fastingforruinouspraises,thattheymayappeartobespiritualmen,"andthatheexplicitlyenjoinedsuperiorstotakeextrafoodiftheyneededitinpublic,notin private,sothatotherswouldnotbe"ashamed"toprovidefortheirbodies.155Thomaseventellstheoddstoryofafriarwhoworriedabouteatingmeatwhen ChristmasfellonaFriday.ButFrancisurgedthebrothersnotonlytoeatbuteventosmearthewallswithmeatsothattheverybuildingwouldfeastonthedayofthe Lord'sbirth.156 InBonaventure'slatervitae,whichglossthematerialsoastominimizemanyofFrancis'sausterities,wefindsimilarstoriesofFranciseatinginordertoencourage otherstodoso.ThemostextremeasceticismintheLegendamaioristhatofsomeoneFranciscures,notofFrancishimself.157Moreover,foodisnot,in Bonaventure'saccount,afrequentorapowerfulsymbol.WhenFrancishasavisionofhimselffeedinghis


brotherswithcrumbs,forexample,thefoodisanimageofsomethingunrelatedtonurtureorsustenanceitstandsfortheRule.Thepointofthestory,asBonaventure glossesit,isthewickednessofthosewhorefusetoaccepttheRulewithreverence.WhenBonaventurerecountsanoccasiononwhichfoodcameasmiraculousalms, hispointisnottocommendorcommentuponthefriars'fastingbut,rather,toemphasizepovertyandmendicancy.158 ItthusseemsclearthatdespiteFrancis'sownabstinence,povertywasafarmorebasicvaluetohimthanfasting,andnakedness/clothingamoreimportantmetaphor. M.D.Lambert,MichelMollat,LesterLittle,andothershaveelaboratedthecomplexwaysinwhichvoluntarypovertythatis,renunciationofownershipandmoney, andofthepowermoneybringswerecentralpracticesandimagesinthespiritualityofFrancisandhisfollowers.159AsThomasofCelanoandBonaventure describedhim,FrancisnotonlymarriedLadyPoverty,hewasLadyPoverty.160Andforthedenudingofpoverty,nakednesswasakeymetaphor.Atthecrucial turningpointsinFrancis'slife,hecastoffhisgarmentsasaliteralsignofrenunciationoftheworld.Whenherejectedhisearthlyfather,forexample,hetookoffhis clothesandhisshoesandthrewawayhismoney.Whenhepreparedfordeath,heagainremovedhisclothesinordertomeethisheavenlyfathernaked.161TheLeo materialincludesatleasttwootherstoriesofFrancisstrippinghimselfasasignofhumilityorpenitence.162ThomasofCelanointheSecondLifereportsthatFrancis metabrotherwhobeggedhimforhistunic(presumablyasarelic)Francisgaveitawayatonce,leavinghimselfnakedinthecold.163Thomas'sFirstLifeofFrancis liststhirtysixhealingmiracles,onlyoneofwhichisperformedwithfood164buttheSecondLifelistsatleastsevenoccasionsonwhichFrancisgavehisclothestothe poor.165WhenFrancisservedandkissedlepers,hiscrucialactwasgivingthemalmsandclothingthemwithhisowngarments,notdrinkingthepusoftheirsores(a favoriteasceticismoflaterfemaletertiaries).166IntheLegendamaior,Bonaventuresuggeststhecentralityofdenudingasanimageofdetachmentandgenerosity whenhesays:
Francisnowdevelopedaspiritofpoverty....Hehadneverbeenabletostandthesightoflepers...butnowinordertoarriveatperfectselfcontemptheservedthem devotedly...becausetheprophetIsaiastellsusthatChristcrucifiedwasregardedasaleperanddespised.Hevisited

Page99 theirhousesfrequentlyanddistributedalmsamongthemgenerously,kissingtheirhandsandlipswithdeepcompassion.Whenhewasapproachedbybeggars,hewasnot contentmerelytogivewhathehadhewantedtogivehiswholeselftothem.Attimeshetookoffhisclothesandgavethemaway,orrippedandtorepiecesfromthem,ifhehad nothingelseathand.167

Althoughitmaybeimpossible,asmanyhaveargued,toseparateFrancishimselffromthecolorfulstoriesthatcirculatedsoearlyabouthim,whatmattersformy purposesisthattheearlyfriarsdidnotseethemanwhocalledhimself"mother"asonewhofedthemwithhislife'sbloodorclosedhisbodyoffmiraculouslytofood. Rather,theysawhimasanimageofthepoorandnakedChristassomeoneeverreadytogivehisraggedtunictoanother,beggingfrommealtomeal,trustinginthe providenceofGod. Nor,forallhisdeepreverenceforthesacrament,washolyfeastcentraltoFrancis'sspirituality.HishagiographersassureusthathereveredtheBodyoftheLord, communicated"frequently,"andwantedtohearmassonceaday.168Inhisownwordsthereechoesadeepawebothbeforetheeucharistandbeforepriestswhocan holdGodintheirhands.Buttheeucharistwas,toFrancisastomanyaround1200,morearevelationthanameal.Hespoke,withprofoundreverence,notof receivingbutof"seeing"thehost.HewasawestruckbeforeGod"comedown"intoaVirgin,"hidingundertheformofalittlebread."169Hesenthisfriarsfromchurch tochurchwithpyxesto''house"Christ(i.e.,theconsecratedwafer)reverently,justashesentthemtopickupandcareforallbooksinwhichthenameofJesusmight beinscribedortorepairthecrumblingstonesofanychapelsinwhichGodwasworshiped.170Althoughhiseucharisticfervor(whichhemayinparthavecopiedfrom thedevotionofcontemporarywomenintheLowCountries)171wassincereandinfluencedlaterFranciscans,heseemstohavereveredthehost,ratherasherevered Bibles,asarelicofChrist.HisconcerntoseeGodatthemomentofincarnationinthehandsofpriestsdidnotemphasizethequalityoftheeucharistasfood,linkfeast andfastaspractices,orflowerintometaphorsofeating,drinking,intoxication,orassimilationaswaysofspeakingaboutthesoul'sunionwithGod. Foodwas,however,centraltoClareofAssisi,thewomanwhochosetofollowFrancisinasceticismandwhofoughtunsuccessfullymostofherlifefortherightto imitatehispoverty.Wehave,ofcourse,farless


materialaboutClare,andherrangeofactivitywasfarmoreconstrainedthanFrancis's.172But,incontrasttotheevidenceconcerningFrancis,theearlyevidence aboutClareThomasofCelano'svita,theprocessforcanonization,thebullofcanonizationitself,andevenThomas'sdescriptionsofherandhersistersinthevitae ofFrancisdoesnottreatherfoodasceticismmerelyinpassingoraspartofacatalogueofausterities.Rather,Clare'sfoodpracticesarecentraltotheargument madeforherholiness.BothThomas'svitaandthebullofcanonizationunderlineherdevotiontotheeucharistandherfoodasceticism.Thomaswrote:

DuringtheseLents[i.e.,thefortydayspriortoEasterandtheperiodfromNovember11toChristmas],shetooknofoodwhateveronthreedaysoftheweek,Monday,Wednesday, andFriday.Thusthedaysofhermeagerfareandthedaysofherstrictmortificationfollowedoneupontheotherinsuchwisethatavigilofperfectfastwasendedbyafeastof breadandwater!ItisnotremarkablethatsuchaseveritymaintainedoveralongperiodmadeClaresubjecttoinfirmities,consumedherstrength,andunderminedherbodilyvigor.

ThomassaysthatFrancishimselfandthebishopofAssisifinallyforbadeherpracticeofkeepingthreedaysoftotalfastandforcedhertotakeanounceandahalfof breadofday.173TheaccountthusmakesitclearthatClareunlikeFrancis,whodesiredtobeindifferenttofoodandnevermadeapointofeatingnothingfoundit importanttokeepa"perfectfast,"thatis,tocloseherbodyentirelytofood. Clare'sadvicetohersisterswasharsherthanFrancis's.HerRuledoesrepeatFrancis'sadmonitiontomoderation("intimesofmanifestnecessitysistersshallnotbe boundtocorporalfasting"),174andinalettertoAgnesofPragueshedidrecallthatFrancisurgedhisfollowerstocelebratefeastsbyachangeinfoodandtobe lenientinrecommendingfoodpracticesfortheweakandinfirm.175Nonethelessshealsostatedunequivocally:"Atalltimesthesistersaretofast[i.e.,totakeonlyone mealaday]"176and"wewhoarewellandable[should]alwayseatLentenfood."177WhensheheardthatAgneshadundertakenfoodausteritiessimilartoherown, shefeltcompelledtorecommendsomerelaxation(asFrancishaddonewithher).''Iaskandbegyou,"shewrote,"torefrainwiselyanddiscreetlyfromanyindiscreet andimpossibleausterityintheabstinencewhichIknowyoutohaveadopted."178Buttakentogether,Clare'sandAgnes'spracticesandClare'sownRulesuggestthat food


austeritieshadgreaterprominenceinthedailylivesofearlyFranciscannunsthaninthelivesofthefriars. OtherfoodmotifsareimportantinClare'sstoryaswell.Sheshedtearsbeforetheholyfoodoftheeucharistandapproacheditwithawe.179Sheonceputanenemy toflightwiththehost.180Hericonographicmotifisthemonstrance.Sheisthusassociatedvisuallyaswellasinwrittenevidencewiththeemergingcultofthe consecratedhost.181Furthermore,servingespeciallyfeedingothersisamajorthemeinClare'svita.Asidefromafewmiraculouscures,hermajormiraclesduring herlifetimewerethemultiplicationofbreadononeoccasionandofoilonanother.182Sheservedthesistersattableandcleanedupthefilthofthesickwithout complaint.183Partofherenthusiasmforholypovertyseemstohavestemmedfromthefactthatbeggingbrothersbroughtbackmerecrumbsforthesisters'meals Thomastellsusshewas"almostsorry"whenbeggingproduced"wholeloaves."184Ononeoccasion,whenPopeGregoryIXissuedabullwhoseresultwouldhave beentoprovidelesspreachingtoherconvent,Clareseemstohavethreatenedakindofhungerstrike.InanyeventorsoThomastellsusshedrewananalogy between''foodforthesoul"(i.e.,preaching)andearthlybread:ifthepopeforbadepreacherstocome,shesaid,thesisterswouldrefusetoacceptthemundanebread providedbythebeggingbrothers.185 AfinalfoodmotifintheClarematerialappearsintheprocessforcanonization,wheretwowitnessesrecountalactationmiracle.186Accordingtothefullestofthe reports,ClareoncesawFrancisinavisionandtookhimajugofhotwaterandatowel.Whenshereachedhim,hebaredhisbreastandgavehersuck,andthe substancewas"sweetanddelightful"and"suchpureshininggoldthatshesawherreflectioninit."Itisreasonabletothinkthatthisvisionwasinfluencednotonlybythe extensiveuseofnursingasametaphorforinstructingandcounselingintwelfthcenturyspiritualliteraturebutespeciallybyFrancis'sownnotionofhimselfandanygood friaras"mother"anotionfoundrepeatedlyintheearliestFrancismaterial.187Nonetheless,theappearanceofsuchavisiontoClareratherthantoFrancis'smale followers,togetherwithotherevidenceofClare'semphasisonservingandfeedingotherswhileherselfnoteating,suggeststhatfoodwastoClarewhatclothingand moneyweretoFrancis:abasicsymbolofbothsacrificeandservice. ThisbriefcomparisonofClareandFrancissuggests,farmorevividlythandoanystatistics,thedistinctiveemphasesofmaleandfemalepie


ties.RaisedinthesamesmallItaliancity,tributarytothesamespiritualcurrents,influencedbyeachother,ClareandFrancisexpressedthesamecravingforself abnegationandworlddenial.Buttheyexpresseditindifferentbehaviorsandmetaphors.OnlytoClarewasfoodcrucial.FrancisrenouncedwealthClarerenounced food.Francisrepairedchurches,clothedthepoor,begged,andpreachedinthestreetsofthetownClare,bothmiraculouslyandprosaically,servedandfedhersisters inthecloister.ToFrancis,"nakedness"wasthesymbolofthepovertyandhumilityofChrist.Clare'smostferventdenudingofselfwasabstinence. AnotherpieceofthirteenthcenturyevidencesuggeststhatcontemporariesrecognizedthiscontrastbetweenFrancisandhisfemaledisciples.AnanonymousFrench FranciscanwhotranscribedacollectionofmaterialsonElizabethofHungarycastFrancisandElizabethindistinctiverolesassociatedbothwithgenderandwithfood. Hewrote:"[Francis]wasthefatherofthefriarsminorand[Elizabeth]wastheirmother.Andheguardedthem[custodiebateos]likeafather,shefedthem[nutriebat eos]likeamother."188IfweturntothosefourteenthcenturymenwhosepietyisatfirstglancemostnearlyparalleltothatoffourteenthcenturywomenHenry Suso,JohnTauler,RichardRolle,andJanvanRuysbroeckwefindclearevidenceofthedifferencebetweenmaleandfemalepietysuggestedbytheanonymous Franciscan'scomparisonoffatherFrancisandmotherElizabeth. HenrySusowasboththemostextremefoodasceticamongfourteenthcenturymenandoneofthefewmalesaintsoftheperiodgiftedwitheucharisticvisions.189He wasdeeplyinfluencedbywomenbothhispracticesandhiswritingswereveryclosetothefemalespiritualityofhisday.YetSuso'sfastingneverbecameafood fixationoradenialofordinaryhungersensationshunger,eating,andfoodwerenotbasicmetaphorsinhiswriting.Insofarasnursingwas,forhim,afundamentalmotif, itexpressedthecentralitynotsomuchoffoodasofwomenandmothersinhisemotionalworld.ApassagechosenalmostatrandomfromSuso'sLittleBookof Wisdomfindshimdescribingpatienceinsuffering(abasicfourteenthcenturymotif)asalivingsacrifice,asweetodor,avaliantknightintournament,acupof wholesomedrink,andaglitteringruby.190SucharangeofimagesistypicalofSusoeatinganddrinkingarenomoreorlessimportantherethanelsewhereinhis spiritualwriting. Suso'sorientationwasalmostentirelytowardwomen.Heexplicitly


identifiedwithhismother'spietyratherthanhisfather'sworldliness191heservedasadvisertoseveralcommunitiesofnunshisvita(whichwasdraftedinpartby ElsbetStagel,inpartbysomeoneelse,perhapsalsoanun)192makesitclearthathesoughtfemalefollowers,thatmorewomenthanmencametohimforadvice,and thatthispopularityledtounpleasantgossip.193Moreover,despitehislikingforchivalricmetaphors,Susooftensawhimselfinfemaleimages.Althoughtheearliest extantaccountofhislifewascompiledbywomenandtherefore,presumably,coloredbytheirchoiceoflanguage,itishardtoavoidtheconclusionthatthefeminine metaphorsemployedtodescribeSusoreflecthisselfperception,sinceboththereportedvisionsandhisownproseinotherworksrepeatedlycasthiminfemaleroles. HesupposedlyoncesaidtoGod:"Peoplecallmethefatherofthepoor...itismypolicytoweepwiththetearfulandmournwiththesorrowladenasamother smoothestheruffledbrowofafeverishchild."194Suchlanguage,inwhichotherscallSuso"father"buthehimselfclaimsamaternalresponsibility,istypicalofhisvita. WhenGodofferedhimavisionofhimselfasaknight,hetriedtorejectit.195Inanotherworkhewrote:"Lord,yourtreatmentofmeispuzzling:Ilookeverywherefor yourdivinitybutyoushowmeonlyyourhumanityIdesireyoursweetnessbutyouoffermeyourbitternessIwanttosucklebutyouteachmetofight."196Buthe welcomedJesus'descriptionofhiminavisionasamaidenpickingroses.197Speakingforallsouls,hewailed:"TheheavenlyFathercreatedmemorelovelythanall merecreaturesandchosemeforhistenderlovingbride,butIranawayfromhim''"formerlyIwascalledhisdearbride,butnow,sadtosay,Idonotdeservetobe calledhispoorlaundress."198Moreover,Susorepeatedlydescribedhimselfasanursingbaby.199Thefollowinglinesfromhisvitaaretypical,andthemetaphormay behisown:"WhenheenjoyedthefamiliarpresenceofEternalWisdomhefeltlikeasmilingbabeheldsecurelyonitsmother'slap,hungrilynuzzlingitsheadagainsther breast."200Sometimeshisdesiretosucklewasexpressedinmorethanmetaphor.Onenight,afterhehadsteppedasideforapoorwomanbecausehe"reveredMary inher,"Maryappearedtohiminavisionandlethimdrinkliquid"flowingfromherheart."201 Susothusclearlyidentifiedwithwomenandchildrenandwithfemalepiety.Nonetheless,hediscouragedwomenfromexactlythoseausteritiesinwhichhegloried.His wordstoElsbetStagelreflectafeelingofsu


perioritytopiouswomenandasomewhatdefensiveprideinhisownasceticattainments:"Discontinuetheseexcessiveausteritieswhichareunsuitabletoyoursex.... [Donot]aim...atimitatingtheausteritiesof...yourspiritualfather."202Moreover,althoughhefrequentlylikenedhisownsoultomaidenormother,hesometimes used"woman"asanimageofmoralweakness(ratherthanhumility)whenaddressingactualwomen.203Toaspiritualdaughterhewrote:"Knowthatyoucannotteach yourselfyouareweakerthanEveinparadise,andyetyouwanttoleadotherstoGod!"204Andheurgedhertoact"virilely,''tobea"knight"forGod,andeven likenedhimself,inteachingher,toaknighttraininganewsquire.205 Fromageeighteentoforty,Susopracticedextremeausterityintheuseoffoodanddrinkaspartofageneralprogramofbodilymortification,whichincludedfrequent scourgings,wearingahairshirt,andcarvingthenameofJesusintohisbarechestwithastylus.206Yetthroughouthisintensefastsandthirsts,heneverlosthistastefor foodanddrink.207Once,afterhavingabstainedfrommeatformanyyears,hegaveintoacravingforitasaresult,hewasattackedbydemonsandsufferedakindof lockjawforthreedays.208 Acharmingstoryfromchaptersevenofhisvitamakesitclearthathisfoodasceticismwasmerelyoneaspectofageneraltraininginselfdenialratherthanthe keystoneofhisasceticvocation.Suso,sothestorygoes,lovedfruit.Inordertocurehimofthiscraving,Godsentavisionofanapplethatsaid:"Eatme!"Suso replied,"No."Butthen,rememberingthathealwaystookanextraportionwhenfruitwasserved,hevowedtoeatnofruitfortwoyears.Becausetherewasfor severalyearsapoorharvest,fruitwasinanycasescarceyetwhenitbecameavailable,Susostillcravedadoubleportion.Atthepointwherehungerhadalmost conqueredhiswill,he"madeabargainwithGod."IfGodwantedhimtosatisfyhiscraving,Godwouldsendhimmuchfruit,Susosaidtohimself.Itseemedanunlikely possibility,inviewoftheshortage,butearlythenextmorningastrangerbroughtasumofmoneytothemonasterywiththestipulationthatitbespentforapples.Suso wasdelighted.209 Thus,despiteSuso'sidentificationwithfemalepietyandhisprideinhisextremeausterities,heneverlostthedesireforfoodassomanyasceticwomendid.Evenin hisyouth,fastingwasnotatthecoreofhis


determinationtoimitateChristandtosufferinpatience,ashismotherhaddone.Norwasfoodapowerfulimagetohim.210Theeucharisticvisionhereceived"many times"issurprisinglylackinginvividdetail,letalonefoodimagery.Hemerelysawraysemanatingfromthehost,andhissoulmeltedaway,piercedwithsweetness.211 Thedescriptionofhistablemanners,whichsoamusedandannoyedthegreathistorianHuizinga,makesitclearthattoSuso,foodpracticesfrequentlyevokedother religiousconcerns,whereasotherpracticesorsymbolsseldomevokedfood.WhenSusodrank,forexample,heswallowedfivetimesforthewoundsofJesus.Heate thefirstandlastmorselsofeachmealinhonoroftheheartofJesus.Hecutanylargefruitintofourparts,threefortheTrinityandthefourthpartforMaryheleftthe fourthpartunpeeledforMary'sbaby,becausechildrendonotpeelfruit.212InsuchpracticestheemphasisisonthebodyorthebabyhoodofChristandnotonthe factthatselfdisciplineisachievedthroughfood.Suso'sonlypersistentandelaboratedfeedingorfoodimageisnursingwhichseemstoexpressnotafixationonfood butaprofoundneedtobecaredfor,asachildiscaredforbyitsmother. FrancisofAssisiandHenrySusoareprobablythethirteenthandfourteenthcenturymenwhosepietyismost"feminine"ifweusethetermfeminine,ashistoriansof spiritualityhavedone,tomeanaffective,exuberant,lyrical,andfilledwithimages.Itis,therefore,deeplysignificantthatdespitetheaustereasceticismandeucharistic fervorofthesetwosaints,metaphorsotherthanfoodandpracticesotherthanfastingdominatetheirpiety.ThespiritualityofthreeothermalewriterstheEnglish hermitRichardRolle,JohnTauleroftheRhineland,andJanvanRuysbroeckfromtheLowCountrieswasalso,inthissense,"feminine."Allthreeelaboratedthe devotiontoChrist'shumanitysocentralinwomen'spiety.AllthreeRollemostofallvoicedtheemotionalidentificationwiththeeventsofChrist'searthlylifethat characterizedecstaticwomensuchasMaryofOignies,Hadewijch,ElsbetStagel,andMargeryKempe.213RuysbroeckandTaulerwerecrucialfiguresinthe developmentofeucharisticdevotion,andallthreewerecloselyassociatedwithcloisteredwomen.Yetfornoneofthethreewasfoodasceticismamajorreligious practicefornoneofthemwasfoodafundamentalmetaphorforencounterwithGodorserviceofneighbor.Nonechosehungerashisbasicsynonymfordesire,and tononewaseatingamajormetaphor


forbecomingonewithChrist'ssufferings(asitwasforHadwijch),forthedelightsofmysticalunion(asitwasforMechtildofMagdeburg),orforthesavingofsouls (asitwasforCatherineofSiena). Allthreeofthesewritersadvisedwomen,wroteforthem,andwereinfluencedbythem.Rolle'sFormofLiving,likehisothertwoEnglishepistles,waswrittenfora woman.Ruysbroeck'sMirrorofEternalSalvation,whichcontainsatreatiseontheeucharist,wasprobablycomposedforMargaretofMeerbeke,towhomhe addressedhisBookoftheSevenCloisters.AndRuysbroeck,likeSuso,wasdeeplyinfluencedbyhismother,whofiguredprominentlyinthevisionshereceived beforeheresolvedhisvocationalcrisisandenteredthehermitageatGroenendael.214MostofTauler'ssermonswerepreachedinGermantonuns.215 Onsomelevel,however,TaulerandRolledislikedwomen.Rollewascloselyassociatedwithanunneryduringhislifeasahermit,andhesymbolizedhisconversionby puttingonahabitmadeofhissister'sdresses.Hisvitawaspreparedbynuns,andheperformedthegreatmajorityofhismiraclesforwomen.216YetRolle,possibly becauseofadeepattachmenthehaddevelopedtowardawomanwhowastotallyignorantofhisfeelings,judgedwomenharshly.Hesawthem,inKnowles'swords, as"agreatdanger...,anoccasionofsin,deceitful,foolish,andweakinreasoning."217Taulertoo,likehisfellowDominicanandcontemporarySuso,viewedthenuns headvisedwithacertainambivalence.HesawwomenascreatedinGod'simage218anddescribedMaryasthemeansbywhichhumankindretrievedthelikenessto GodlostinEden.219Herecognizedthateucharisticpietywasaparticularcharacteristicofwomen.220Nevertheless,herepeatednegativestereotypesofthefemale:
Weareallwomeninourfrailty,amanlikeme,nolessthanyouwomengiddyweare,andunstable.ButIhavebeenincountrieswheretheyactlikemen,showinggreatstrengthin theirconversions,andgreatsteadfastness.ThewordofGodproducesgreaterandfinerfruitsthereinasingleyearthanintenwholeyearswithus.Miraclesandgreatgraceareto beseenthereamongsuchblessedpeople.Inothercountriestheyallbehavelikewomen.Whatevertheiropportunitiestheymakenothingofthem.Iknowthatyouwillnotliketo hearmespeakinthiswayaboutwomen,but,mydearchildren,wemustallbecomemenanduseourstrengthtoturntoGod,ifwearetobeofanyuse.221


UnlikeSuso,TaulerfeltnogreatneedtodescribehimselforGodinfemaleimagesalthough,likeallspiritualwriters,hecallsthesoul"abride."222ToTauler, tendernessaswellasharshnessandrigorwasincorporatedintothenotionoftheGodheadthroughthemaleimagesof"lovingfather"and"goodshepherd."223But whenheneedednotonlytosymbolizeutterselfabasementbutalsotourgeitastheonlypathtoGod,hechosetheCanaanitewomanfromMatthew15:2128and toldofacontemporarywomanwhoofferedtogotohellinordertodebaseherselfbeforetheCreator.224 TaulerandRollerejectedsevereasceticismasinappropriateattentionto"works"andwereslightlydefensiveaboutbeingthemselvesunabletopracticeit.Rolle'svita includesapassingreferencetofasting:

Hespurnedtheworldtoowithitsriches,beingcontentwithonlythebarenecessitiesoflife....Hemortifiedhisfleshwithmanyfasts,withfrequentvigils,andrepeatedsobsand sighings,quittingallsoftbedding...fixinghismindalwaysonheaven,anddesiringtodeparttobewithChrist,hismostsweetBeloved.225

ButRolle'sownwordsclearlyindicatethathedidnotpracticeextraordinaryfoodasceticismandthathewascriticizedbycontemporariesforfailingtofitthe recognizedhermitpattern. IntheMelodyofLoveRolleclaimsthathehasbeenattackedunfairlybysomewhoattributethemysticalfavorshereceivestodrunkennessorafullstomach. Althoughhedescribeshimselfaspracticingpenance,avoidingwomen,andmaceratinghisflesh,headmitsthathehasfounditnecessarytoeatandthat"althoughIam gratifiedwiththeheavenlymelody,someholdmeforamanofnothing.Theseeviltonguessaythat,liketherich,Ilivewell.AndtheywishtoconvinceeveryonethatI amunworthyofGod."226IntheFireofLovehecommentsthatitisbettertoeatalittletoomuchbymistakeifitisdone"withgoodintenttosustainnature"thanto fastuntilonebecomestoofeebletosingwithloveofGod.

EatenhaveIanddrunkenofthisthatseemedbest,notbecauseIlovedpleasantnessbutbecausenaturemustbesustainedintheserviceofGod....IdaresaywithblessedJob: "Foolshavedespisedme...,"neverthelesstheyshallbeashamedwhentheyseemethathavesaidthatIwouldnotabidebutwhereImightbedelicatelyfed.227


Andthoughpalenessoffacebethebeautyofsolitaryman,neverthelesstheirserviceisnotrightlyorderedforiftheybebiddentochastisetheirbodiesandbringthemintothe serviceofthespirit,yetoughttheynottoslaytheirbodies,butkeepthemforthehonourofGod.228

LikeFrancisofAssisi,Rolleseemstohaveconceivedoftrueasceticismasthestateofbeingatthemercyofothersratherthanasrigorouscontrolanddenialofself. Thushestressedtheirregularityofsustenancemorethanitsabsence,writing:"Ifreelypraisethegiverofthelaw...becauseinthislifeIamwithoutpowernordoI haveanythingwhenIhungerexceptwhatothersgivetomeandIeatnotwhenIwillitbutatthewillofothermen."229 Tauler,likeRolle,wasbothunabletofastandunimpressedwiththespiritualvalueofextremefoodasceticism.HeadvisedthefaithfultoacceptthesufferingGod sendsratherthanseekoutmorebitternessthroughselfimposedausteritiesorthe"busyness"of"works":

Setyourheartatrest.Whetheryouhavedeserveditornot,takeyoursufferingascomingfromGod,thankhimforitandbeatpeaceandatrest....[Butsomepeople]wanttotake stillmore[bitterness]uponthemselves.Theymakethemselvesillandqueerinthehead,anditisallofnoavail.Thereasonwhytheyderivenogracefromtheireffortsandmakeno progressisthatthewholeperformanceisselfdetermined,whethertheyaredoingpenance,fasting,prayingormeditating.TheyexpectGodtofallinwiththeirideas.230

Taulerarguedthatthevalueofsufferingliesinselfabnegationthereforesilenceisthebestausterity,moreusefulthanfastingorvigilsorselfflagellation.231Hecalled thetendencytojudge(oreventopayattentionto)theasceticpracticesofothersa"murderer"and"thief"thatrobsGodofproperhonoranddevotion,232andhe warnedthatasceticismcanleadtopride:

Dearchildren,whatarethesedelightsandsatisfactionsthatwehavetobedetachedfrom?Theyarethingslikefasting,keepingvigils,praying,observingtheRuleoftheOrder thesearethedelightswhichithasnotbeenourLord'swillformetofindinourOrder.233


NordoImean[thatweshoulddespise]thosethingswhichservetheneedsofournature.Whenwearehungryorthirstywewillnaturallyenjoyeatinganddrinking,atiredman willnaturallylookforwardtoagoodrest....Evenso,ifwedesirethesethingsgreedilyasmeresourcesofpleasure,andnotbecauseweneedthemorfindthemuseful,theycan hinderthebirthofGodinoursouls.234

Urginganinnerpoverty,areposebeyondworksandbusyness,TaulerjustifiedhisowninabilitytopracticeasceticismasitselfascourgesentbyGodandatthesame timearguedforadeeperandhighersurrenderthatwentbeyondallpracticesevenbeyonddiscursivemeditationonChrist'sPassion:235
ButGod...oftenbreaksdownwhateverrestsonsuchafoundationasthis[i.e.,piouspractices]byfrequentlyarrangingthingswhichruncontrarytomen'sdesires.Iftheywant tokeepvigil,theyareobligedtosleep,againsttheirwilliftheyliketofast,theyaremadetoeat....Forjustasworldlyandsinfulpersonsareseducedbysensualpleasures,so thesepeopleareheldbackbycomplacencyinwhattheydoorwhattheyfeel,andarethushinderedfromanabsoluteandsimplesurrendertoGod.236

TheFlemishmysticRuysbroeck,anxious(likeTauler)tocounteranysuggestionofquietismorantinomianism,alsomaderoomformeditationonthePassion,for fastingandabstinence,andevenforphysicalmanifestationsoflikenesstoChristsuchasstigmata.ButhepreferredahigheranddeeperunionwithChrist'sdivinity, beyondworksandbusynessandconcernforpractice.237InhisBookoftheSevenCloisters,writtenforanun,hepraisedthe"poorconvent,"warnedagainstexcess infoodanddrinkasthe"rootofallsins,"andpointedoutthatAdamfellthroughgreedalthoughhewasnothungry,whereasChrist,hungryandtemptedbythedevil, resistedfood,saying"Mandoesnotlivebybreadalone"(Matt.4:4).Buthealsowarnedagainsteatingtoolittleanddamagingthebody,whichshouldbeourservant, andpointedoutthatwisereligiousleaderssuchasAugustineandFrancis,whilestrictforthemselves,werelenienttowardthehumanneedsoftheirfollowers.238 Moreover,HenryPomer,inhislifeofthesaint,laysnostresswhatsoeveron


foodasceticism.239HeevensuggeststhatwhatwasremarkableaboutRuysbroeck'sdevotiontotheeucharistwasthefactthathedidnottreatitlikefood.Unlike othercelebrants,Ruysbroeckseemedtoabsorbthehostwithoutopeninghislipsorchewingorrollingitonthetonguerather,hewastransportedtoGodfromthe momenthetouchedtheelements.240 Despitetheirprofounddevotiontotheeucharist,neitherTauler,Rolle,norRuysbroeckusesfoodasabasicimage.Ruysbroeck,althoughinfluencedbyHadewijch,to whomfoodimageryandeucharisticdevotionwerecrucial,241makeslittleuseofanyimagefromanimatenature,althoughhisworkisfilledwithmetaphorsoflightand water,sunandsea.242Eveninthelittleeucharistictreatisefoundinchapters4to17oftheMirrorofEternalSalvation,hungerandthirst,althoughoccasionally metaphorsfordesireforGod,arenotthemostcommonimages.RuysbroeckranksthemfourthamongthesevenblessingsofthosewhoattainunionwithGod.243The onlypassageinwhichhungerbecomesanimageofinsatiable,consumingdesireisadiscussionofChrist'sdevouringofoursins.244OnlyintheBookoftheTwelve BeguinesdowefindrepeatedpassagesinwhichdesireforGodistreatedasinsatiablehunger,ashellitself,245andanoccasionalearthyimage(likethosesocommon inRuysbroeck'scontemporary,CatherineofSiena)ofChristasroastedmeatandwarmdrink.246AndtheBookoftheTwelveBeguinesnotonlyputssuchimages intothemouthsofwomen,itisalsosometimesdirectlyimitatedorevenborrowedfromHadewijch.247 ToRolle,heatandmelodyarethedominantimages,astheverytitlesofhisworksindicate.248Evenwherehequotesbiblicalpassagesthatsuggestimagesofeatingor drinking,Rolleavoidselaboratingthem.Commenting,forexample,onPsalm77:25("Manhaseatenthebreadofangels"),Rollewrites:"Thesoundofpraiseisangels' food."249 Tauler'sbasicthemes,oftenadoptedfromEckhart,areofthesoul'sfreedomfrom"works"andworldlyconcerns,itstrue"patience"beforeGod,itsfinal"illumination" and"transformation"intoGod.HeusestraditionalBernardianlanguageof"eating''and"beingeaten"todescribethesacrament,butsuchimageryexpressesnotso muchyearningasrepose.NeitherChrist'sbody,hisflesh,hishumanityas"food"norourdesireas"hunger"iscentralinthesepassages,but,rather,anEckhartiansense ofourdeification:"250

Page111 WefeeduponourGod[WiressentunsernGot].HowwonderfulandinexpressibleisthisloveofHisthatfoundthismarvelouswayforHimtocometous.251 ItisGodHimself,andnointermediary.ThereisnodifferencebetweenitandGod.InthisgiftHegivesHimselftousdirectlyandnotinanyfigurativewayHeisunited,simplyand purely,withus.Thisisafeastindeed."252 Alltheotherfoodweeatisabaseandlifelessthing,derivingitsworthonlyfromthedignityofhumanlifewhichitsupports.Butthisnoblefoodislivingitself,andisthelifeof men.Allthosewhoarerefreshedandnourishedbyitliveeternally.253

Tauler,likeRolleandRuysbroeck,allowsbiblicalpassagestosuggestfoodmetaphorstohim.Forexample,whenhepreachesonJohn7:37("Ifanymanthirst,lethim cometomeanddrink"),hesaysthattheHolySpiritgivesusthirstforGodandthatonceweshakeoffearthlythings,wearejubilantandinebriatedwithGod.But evenhereheweavesthirstinginamongotherimages(suchasthatofhoundspursuingthehart),andheshiesawayfromthesortofhungerimagesthatdelighted fourteenthcenturywomenimagesinwhichhungerisinsatiablelonging.254Rather,hespeaksoftakingtherichandtastydishesofGodpreparedinthekitchenorof aworkmanstoppingtoeatinordertogoonworking.255Foodisrefreshmentorrespiteitisnotacentralimageeitherofourcravingformysticalunionorofsuffering inimitationofChrist.Awareoftheeucharisticpietyofthewomenofhisday,heholdsbackalittlefromadvocatingitsenthusiasms.InaCorpusChristisermonon John6:5("Hethateatsmyfleshanddrinksmybloodabidesinme"),hewarns:

Hedoesthis[giveshimselfasbread]sothathemaycomeintous,sinkintous,becomeapartofus,socloselyandintimatelythateventhesensescangraspandunderstandit. Hadhewished,hecouldhavedonethisinamuchgranderandmoresplendidway,illuminingandtransfiguringus.IndeedSt.Hildegardwrotethatthisdoeshappeneveryday, thoughinvisibly.AsisterofourOrderupinthemountainshadavisionofthisverythingshesawanamazinglightsurroundingthepriestandthealtar,agreathostofangelsand manylovelythings.ShesawallthiswithherbodilyeyesbutthisisnotthewayinwhichourLordgivesHimselftoyouandme.256


MensuchasFrancisofAssisi,RichardRolle,andHenrySusoareoftenseenasthemostextremeexamplesoftheaffectivespiritualitythatcharacterizedmanylate medievalwomen.AnditiscertainlytruethattheiremotionalidentificationwithscenesfromChrist'slife,especiallyhisNativityandCrucifixion,wasbothliteraland extravagantalthoughsomemedievalwomen,suchasMaryofOigniesandDorothyofMontau,exceeditinexuberance.Inanycase,therewasnothingexclusively "feminine"abouttearsorecstasies,aboutvisionsorpoetry,inthelaterMiddleAges.Yetthemenwhodisplayedsuchcharacteristicswerefrequentlyadvisersof womenandcloselyinfluencedbythem,andthecharacteristicsweremoreoftenfoundinwomen'sreligiosity.257IndiscussingFrancis,Suso,Tauler,Rolle,and Ruysbroeck,Ihavelookedbrieflyatthosethirteenthandfourteenthcenturymenwhoweremostinfluencedbywomenandwhosepietymostresembledtheirs.Itis thussignificantthattheirdevotionshowednomarkedinterestinfood,eitherasasceticrenunciationorasmetaphorforencounterwithGod.Itisalsosignificantthat theyexplicitlyassociatedeucharisticdevotionandfastingwiththeirfemalefollowersandbothadmiredandcastigatedinwomentheextravagantvisionaryandascetic experiencestheythemselvesfounditimpossibletoachieve.258


4 FoodintheLivesofWomenSaints
[Avoicesaid:]"Believe,daughter,andyoushalleat.Andletnooneputawayfromyoutheconsolationofsufferingforme,becauseyouwillnotlackmeindeed,youhavemenow andbecauseyouloveme,nowyouhavewhatyoulove....Trusttherefore,daughter,andhastentoLukardis,yoursister,andjoinyourselfthustohersothatyourmouthcanreceive breathfromhers...."[Agnesobeyed,andLukardisblewinhermouth.]...Inthatmoment,[Agnes]feltinhermouthasifshehadthesacramentofthehostgiventoherbythehand ofapriest.Throughthis,sheafterwardsasserted,agreatsavorofthesweetnessofdivinegracepenetratedheratthisveryhour...sothat,herinnereyebeingillumined...,shesaw openlymanymiraculousthingsworkedwithintheservantofGod,hersister,byGod.AndamongmanyotherthingsshesawcelebratedintheheartofthehandmaidenofChristthe deliciousbanquetofGod....There,ifitispermittedtosayit,sheknewtheholyTrinityinunityofessenceasifitcelebratedmass....Andeach[sister]sawherselfintheotherasif inamirrorandknewtheremarvelousthingsinthelightofdivineunderstanding. LIFEOFLUKARDISOFOBERWEIMAR (EARLYFOURTEENTHCENTURY)1

InthehighMiddleAgesdevoutChristiansfastedbeforecommunionandreceivedtheirGodasfood.Because,inthisoneritualmoment,foodactuallybecameGod, foodwasapowerfulsymbol.MysticsandpreachersfromAugustineandJohnChrysostomtoBernard,Tauler,andGersonusedfoodasametaphorforgraceand inspiration,fastasasymbolofpenanceandpreparation.Someholywomencarriedthereligioussignificanceoffoodmuchfurther.Notonlydidabstinenceand eucharistlieattheheartoftheirpractice,eachtookamoreradicalform,fastsometimeslengtheningintoyearswithouteating,communionsoar


ingintodaysoffrenzyortrance.Moreover,asthepassagefromtheLifeofLukardissuggests,eatingandnoteatingbecamemorethanmetaphorsforgraceand desire.Theybecameactualmodesofexperiencing.Andsuchexperiencingwasnotlimitedtothecontextofthemass.TobothLukardisandAgnes,revelationand healingweregivenfromnuntonunasfood.Anygracemighttastelikethesacramentanycommunionorsharingmightbeabanquetanygiftmightbegivenbyorinto themouth. Itisonlythroughcloseanalysisofanumberofmedievalstoriesthatwecanseethewayinwhichfoodthemesinteractandinterweaveinwomen'slives.Suchanalysis indicatesthatwomen'swaysofservingtheirfellowChristiansandofunitingwithGodwerecloselytiedtofood,bothsymbolicallyandinfact.Medievalwomenfed others.Theyabstainedinordertofeedothers.Theyfedotherswiththeirownbodies,which,asmilkoroil,becamefood.Theyateordrankthesufferingoftheir fellowcreaturesbyputtingtheirmouthstoputrifyingsores.Moreover,womenachievedecstaticunionbyfusingwithaGodwhobecamefoodonthealtar.Inafierce imitationofthecrossthatincludedselfflagellation,selfstarvation,andacuteillness,womenbecamethemaceratedbodyoftheSavior,thebleedingmeattheyoften sawineucharisticvisions.IneroticunionwiththeadorablebodyofJesus,theyfeltgracewithinasinebriatingdrinkorasameltinghoneycomb. Thisassociationofthecontemplative,theascetic,andthecharitableactivitiesofwomenwithfoodbothactualfood,eatenanddistributed,andfoodasasymbolof giftorfleshrunsthroughoutthevitaeofwomensaints.Someofthesevitae,particularlythecollectivelivesknownasNonnenbcher,werewrittenbywomen, thoughthemajorityofextantdescriptionsofholywomenwerecomposedbymen.Thusitwouldseemthatbothmenandwomencontributedtothetendencyto describewomen'sexperiencesandwomen'sbodiesinfoodimagery.Theguidanceofconfessorsandpreachersaswellasofabbessesandspiritualfriendslaybehind thestrikingpatternoffeedingmiracles,eucharisticvisions,andextendedfaststhatcharacterizedwomen'slives.Theanalysisthatfollowsdemonstrateshowimportant foodwastowomen,bothassymbolandasfact.Italsosuggeststhattheassociationofwomanwithfood,especiallythenotionthatwoman'sbodyisfood,was importanttobothmenandwomenfromthethirteenthtothesixteenthcentury,andperhapsbeyond.


TheLowCountries ThecentralityoffoodinfemalespiritualityfirstemergedinaremarkablegroupofLowCountrywomeninthelatetwelfthandthirteenthcenturies.Mostlythedaughters ofwealthyurbanfamilies,frequentlysufferingintenseadolescentconflictovertheirparents'desireforthemtomarry,oftenofquasireligiousstatusratherthanaffiliated withanyestablishedorder,thesewomencombinedacontemplativeorientationwithintensespiritualfriendships.2 Theydisplayedaquietsenseofservingothers throughprayerandsometimesthroughmoreactivecharities.ThemostfamousisthebeguineMaryofOignies,precursorinmanydevotionalpracticesofFrancisof Assisi.Numerousothersemergefromthesourceswithdistinctivepersonalities:thelearnedandaccomplishedwritersBeatriceofNazareth(d.1268)andHadewijch MargaretofYpres(d.1237),whodiedyoungandneverreallyfoundthespiritualadvisershecravedIdaofNivelles(d.1231),IdaofLouvain,andIdaofLau(d. latethirteenthcentury),withtheireucharisticfervorthesufferingleperAliceofSchaerbeke(d.1250)JulianaofCornillon,whowanderedinsearchofareligious house,neverfindingadequatesupportforhergreatvisionofthefeastofCorpusChristiLutgardofAywires,quiet,reclusive,butsoughtoutbyothersasareaderof heartsandChristinatheAstonishing,whosevitaisfilledwithsomeofthemostvividandimprobablemiraclesofthethirteenthcentury.Intheirvitaewrittenbytwo remarkableclericalbiographers,JamesofVitryandThomasofCantimpr,andseverallesswellknown,sometimesevenanonymous,authorsfoodmetaphorsare prominent.Themaleauthorsfoundextravaganteatingimageryusefulindescribingtheecstaticexperiencesoftheirsubjectsthewomenthemselveswhenwehear theirvoicesrecountingvisionsordeliveringpithyopinionsusedeatingimagerynotmerelyfortheeucharistbutforotherspiritualexperiencesaswell.3 MaryofOignies,whofrequentlyexperiencedthetasteofhoneyinhermouthatmass,alsoreceivedsensationsofbeingfulloroftastingsweetnesswhensheheard wordsofspiritualadvice.4 Whenherbiographer,JamesofVitry,wonderedwhyherfrequentvigils,fasts,andeffusionsoftearsdidnotcauseheadaches,Mary replied:"Thesetearsaremyfeast[refectio]theyaremybreaddayandnightthey...feedmymindratherthanemptyingandafflictingmyhead,theybringsatietyto


mysoul."5 LutgardofAywires,harassedbysuitorsinheryouth(oneevenattemptedtoabductandrapeher),6 spokethustoaprospectivehusband:"Goawayfrom me,foodofdeath,nutrimentofvillainy,sinceIamheldbackbyanotherlove."7 Asmarriagewasthefoodofdeath,sodeath,toLutgard,wasthefoodoflife.Five yearstothedaybeforeherdeath,uponhearingthegospelparableofamanwhopreparedagreatfeast,shetoldSybilofGagesthatonthatverydayshe"wouldgoto themealofthespouseofthelamb."8 IdaofLouvain,likeMaryofOignies,experiencedbizarresensationsofeatingwhennofoodwaspresent.Shereceivedthe"food ofspiritualreading"intoherstomach,felttheeucharistslipdownherthroatlikeafish,saidtotheothernunsbeforecommunion,''LetusgodevourGod,"andfound hermouthfilledwithhoneycombwheneversherecitedJohn1:14:"Verbumcarofactumest."9 Whenoneofherbloodsisterscalledhertocomeawayfromprayerand smellthesweetwineherfatherofferedforsale,Idasaid,"Winewillprovokemetotears,"but,saidherhagiographer,she"didnotmeanmaterialwine."10Julianaof Cornillon,whopracticedextremefastsandfeltpassionatecravingfortheeucharistduringadolescence,wasteasedanddisciplinedforherexcesses.Whenhernurse andsisterstoreherawayfromprayer,callinghertoeat,shetoldtheminajollyway,"Iwantbetterandmorebeautifulfood,"butshehidherrealmeaningfrom them.11 SuchpassagessuggestthatthesewomenquiteunselfconsciouslythoughtofGodasfood.Moreover,thebiographerswhorepeatedtheircommentspersistentlyused extendedfoodmetaphorstoelaboratethesignificanceofwomen'spractices.JamesrepeatedlydescribedMary'secstasiesasinebriation,ashungerandfullness,as receiving"milkandhoneyfromthelipsofthespouse."12ThomasofCantimprspokeofMargaretofYpresasaccepting,chewing,andsavoringGod.13The anonymousauthorofAliceofSchaerbeke'svitadescribedherasrestoredbyliquidfromthebreastsofChrist,asinebriatedwithhissweetness.14Hewrotethusof Alice'sseclusionbecauseofdisease:
Thefirstdayshewentintothe[littlehousebuilttoisolateherfromtheothersisters],theLordappearedtoherandtookherinhisarmswithanembraceandsaid:"Welcome, daughter!Ihavelongdesiredthistabernacle.Aslongasyouareinthisbody,Iwillremainwithyou.AndIwillbeyourcellarer[themonasticofficialinchargeoffood]toprovide youwithwhatyouneed."15


TheauthorofthebriefvitaofthebeguineGertrudevanOostenechoedJamesofVitry'svitaofMaryofOignieswhenhesaid:"Andsodayafterdaytearswereher fooddayandnight,andifshetookanycorporealfooditwasonlyalittleandneverwithoutweepingandwailing."16 Foodwasnot,however,merelyametaphorforinteractionwiththedivine.Itwasattheheartofreligiouspractice.TheprimarydevotionalemphasisintheseLow Countryvitaeisthesubstitutionofholyfood(eucharist)forordinaryeating.Whetherornotpenitentialasceticismingeneralcharacterizedtheirlives,thewomenall fastedinordertopreparethemselvesforChrist'sbodyandblood.SeveralofthemwereincapableofeatingordinaryfoodwhentheyexperiencedthefillingofChrist. MaryofOigniesvomitedoutanunconsecratedhostandcompulsivelywashedhermouthtoridherselfofthetaste.17IdaofLaurepeatedlyexperiencedfitsand tranceswhichshefoughttocontrol,becausenewlegislationhadbeenpasseddenyingthecuptoanyonesufferingfromfrenzy.18Whileoutofhersensesshecouldnot swallowordinaryfoodevenifitwasplacedonhertongue,andevenwhileinhersensesshefeltnonormalhungerondayswhenshehadtheeucharist.19Margaretof Yprescouldtastenothingexcepttheeucharistduringthelastyearofherlife.20IdaofLouvainandChristinatheAstonishingwerebothconsideredinsaneandwere chainedupbytheirfamiliesbecauseoftheireucharisticcravings.21 Themass(and/orreceptionoftheeucharist)wasfrequentlytheoccasiononwhichthesewomenreceivedecstaticunionwithChrist.Andthesweetnessofecstasywas oftenexperiencedaspalpablefood.WhenIdaofLouvain,forexample,begantofeelstrongerandstrongerdesireforfrequentcommunion,shewastoomodesteither tobringthematterupwithherconfessorortoreceivetheeucharistwithouthispermission.Thus,wroteherhagiographer:
Itfrequentlyhappenedatthattimethat,whenthepriestreceivedtheholycommunionatthealtar,asthecustomwas,she,intheintensityofherdesire,receivedwithhermouthat theselfsamemomentthemostsacredpledgeofthehostoftheSavior(brought,webelieve,byaministeringangel)anddiscerneditwiththesenseoftasteandevencheweditwith herteeth.22



eucharistas"light"orasavaguesweetnesswithinIdareceivedherLordasfoodbetweenherlips.23 Whenreligioussuperiorsdeniedthecuporthehosttowomen,sometimesindirectresponsetotheirextravagantbehavior,Christoftenfedthemdirectlyinvisions.For example,IdaofLauwasdeniedthechalicebecauseoffrenzyandAlicebecauseofleprosy.24IdaofLouvainwasdeniedthecupbecauseofnosebleedsand,at anothertime,wasdeniedreceptionbecauseofherstatusasnovice.25Lutgard'sabbessforbadeherweeklycommunion,probablybecauseofthejealousyoftheother nuns.26Inconsequence,allwerecomforted,fed,andvindicatedbyChrist.IdaofLouvainandLutgardhadvividexperiencesofnursingfromChrist'sbreast.27 Thomastellsusthatonce,whenLutgardstoodbeforethecrucifixduringoneofherillnesses,shesuddenly"sawChristwithhiswoundallbleeding.Andshesucked suchsweetnesswithhermouthathisbreastthatshecouldfeelnotribulation."Onanotheroccasionthefigureonthecrucifixleaneddownandpickedherup,holding hertohissidetonurse.YetanothertimeChristcameasalambtoherandsuckedfromhermouthamarvelouslysweetsong.28Thomasalsodescribesafourthvision inwhichLutgardencounteredGod(orGod'srepresentative)inagraphicallymouthtomouthembracethatbroughtcomfortindeprivation.ShesawJohnthe EvangelistasaneaglesuckingfromChrist'sbreasttheeaglethenflewtoher,insertedhisbeakbetweenherlips,andfilledhersoulwithsplendors.29Theauthorofthe vitaofIdaofLaumakesitquiteclearthatGodsubstitutesheavenlyfeedingwhenwomen'spassionatedevotionisdeniedbyearthlyauthorities.
Andmanygrieved[whentheablutionscupwasprohibitedtonuns],thirstingwithunquenchablethirst,...andtheyobservedthesentencegivenbecauseofthegoodof obedience,althoughtheyburnedagainstit....[But]listentowhatthephilosophersays:Whogivesalawtolovers?Loveistheirparamountlaw.ThereforeblessedIda..., afflictedbyarigidsentencewhichwasthewayoftheorder,prostrateasmuchinbodyasinspirit,...lifteduphervoicetoGodsaying:"Youknow,ohLord,thatIdarenotcome toyoubutyoucanstillcometome."Whichthingsbeingsaid,thefatherofmercies...filledherdesireslovinglyandquickly.And...hevisitedherthroughthewholeyearon Sunday,givinghersweetnessandsavormorefullythanshehadhadbeforewhenshehadreceivedthebodyoftheLord.30



FilledwithChrist,therecipientwassimultaneouslycrucifiedwithhisagony.IntenselyliteralintheirimitatioChristi,desiringtofusewiththephysicalbodyofChrist thattheychewedandconsumed,thesewomenprovidesomeoftheearliestexamplesofthenovelmiracleofstigmata.MaryofOigniesrespondedtohereucharistic cravingandtoguiltabouteatingafteranillnessbymutilatingherselfintheformofChrist'swounds.31IdaofLouvainreceivedstigmataatthemomentinherlifethat wasthehighpointbothofeucharisticfrenzyandofconflictwithherfamilyalthoughsheaskedtohavetheoutersignsremoved,theinnerpainremained.32Therecluse ElizabethofSpalbeek(orHerkenrode)(d.after1274),whoimitatedthePassionofChristinelaboratepantomimeandselftorture,supposedlyreceivedinherbody "veryclearly...withoutanysimulationorfraud"thefivestigmataoftheLordasrecentwounds,"whichfrequently,andespeciallyonFridays,emittedastreamof blood."33Moreover,likeChrist'sdeathonthecrossitself,suchimitationhadevangelicalovertones.Lutgard,Aliceandothersofferedtheirexcruciatinghungerfor Christ'sbodyandbloodinexchangeforthesalvationofthesoulsoftheirfellowChristians.34 ExtremefastingisathemeineveryfemalevitafromtheLowCountries.Whenthewomenlivedintooldage,fastingwasusuallymostintenseinadolescence.Itwas oftencombinedwithsleeplessnessandhyperactivity.ThevitaeofMaryofOignies,JulianaofCornillon,IdaofLouvain,IdaofLau,ElizabethofSpalbeek,and MargaretofYpresmakeitclearthatthewomenreachedapointwheretheywereunabletoeatnormally,wherethesmellandsightoffoodcausednauseaandpain. MaryofOignies,whomutilatedherfleshoutofguiltovereating,thenembarkedonaprogramofextendedfast.Sheateonlyonceaday(atVespersoratnight)she tooknowineandnomeatoftensheateonlycoarseblackbreadthattoreherthroatandmadeitbleed.Once,afterthirtyfivedaysoftotalabstinenceandsilence,she "camebacktoherself"andtriedtoconsumeearthlyfood.Butshecouldnotbearitsodorandcouldsiponlywinefromtheablutionscup.IdaofLouvain,whorefused toacceptanythingfromhermerchantfatherexcepttheroomshelivedin,workedatnighttoprovidefoodforherselfandforthepoorwhocametoherforaid.Sheate onlymoldybreadand,iffoodwasservedtoher,shemixedittogetherinordertodestroyanypleasanttasteitmighthave.Onceshewentforelevendayseatingonly thelittleflowersofthelimetree.JulianaofCornillon,whowaspunishedforexcessivefastingasachild,triedtohideherrefusaltoeatduringado


lescence,butsheconsumedsolittlethathersisterswonderedhowshelived.35WhenLutgard,duringoneofhersevenyearfasts,wascommandedtoeat,thefood refusedtopassdownherthroat.36PhilipofClairvauxreportsthatElizabethofSpalbeekatealmostnothing.Shecondescended,withobviousreluctance,tolapupa littlemilk,butsheabhorredfood.Whenrelativesorcompanionsputfruit,meat,orfishtoherlips,shesuckedalittlejuicebuttookinnothingof"thegrossermatter."A doveconsumedmoreinasingleswallow,saysPhilip,thanElizabethwaswillingtodrinkofthewineshewasoffered,andheremarks:"Sheateanddrankmoreto satisfythewillofothersthanbecauseofherownwillorevenbecauseofnecessity."37 Suchfastingwasinterpretedbybiographersasrenunciationoftheworld.ThomasofCantimprcommentsthatChristinatheAstonishingcamefromafamilysopoor thatshehadnothingtogiveupexceptfoodanddrink.38Butfastingwasoftenspecificallyaresponsetoguiltoverthewealthandconspicuousconsumptionpracticed bymerchantfamilies.MaryofOignies,Lutgard,andIdaofLouvain(whosefathersoldwine)struggledtoavoidtheprosperousmarriagesplannedforthem.Julianaof Cornillonfastedaspartofabattlewiththesuperiorsofherlittlemonasticdependency,whoweretoolenientforhersevereadolescenttaste. Fastingwasseldomexplicitlylabeled,eitherbywomenorbytheirhagiographers,asanattackonthebody,anexertionofcontroloverit,oranefforttodestroyits sensationsorresponses.Hagiographersoccasionallypraisedwomen'sasceticfeatsandcomparedtheirsubjectsfavorablytotheDesertFathersofantiquity.39But theyalmostneverdrewadichotomybetweenfleshandspirit,nordidtheyjustifyfastingbyreferencetoaconnectionbetweenfoodandlust.Rather,theyspokeof abstinenceaspreparatorytoandsimultaneouswithtruefeedingbyChrist.ItwasidentificationwithChrist'ssufferingitwasaffective,evenerotic,unionwithChrist's adorableself.Itwasalsoserviceofothers. ThehagiographersandthewomenthemselvessawselfstarvationandillnessasextensionsbothofChrist'ssufferingonthecrossandofthepainsofpurgatory. Purgatorywasnotprimarily,tothesewomen,aphysicalplacesomewhere,alogicalcomplementtoheavenandhellitsimplywassufferingredemptivesuffering whichwassimultaneouslyChrist'sandthesinner's.Thussufferingonearthcouldreplacesufferinglater,andbysufferingonecouldredeemothersaswellasoneself. Mar


garetofYpresdesiredthetormentsofherdeathtolastuntiltheyconsumedhertimeinpurgatory,andChristinavisionguaranteedthatthishadalreadyhappened.40 LutgardtoldafriendthatChristhadpromisedherthatherblindness,patientlyaccepted,wouldreplacethepangsofpurgatory.41 Suchsufferingalsoservedone'sneighbors.AliceofSchaerbekeofferedupforspecificgoalsthelossofvariouspartsofherbodytoleprosy.42Lutgard,attheVirgin Mary'scommand,undertookthreefastsofsevenyearseach(onbreadandbeer)inordertorelievesoulsinpurgatoryandtoquietChrist'sangeroverheresy.43Ona lessuniversalnote,MaryofOigniesfastedfortydaystodriveademonoutofanafflictednun.44Speakingtoabelovedcompanionafterlosingherrighteyetoleprosy, AliceofSchaerbekevoicedthenotionofsufferingthatsustainedmanyreligiouswomen:"Dearsister,donotgrieve[forme]anddonotthinkthatIsufferforor expiatemyownsinsIsufferratherforthosewhoarealreadydeadandintheplaceofpenitence[i.e.,purgatory]andforthesinsoftheworld."45 Fastingwasnottheonlyformofservicethesewomenpracticed.Theyalsocareddirectlyforthesickandthepoor,oftenbyprovidingfood.MaryofOignies,who neverachievedthecompletepovertyshewanted,gaveherowngoodstothepoor,beggedinordertofeedthem,andworkedfortheirfoodandclothing.46Christina beggedinordertoshareherfood.47EvenlittleJulianaofCornillonfedhersistersbyrequestingthejobofcowherdandproducingmoreinmilkingthecowsthan anyoneelsehadbeenabletodo.48 AcharmingstoryfromthelifeofIdaofLouvainillustratesnotonlyIda'scommitmenttofeedingthepoorbutalsoherstrangeeatinghabits,herecstasies,andher conflictwithherfather.Moreover,itshowsthewayinwhichsuchmotifstendtobewoventogetherinthesevitae.Oneday,sothestorygoes,Idawassnatchedinto ecstasywhilereturningfromVespersandsawMarycarryingJesusonherbreast.Shefelldowninthestreetasifdeadand"agreatwaveofcorpulence"invadedher body.Shebegantoshake,alarminghercompanion.Atthisverymoment,however,apoormanwasbeingdeniedhospitalitybyIda'sfather.Whenthepauper, mutteringtohimself,madehiswaypastIdainthestreet,shecamebacktoherself,wenttoherfather,andobtainedalmsforthebeggar.Shethenreturnedtoherroom anddalliedinspiritualdelightsforthirteendays.Duringthistimeshetookmaterialfoodonlyonce,when


breadlyingbesideherbedbegantosmellunnaturallysweet.Thenshesnatcheditupandateit"bydivinepurpose,thatherbody,whichwastakingnomaterialbread, mightbestrengthenedduringthesethirteendays."49 ThereligiouswomenoftheLowCountriesfedothersthroughmiraclesaswellasbytheworkoftheirhands.IdaofLouvaincuredthereligiousdoubtsofayounggirl bychangingbeerintowine.OnoneoccasionthebreadonIda'stablegrewratherthandiminishedduringthecourseofthemeal,inordertohelpthepoorandsickto whomitwastobedistributed.50Lutgardtwicecuredgirlswhofeltacravingformeat,whichThomasinoneinstancelabeledan"infirmity."51ThefruitJulianaof Cornillongavetoafriendwassubsequentlydiscoveredtohavesupernaturalsweetness.52 Mostremarkableofall,thewomen'sbodiesthemselvesbecameasourceoffood.Theyexudedoil,milk,orsweetsalivathathadthepowertocureothers.Such extraordinaryexudingwasclearlypredicatedonunusualclosure.Hagiographersconnectedfailuretoeatordinaryfoodorexcreteordinaryfluidswithexuding extraordinaryliquids.ThomasofCantimprmentioned,forexample,themomentatwhichLutgardceasedtomenstruate.53HealsoreportedthatChristonce commandedhertogetupfromafeverishsweatinwhichshewaslanguishingandgodirectlytochurch."Whyareyoulyingthere?"heasked."Youmustdo penance...notindulgeinsweat."When,afterthisreprimand,sherantoMatinsshesawChristinthedoorwayofthechurch,andshenursedfromhisside.54Philipof ClairvauxcombineswithhisdiscussionofElizabethofSpalbeek'sinediatheinformationthat"neithersalivanorsputumemanatedfromhermouthnoranymucusor otherfluidfromhernostrils."55Itisexactlyinthosevitaethatstressbothwomen'sexudingsandthelactatingChristthatunusualclosurealsocomesinforspecial attention. ExudingcuringfluidisparticularlyathemeinThomasofCantimpr'swritings.56Hetellsus,forexample,thatChristinatheAstonishingfledintotheremotedesert, whereshebecameveryhungry.Sosheprayed,andGodmadehervirginbreastsswellwithmilk,fromwhichshefedherselffornineweeks.Later,whenshewas persecutedbysistersandfriendswhothoughthermadandchainedherinthecellar,herbreastsfilledagainandranwithoil.Whentheoilprovedacuringsalve


thathealed,amongotherills,thesoresofoneofhersisters,hertormentorsreleasedherfromthecellar.57 AnotherofThomas'sheroines,Lutgard,alsoexudedoil,althoughinhercaseitcamefromthefingertips.Theincidentispresentedasherresponsetothevision (discussedabove)inwhichJohntheEvangelistdrankfromChrist'sbreastandthenbreathedintohermouth.LutgardrepeatedlynursedfromChristandsawothersdo so.Ononeoccasion,afterChrist(intheformofalamb)suckedfromherlips,hervoicebecamemoresolemnandwiseonanotheroccasion,aftershehadnursed fromChrist'sbreast,herownsalivabecamesweettothetaste.58Hercharacteristiccureswereperformedbytouchorsaliva."Thosewhohadillnessinhandorfoot orothermemberswerecuredatoncebycontactwithherhandorhersaliva,"Thomassays."Butthisdrewmanypeopletoher,andsheaskedGodtotake[thegift] away."59 JamesofVitry'sbiographyofMaryofOigniesreflectsasimilarconcernwithmiraculousfluids.JamesrecountsthatMarythoughtshesawmilk(notoil)flowingfrom relicsonanaltardedicatedtoNicholasofMyra,themostfamousmedievalmyroblyte.60Alaterbeguineandstigmatic,GertrudevanOostenwhodisplayedso ferventadevotiontotheinfantJesusthatthedevilsometimesappearedtoherasacryingchildfoundthatherbreastsfilledwithmilkwhenshemeditatedonthe Nativity.61Moreover,unusualbleeding(incontrastwiththeordinarybleedingofmenstruation)wasasignofholinessinmanyoftheseLowCountryvitae.Idaof Louvain,IdaofLau,MaryofOignies,Lutgard,andBeatriceofNazarethallsufferedviolentnosebleedsduringeucharisticecstasies,andtheirhagiographerssawthe bleedingasasignofmysticalfavors.Lutgard'svariousbiographersreportthatevenherhairdrippedwithbloodwhencut.62Notonlydothehagiographersattribute stigmatatoseveralofthesewomentheyalsoclaim,inthecasesofElizabethofSpalbeekandGertrudevanOosten,thatthewoundsbledinaperiodicpattern. Holywomencontinuedtofeedothersmiraculouslyfrombeyondthegrave.Indeed,indeaththeysometimesachievedaquasisacerdotalfeedingroledeniedtothemin life.Bythelatetwelfthcentury,womenwereprohibitednotonlyfromordinationbutevenfromcontactwithaltarvesselsbythelatethirteenthcentury,laypeople weredeniedthechalice.Yetafterdeathholywomenoccasionallyreappearedinvisionstooffer


communionandtheyappearedtomenaswellastowomen.AfterMaryofOignies'sdeathshecametoaCistercianmonk,and,Jamestellsus,agoldenchalicethat issuedfromhermouthgavedrinktotwoofthemonk'sfriends.63JulianaofCornillonwasseenafterherdeathassistingChristwiththecupatthealtar.Thewoman whoreceivedthisvisionwascuredofagreatdesireforfoodanddrink"whichtheweaknessofthefleshhadgivenher"andfeltherself"inebriated"with"spiritual refreshment"sothatshedidnotneedtodrinkwine.64Althoughmalebiographersmayhaveoveremphasizedtheimportanceofwomensaintstomalefollowers,while neglectingtheirimpactonotherwomen,65suchvisionsmakeitclearthatholywomenservedbothmalesandfemalesbytheirfastingandbytheirfeeding.Thevisions alsodemonstratetheextenttowhichbothmenandwomeninthethirteenthcenturyassociatedwomenwithfeedingandwithfood. TwohundredyearsafterMaryofOigniesandmorethanahundredyearsaftertheFlemishholywomenIdaofLauandIdaofLouvain,apoorlaywomaninwhatis nowHollandgainedbothrespectandnotorietyforaverysimilartypeoffemalespirituality.InthestoryofLidwinaofSchiedam,whodiedin1433attheageoffifty three,suchthemesascharitablefooddistribution,feedingmiraclesandvisions,fastandillness,miraculouslysweetbodilyeffluvia,andeucharisticdevotionaretightly interwoven.66AsinthelivesofMaryofOignies,LutgardofAywires,andIdaofLouvain,foodisclearlythedominantfactandthedominantsymbolinLidwina'slife. SeveralhagiographicalaccountsofLidwinaexist,incorporatinginformationprovidedbyherconfessors67moreover,thetownofficialsofSchiedam,whohadher watchedforthreemonths,promulgatedadocumentthatsurvives.SuggestingthatLidwina'smiraculousabstinencewastheaspectofherlifethatmostcapturedpublic attention,thedocumentsolemnlyatteststohercompletelackoffoodandsleepandtothesweetodorgivenoffbythebitsofskin,bone,andentrailsshesupposedly shed.68HerbiographersalsoreportthatPhilipofBurgundy'ssoldiers,whileoccupyingthecity,setaguardaroundLidwinatotestherfasts,whichtheythen authenticated.69OnanotheroccasionfoursoldiersofthesamePhilipbrokeintoherhouse,seriouslyinjuredherniece,andridiculedandabusedLidwina,claimingthat herswollenbodywaspregnantbythelocalpriest.70Theincidentcorroboratestheimpressionthatherprolongedsurvivalinextremeillnessandwithouteatingwas what


mostattractedcontemporaryadmiration,makingenemiesofhercityfearthepowerofherprayers. TheaccountsofLidwina'slifesuggestthattheremayhavebeenearlyconflictbetweenmotheranddaughter.Whenherterribleillnessputaburdenonthefamily's resourcesandpatience,ittookamiracletoconvincehermotherofhersanctity.71Oneofthefewstoriesthatsurvivefromherchildhoodshowshermotherannoyed withherchildishdawdling.Lidwina,whowasrequiredtocarryfoodtoherbrothersatschool,slippedintochurchonthewayhometosayaprayertotheVirgin.The incidentshowshowgirlishpietycouldprovidearespitefromhouseholdtasksinthiscase,asinsomanycases,thetaskoffeedingmen.72WealsolearnthatLidwina wasupsettodiscoverthatshewaspretty,thatshethreatenedtoprayforadeformitywhenplanswerebroachedforhermarriage(herehermotherdefendedher),and that,afteranillnessatagefifteen,shegrewweakanddidnotwanttogetupfromhersickbed.Theaccountthussuggeststhatshemayhavebeencultivatingillness perhapsevenrejectingfoodbeforetheskatingaccidentsomeweekslaterthatproducedsevereinternalinjuries.Inanyevent,Lidwinaneverrecoveredfromherfall ontheice.Herhagiographersreportthatshewasparalyzedexceptforherlefthand.Sheburnedwithfeverandvomitedconvulsively.Herbodyputrefiedsothatgreat piecesfelloff.Frommouth,ears,andnoseshepouredblood.Andshestoppedeating.73 Lidwina'shagiographersgointoconsiderabledetailaboutherabstinence.Atfirstshesupposedlyatealittlepieceofappleeachday,althoughswallowingbreaddipped intoliquidcausedhermuchpain.Thenshereducedherintaketoabitofdateandwateredwineflavoredwithspiceslatershesurvivedonwateredwinealoneonly halfapintaweekandshepreferredriverwatercontaminatedwithsaltfromthetides.Whenshestoppedtakinganysolidfood,shealsostoppedsleeping.Finally sheceasedtoswallowanythingatall.74AlthoughLidwina'sbiographerspresentherabstinenceasevidenceofsaintliness,shewassuspectedbysomeduringher lifetimeofbeingpossessedbyadevilinsteadsheherselfseemstohaveclaimedthatherfastingwasnatural.Whenpeopleaccusedherofhypocrisybecauseshefound joyinherillness,sherepliedthatitisnosintoeatandthereforenoglorytobeincapableofeating.75 FastingandillnesswerethusasinglephenomenontoLidwina.Andsincesheperceivedthemasredemptivesuffering,sheurgedbothon


others.WearetoldthatacertainGerardfromCologne,atherurging,becameahermitandlivedinatree,fedonlyonmannasentfromGod.76Wearealsotoldthat LidwinaprayedforhertwelveyearoldnephewtobeafflictedwithanillnesssothathewouldberemindedofGod'smercy.Notsurprisingly,theillnessitselfthen camefrommiraculousfeeding.ThenephewbecamesickafterdrinkingseveraldropsfromapitcherofnewbeeronatablebyLidwina'sbedsidebeerthathad overnightbecomemarvelouslyaromaticandsweet.77 Likethebodiesofmanyotherwomensaints(suchasChristinatheAstonishingandLutgard),Lidwina'sbodywasclosedtoordinaryintakeandexcretionbut producedextraordinaryeffluvia.78TheauthenticatingdocumentfromthetownofficialsofSchiedamtestifiesthatsheshedskin,bones,andevenportionsofintestines, whichherparentskeptinavaseandthesegaveoffasweetodoruntilLidwina,worriedbythegossiptheyexcited,insistedthathermotherburythem.ThusLidwina's bodyshedholypiecesexactlyasdidthebodyofChrist,whichonceleftbehindamiraculoushostafterappearinginavision.79Moreover,Lidwina'seffluviacured others.AmaninEnglandsupposedlysentforthewatershewashedherhandsintocurehisdiseasedleg.80Thesweetsmellfromherlefthandledoneofher confessorstoconfesshisownsins.81 Lidwinaevennursedothers,inanactthatsheherselfexplicitlysawasanalogoustotheVirgin'snursingofChrist.82OneChristmasseason,allherhagiographerstell us,acertainwidowCatherine,whotookcareofher,hadavisionthatLidwina'sbreastswouldfillwithmilk,likeMary's,onthenightoftheNativity.Whenshetold Lidwina,Lidwinawarnedhertoprepareherself.ThenLidwinasawavisionofMarysurroundedbyahostoffemalevirginsandthebreastsofMaryandofallthe companyfilledwithmilkthatpouredoutfromtheiropentunics,fillingthesky.WhenCatherineenteredLidwina'sroom,Lidwinarubbedherownbreastandthemilk cameoutandCatherinedrankthreetimesandwassatisfied(nordidshewantanycorporealfoodformanydaysthereafter).83OneofLidwina'sbiographersadds thatwhenthesamegracewasgiventoheragain,shefedherconfessor,JohnWalter84buttheothertwohagiographicalaccountssaythattheconfessorwasnotthere attheappointedhouranddidnotreceivethegift. Lidwinaalsofedothersbycharityandbyfoodmultiplicationmiracles.Althoughshedidnotherselfeat,shechargedthewidowCatherinetobuyfinefishandmake fragrantsaucesandtogivethesetothepoor.


Themeatandfishshegaveasalmssometimeswentmuchfurtherthananyonehadexpected.85Shegavewater,wine,andmoneyforbeertoanepilepticburningwith thirstshesentawholeporkshouldertoapoorman'sfamilysheregularlysentfoodtopoororsickchildren,forcingherservantstouseforothersmoneyorfoodshe wouldnotherselfconsume.86Whenshesharedthewineinherbedsidejug,itseemedinexhaustible.SopleasedwasGodwithhercharitythathesentheravisionofa heavenlybanquettableladenwiththefoodshehadgivenaway.87 LidwinaclearlyfeltthathersufferingwasservicethatitwasonewithChrist'ssufferingandthatitthereforesubstitutedforthesufferingofothers,boththeirbodilyills andtheirtimeinpurgatory.Indeed,accordingtoatleastoneofherhagiographers,herbodyquiteliterallybecameChrist'smaceratedandsavingflesh,for,likeIdaof Louvain,shereceivedstigmata.88JohnBrugman,intheVitaposterior,notonlyunderlinestheparallelbetweenLidwina'swoundsandthoseonthemiraculous bleedinghostshereceivedhealsostatesexplicitlythatinherstigmata,Christ''transformedhisloverintohislikeness."89Herhagiographerstellusthatthefeversshe sufferedalmostdailyformanyyearsbeforeherdeathreleasedsoulsfrompurgatory.90Thisnotionofsubstitutionisreflectedquiteclearlyinthestoryofanevilmanin whosesteadLidwinamadeconfessionshethentookuponherselfhispunishmenttotheincrementofherownbodilyanguish.91Weseesubstitutionofanotherkindin thestoryofLidwinatakingoverthetoothacheofawomanwhowailedoutsideherdoor.92 Thus,inLidwina'sstory,fasting,illness,feeding,andsufferingfuse.Lidwinabecomesthefoodsherejects.Herbody,closedtoordinaryintakeandexcretionbut spillingoverinmilkandsweetputrefaction,becomesthesustenanceandthecurebothheavenlyandearthlyofherfollowers. ButholyeatingisathemeinLidwina'slifeaswell.Theeucharistwasatthecoreofherdevotion.Duringherpatheticfinalyears,whenshewasalmostunableto swallow,shereceivedfrequentcommunion(asoftenaseverytwodays).Herbiographersemphasizethatduringthisperiod,onlytheholyfoodkeptheralive.93But formuchofherlifeshewasembroiledinconflictwiththelocalclergyoverhereucharisticvisionsandhunger.Oneincidentinparticularshowsnotonlytheimportance ofChrist'sbodyasfoodinLidwina'sspiritualitybutalsotheway


inwhichawoman'scravingforthehost,althoughitkeptherunderthecontroloftheclergy,couldseemtothatsameclergyathreatbothbecauseitcriticizedtheir behaviorandbecauseifthwarted,itcouldbypasstheirpower.94 OnceanangelcametoLidwinaandwarnedherthatthenextdaythepriestwouldbringheranunconsecratedhosttotesther.Thenthepriestcameandpretendedto adorethehost,butLidwina,whenshereceivedit,vomiteditout,declaringthatshecouldeasilytelltheLord'sbodyfromunconsecratedbread.Thepriestsworethat thehostwasconsecrated,however,andreturnedangrilytothechurch.Lidwinathenlanguishedforalongtime,cravingcommunionbutunabletoreceiveit.About threeandahalfmonthslater,Christappearedtoher,firstasababy,thenasableedingandsufferingyouth.Angelsappeared,bearingtheinstrumentsofthePassion, andthen(accordingtoonehagiographer)raysfromChrist'swoundedbodypiercedLidwinawithstigmata.Whenshesubsequentlyaskedforasign,ahosthovered overChrist'sheadandanapkindescendedontoherbed,containingamiraculoushostmarkedwithdropsofblood,whichremainedandwasseenbymanypeoplefor daysthereafter.95ThepriestreturnedandorderedLidwinatokeepquietaboutthemiraclebutfinallyagreed,atherinsistence,tofeedherthemiraculoushostas communion.LidwinawasconvincedthatitwastrulyChristbecauseshe,whowasusuallystifledbyfood,atethisbreadwithoutpain.Thenextdaythepriestpreached inchurchthatLidwinawasdeludedandthatherhostwasafraudofthedevil.But,heclaimed,Christwaspresentinthebreadheofferedbecauseitwasconsecrated withallthemajestyofthepriesthood.Lidwinaprotestedhisinterpretationofherhost,butsheagreedtoacceptaconsecratedwaferfromhimandtoprayforhissins. SubsequentlythepriestclaimedthathehadcuredLidwinafrompossessionbythedevil,whileLidwina'ssupporterscalledherhostamiracle.AlthoughLidwina's hagiographersdonotgivethefulldetails,theyclaimthatthebishopcametoinvestigatethematter,thatheblessedthenapkinfortheserviceofthealtar,andthatthe priesthenceforthgaveLidwinathesacramentwithouttestsorresistance. Asthestoryworksitswayout,itsthemeisnotsubversiveofclericalauthority.Theconflictbegins,afterall,becauseLidwinawantsaconsecratedhost,anditresultsin herreceivingfrequentcommunion,humblyandpiously.Accordingtooneofherhagiographers,themoralofthestoryisthatthefaithfulcanalwayssubstitute"spiritual communion"


(i.e.,meditation)iftheactualhostisnotgiven.96Butthestoryhasradicalimplicationsaswell.ItsuggeststhatJesuscancomedirectlytothefaithfulifpriestsare negligentorskeptical,thatapriest'swordmaynotbeauthoritativeonthedifferencebetweendemonicpossessionandsanctity,thatvisionarywomenmighttestpriests. OtherstoriesinLidwina'slifehavesimilarimplications.Sheforbadeasinningpriesttocelebratemassshereadtheheartofanotherpriestandlearnedofhis adultery.97Hervisionsofsoulsinpurgatoryespeciallyconcernedpriests,andshesubstitutedhersufferingsfortheirs.98OneAshWednesdayanangelbroughtashes forherforeheadbeforethepriestarrived.99EvenifLidwinadidnotrejecttheclergy,shesometimesquietlybypassedorjudgedthem. LidwinafocusedherloveofGodontheeucharist.Inreceivingit,invisionandcommunion,shebecameonewiththebodyonthecross.EatingherGod,shereceived hiswoundsandofferedhersufferingforthesalvationoftheworld.Denyingherselfordinaryfood,shesentthatfoodtoothersandherbodygavemilktonurseher friends.FoodisthebasicthemeinLidwina'sstoryselfasfoodandGodasfood.ForLidwina,asforthemanyFlemishholywomenbeforeher,eatingandnoteating werethus,finally,onetheme.BothfastingandeatingthebrokenbodyofChristwereactsofsuffering.Andtosufferwastosaveandbesaved. FranceandGermany ThevariousvitaeofLidwinaofSchiedamdonotshowthepiouswomancollectingalargenumberofdisciples,maleorfemale.100Indeed,Lidwinahadfewparallels orimitatorsinherownregion,eitherinherdayoroverthenexthundredyears.ButifweturnfromtheLowCountriestotherestofEurope,wefindthatfood metaphors,foodmiracles,andfoodpracticescharacterizedthelivesofwomensaintswellintothesixteenthcentury.Despitethesuggestionofrecentscholarsthatthe natureoffemalesanctitychangedbetween1200and1500anddisplayeddifferentpatternsinnorthandsouth,thethemesfoundinLowCountryspirituality,from MaryofOigniestoLidwinaofSchiedam,echothroughoutfourteenthandfifteenthcenturyEurope. Femalerolesdiffered,tobesure,accordingtoregionandperiod.Somewomen,especiallyItalianlaywomenandtertiaries,centeredtheir


livesonactivecharity,whereasothers,usuallynorthernnunsorrecluses,centeredtheirsonecstasyandprayer.Butfoodassymbolandasfactremainedcrucialin boththeseroles,inallregionsandinallperiods.Tothemorecontemplativenun,fastingandillness(thetwowerefrequentlyindistinguishable)werepreparationand occasionformysticalunion,forbeingfedbyChrist.Forthoseinwhoselivesservingwasmoreimportant,fastingandeucharistweretheselfdenialandself replenishmentthatmadethefeedingofotherspossible.Moreover,asthelifeofLidwinaofSchiedamsuggests,thetworolesweresometimesnotsodifferentafterall. AliceofSchaerbeke,languishinginhercellwithleprosy,andLutgardofAywires,fleeingfromcrowds,wereclearlycontemplatives,whileMaryofOigniesleda moreactivelife,nursingthesickandbegging.ButLidwina,lyingparalyzedonherbedandofteninecstasy,orderedmuchfoodsenttothepoorandsawhersuffering asservice.EvenMaryofOigniesandLutgardcombinedecstasyandcuring. Withdrawalandaction,prayerandservice,thustendedtofuseasvaluesinwomen'slives,despitetheirvaryinginstitutionalframeworksandemphases.Andfoodwas acentralmetaphorforthisfusion.Tomedievalwomen,"feeding"wasabasicreligiouscommitment,atransitiveandanintransitiveverb.Medievalwomenfedothers (pascere)theyalsofedonGod(pasci).IfwesurveysomeofthemanystoriesofFrenchandGermanholywomenfromthethirteenthtothefifteenthcentury,itis easytoseethatfoodthemesareasprominentthereastheyareinthelivesofMaryofOignies,LutgardofAywires,IdaofLouvain,andLidwinaofSchiedam.As prominent,andascomplicated.Here,too,eating,feeding,fasting,hungering,andbeingfoodfuseintoasinglethemeathemethatexpressesthewoman'sloveof neighborandloveofGod. EucharisticdevotionfigurescentrallyinawidevarietyofvitaefromGermanandFrenchspeakingareas,andtheecstasiesthateitheraccompaniedreceptionofthe hostorsubstitutedforitunderlineitsqualityasfood.Forexample,BeatriceofOrnacieux,whoseLifewasprobablywrittenbyMargaretofOingt(d.1310),received manyvisionsofChristinthehostattheelevation.101OneChristmas,whenshehadworkedherselfintoanagonizedfeelingofunworthinessbeforereceiving,acrumb ofthebreadremainedinhermouthandswelled,almostchokingher.Shewasunabletoeatforalongtimeafter.102ThenunsofTss,Unterlinden,andEngelthal, whosecollectivebiographiesorNonnenbcherwerecom


posedintheearlyfourteenthcentury,repeatedlyreceivedeucharisticvisions.ChristappearedtoasicknunatTssonaplatterasfood,andanothersicksisternursed atthebreastoftheVirginMary.103AnunatUnterlindensawChristinavisioncelebratingmassafterthecelebration,sheandallthesistersoftheconventwent forwardandreceivedthesacramentfromtheLord'sownhand.104AnunatEngelthaladdressedthebabyJesus,whoappearedinavision:"IfIhadyou,I'deatyou up,Iloveyousomuch."105AdelheidLangmann,alsoofEngelthal,thoughtshemarriedJesuswiththehostratherthanwithaweddingring.106Inanevenmore startlinguseoffoodimages,AdelheidalsoclaimedthatJesussaidtoherinseveralvisions:"Yourmouthtasteslikerosesandyourbodylikeviolets""Mysugarsweet andhoneysweetlove,mytenderone,mypureone,youaremineandIamyours."107 InmanyothervitaeofFrenchandGermanwomenfromthesameperiod,theeucharistservesasmarvelouslysustainingfood,replacingallothernurture.JaneMaryof Maill(d.1414),whofastedandpunishedherbody,issaidtohavelookedrosy,wellfed,andhappyaftercommunion,108whileFloraofBeaulieu(d.1347),after beingsplashedinavisionwiththeliquidfromagoldenchalice,wentfordayswithouteating.109Florafrequentlyexperiencedeucharisticecstasiesthatleftherunable towalkortoswallowsincesheassumedthatothersweresimilarlyaffectedbyreceivingorhandlingthehost,shemarveledthatanypriestcouldfailtoachieve mysticaldelightswhencelebratingmass.110ThemouthsofbothFloraandJaneMaryofMaillfilledmiraculouslywithChrist.JaneMaryfoundbloodinhermouth whensheprayedforadrinkfromthechaliceFlorareceivedaportionofthehostwhenthepriestwhowascelebratingdiscoveredthatithaddisappearedfromthe paten.111 ThepatternofeucharisticfoodarrivingmiraculouslyandreplacingordinarynurtureisfoundthroughouttheremarkablevitaofLukardisofOberweimar(d.1309), whosestory,likethatofhercontemporary,IdaofLouvain,isdominatedbymotifsofofferingandreceivingfood.Inaseriesofvividvisions,Lukardiswas miraculouslyfedbyChristandMary.Christoften,wearetold,broughtherdeliciousdrinkwhenshewasthirsty.112Oncewhenshewastooweaktogotothechapel tomeditate,shehadherselfcarriedtherebytwosisterswhenthedoorwasclosedMaryappeared,nursingJesus,andsaid,"Askforwhatyoudesire.""Seeingyouis enough,"repliedLukardis.ButMaryinsisted.SoLukardisansweredthatshewishedtobefedfromMary'sbreast.After


shewasthusfed,"Lukardislayinherbedforthreedaysandnightswithouttakingfoodordrinkorseeingthelightofthesky.Forshelayasifdead,butherfacewas ruddy."113 Onanotheroccasion,afterLukardishadfastedseverely,Christappearedasabeautifulyouthandblewintohermouth."Shewasinfusedwithsuchsweetnessand suchinnerfruitionthatshefeltasifdrunk"andonceagaincouldnoteatforthreedays.114Onyetanotheroccasion,whenLukardiswasintheinfirmaryatEaster,her desirefortheeucharistgrewandgrew.Asistersawherstruggleintothechoirandstandthere,movinghermouthasifchewing.Afterthemass,whenthepriorasked herifshewishedtocommunicate,shesignedthatshehadalreadydonesoandshecontinuedtochewallday.115FromcommunicatingeverySundayandfeastday, sheprogressed,atdivinecommand,tocommunicatingeveryFridayandeverydayinLentaswell.Whenseveralofhersistersmurmuredthatthiswasanunheardof innovation,wordcamethatanuninanothermonasteryhadreceivedavisionvindicatingLukardis'spractice.116 NotonlydidLukardisprepareforGodbyfastingandsuffering,receivehimpalpablyasfood,andfindordinarynourishmentunnecessaryaftershewasmiraculously filled,shealsofusedwithChristinafrenzyofpenitentialsuffering,andtheidentificationspilledoverintobothstigmataandfeedingmiracles.AsChristhadfedherwith hisbreath,soLukardisfedafellownunbybreathingtheeucharistintohermouth.117Lukardisalsofunctionedasspiritualadvisertoanunwhosufferedagoniesof indecisionaboutwhethershemightreceivecommunion.118Moreover,LukardisreceivedChrist'swoundsinwardlyinavision,andafterwardssheinducedvisible stigmatabycompulsivelydiggingherfingersintoherownflesh.119WhenalocalDominicanhadavisionofLukardisandtwoothersnailedtocrosses.Godtoldhim thatLukardiswastheonetobeidentifiedwithChrist."Theonewhosuffersmost[isgreatest],"Godsaid,"formyPassionbringsredemptiontothewholeworld."120 TothenunsofLukardis'sconvent,foodwassonaturalametaphorandmeansofgracethathealingandrevelationcouldbeexperiencedasahostblownfrommouth tomouth.OtherthirteenthandfourteenthcenturywomenalsoconsideredfoodandeatingbasicmetaphorsandevenmorethanmetaphorsforunionwithGod andserviceofneighbor.ThenunsoftheSaxonmonasteryofHelfta,forexample,thought


thatmanyoftheirsistersdrankfromJesus'sideorheartinecstasyandGertrudetheGreatsupposedlytooktheinfantChristtoherownbreastinseveralvisions.121 ThebeguineMechtildofMagdeburg,whotookrefugeatHelftainoldage,reflectsnotonlythetendencytodescribeunionineatingimagerybutalsotheconfidence, foundinLukardisandLidwinaaswell,thatGodwillfeedhisfollowersdirectlyifhumansfailtodoso.When,ononeoccasion,Mechtildlamented,"MustIbewithout massthisday?"shereceivedavisioninwhichJohntheBaptistcelebratedmassforher:

Thenthemaid[Mechtild]wentuptothealtarwithgreatloveandwidelyopenedsoul.JohntheBaptisttookthewhitelambwiththeredwoundsandlaiditonthemouthofthe maid.ThusthepureLamblaiditselfonitsownimageinthestallofherbodyandsuckedherheartwithitstenderlips.122

Mechtild,whoseownwordssurvive,althoughrearrangedbytranslators,sawherselftastingGodinmysticalunionandfeedingothersbyhersuffering.Shewroteof botheucharistandecstasyas"eatingGod."123ShecomposedalovelydialoguebetweenthesoulandthesensesinwhichthesensesurgedhertorestatMary'sknee, watchingtheangelsdrinkMary'smilkbutsherefused,turningtoJesus'bloodasthehigherfood.124Shespokeofherloveandhersufferingforsoulsinpurgatorynot justasfeedingbutasnursingfeedingwithherblood:"Imustgivethemmyheart'sbloodtodrink.IfIprayforthem,becauseoftheirgreatneedandseethebitterfate theymustsufferforeverysin,thenIsufferasamother."125Overandoveragain,insuchvisions,Christisfood,desireisinsatiablehungerorthirst,servingisfeeding ornursing,and(howeveroddthismayseemtomodernsensibilities)themouthisafundamentalwayofmeetingGod. IntheNonnenbcherandwomen'svitaeofthethirteenthtothefifteenthcentury,fasting(sometimesinducedbyillness,sometimesleadingtoit)wasclosely intertwinedwithheavenlyfeast.NoteatingwaspreparationforeucharistitwasalsorenunciationoftheworldandunionwiththeagonyofChrist'sredeemingdeath. Indeed,theauthorofthenuns'bookofUnterlindencalledfastingimitatioChristiandthegloryofthemartyrs.126SaintssuchasDoucelineofMarseilles(d.1274) andJaneMaryofMaillfastedasanaspectofeucharistdevotion.Doucelinewentintoecstasyeverytimeshereceivedcommunion,sawprayerasa


substituteforeating,andinavisionenteredthetabernacleto"taste"Christ'ssweetness.127JaneMary,whoconvincedherhusbandontheirweddingnighttoobserve chastity,sufferedpatientlyfromillnessintheearlyyearsofhermarriage.Afterherhusband'sdeathshecaredforthepoor"likeMartha,"sendingdelicaciesfromher tabletothesick,theold,andthepregnant,andfastedonbrownbreadanduncookedherbsuntilherbodywaspaleandskeletal.ButChristhimselfsummonedherto theeucharist,appearedinvisionswithhiswoundsallbleeding,changedwaterintowineforher,andkeptherrosyandbeautifulwithhimselfasfood.(Shelivedtobe eightytwo.)Hercharitablefeedingofotherswasrewardedwhenshefedanangelindisguise.128 ManyoftheFrenchandGermanvitae,likethosefromtheLowCountries,depictwomenwhoapparentlybecameunabletoeatnormally.AlpasofCudot,who supposedlylivedfortyyearsontheeucharistalone,beganher"fast"duringasevereillness(perhapsleprosy),inwhichsheswelledandstankandwasleftfordeadby herfamily.129CuredbyMary,whotoldherthatshewouldneverneedtoeatordrinkagain,Alpasafterwardstookonlytinybitsoffood,whichshechewedforthe juice,spittingoutthepulp.HerCistercianhagiographerunderlinedtheinterdependenceinherlifeofeucharisticfeastandbodilyfast,ofaclosedandshriveledearthly bodyandthe"fattening"ecstasiessentfromheaven.130Alpas,whowasparalyzed,clearlydevelopedphysicaldifficultiesinswallowingatonepointshewasacutely afraidoftakingevenawholehostintoherthroat,untilJohntheEvangelistcameinavisiontohelpher.131Althoughshesawherinediaasaninfirmity,sheclearly valueditasaspiritualgiftaswell,andshethoughtitwasatemptationofthedeviltodesireitcured.132Herchroniclersemphasizethefactthatherbody,whichearlier ranwithstinkingsores,closedupafterdeathherintestineswerealmostempty.133 Despite(andalsobymeansof)herbodilyagony,Alpasservedotherswithvisions,advice,andevenfood.Aninterestingaddendumtooneofthemanuscriptsofher vitasaysthatwhenthepriorofCudotbroughtherbitsofporktosucksheatethemallandwashorrifiedbyhergreed,forsheusuallysentwhatwasleftonhertable toanoldwomanintheneighborhoodwholackedeventhenecessitiesoflife.Thenextdayshesentalltheporkmorselstotheoldwomanandthatnightsawavision ofthedevilasacook,bearingfood.134Thesuggestioninthisstorythatasaintlyabstainermightlosecontrolandslip,almostagainstherwill,


intogluttonyfindsechoesinafewlaterlives(forexample,thoseofElsbetAchlerofReute[d.1420],CatherineofSiena,andColumbaofRieti)thatgiveevidenceof surreptitiousandcompulsivegorgingbyfemalefasters.135 Behindthelivesdiscussedhere,whethersharplyindividualizedliketheportraitofAlpasorstereotypedlikethenuns'bookfromTss,wefindacommonpattern.Like outcroppingsofrockthatmaytakedifferingandsometimestwistedformsbutarebuiltonthesamecrystallinestructure,thesestorieshaveaunifyingthemebehindtheir flamboyantvarietyofdetail.Inthem,Godisfoodandselfisfood.ThecommunicationofGodtohumanityandthegivingofoneselftoanotherthroughsufferingor serviceisunderstoodas"feeding"animpartingoffleshthatnurturesasitisconsumed.Suchacomplicatedexchangeoffleshrequiresfastingfromordinaryfoodas thestandardprerequisite.Thusclosingandopening,abstainingandeating,arethebasicpatternsorganizingsuchnarrativesandsuchlives. ThiscommoncrystallinestructureunderliesthestoriesoffourofthegreatestreligiouswomenofthenorthofEuropeElizabethofHungaryorThuringia,Margaretof Hungary(d.1270or1271),DorothyofMontau,andColetteofCorbie.Toallfour,obsessivefasting,accompaniedbysleeplessnessandfreneticactivity,becamea focalpointofpiety.Allfourstruggledforcontrolovertheirvocations.Allfourfedothers.Yetdespitethelargeamountofscholarshipdevotedtotheirlives,the commonpatternhasgoneunnoticed.Itwillthereforebeusefultotakeafewparagraphstotelltheirstories. ThelifeofElizabethofHungary,marriedatfourteentothesonofthedukeofThuringiaandwidowedattwenty,hasbecomesoencrustedwithlegendthatitishardto decipher.136Theimportanceofhersternconfessor,ConradofMarburg,ininducingherobsessionwithfoodisimpossibletoassessatthisdistance.137Itisclear, however,thatshefeltintenseguiltaboutherhusband'swealthandprobablyaboutherloveforhimaswell.Itisalsoclearthatsheceasedeatingthefoodfromher husband'stableforfearithadbeenacquiredimmorallyandthatshehidheracutefasting,crumblingherbreadtomakeitappearshehadeatenandspendingherdowry tobuyalittleuntaintedfoodforherselfandherservants.Onceshetookthehabitofatertiary,sheperformedextremefastswhilecookingforandservingothers. Throughoutherlife


shecompulsivelygaveawayfood.138Afterdeath,herbodyoozedhealingoil.139Thestoriesanddescriptionsthataccumulatedaroundhereventhosethatare clearlyapocryphal(likethelegendofbreadturnedtoroses)stressedherfooddistributiontothepoorandhermotherly"nourishing"ofhersons,thefriars.140 Anotherroyalsaint,MargaretofHungary,anunfromgirlhoodwhoferociouslyrefusedoffersofmarriage,141practicedsimilarfoodasceticism.Shetoowasfreneticin theserviceofothers,evencleaninglatrinesandcarryingtheexcrementandvomitfromseriouslyillnuns.142Toavoideating,Margaretseveraltimesservedhersisters atthebeginningofthemeal,escapedtothechapeltopray,andreturnedtoservethemagain143shefrequentlycoveredherfacewithaclothduringmeals.144Shehid herownillnesses,lestshebesenttotheinfirmaryandofferedmeat,andherbodywasso"emaciatedandpale"fromfastingthatallmarveled.145Yetsheinsistedon cookingforothers,freezingherhandsincoldwaterandcuttingthemonfishscales,andshewentintoecstasyatcommunion,remainingforhoursafterwardinthe churchandrefusingordinaryfood.146Moreover,herbodyitself,whichsherefusedtowashorcarefor,curedthesick.Washwaterfromherhair,whenheldinthe mouthorswallowed,curedillsistersandevenabrotherinanothermonastery.147 ThelaywomanDorothyofMontau(orPrussia),whosefoodasceticismbeganearlyandbroughtherintosevereconflictwithhermother,148feltagoniesofguiltover enjoyingthreesmallfishes,developednauseaatthesightorsmelloffood,atesolittlesheceasedexcreting,andwouldhavegonewithoutfoodentirelyatonepointin herlifehadnotherconfessorintervened.149Shewaspassionatelydevotedtotheeucharist,aroundwhichhermostelaboratevisionsandimagesclustered,andshe developedakindofmysticalpregnancyorswellinginpreparationforcommunion.150Anxioustobefreeofherhusbandandhousework,sheenjoyedbegging,and onecannothelpsuspectingthatamongitsattractionswasthefactthat,likeherfrequenttrances,itrelievedherofthejobofpreparingfood.151Oneofherhusband's fiercecomplaintswasthatwhileshewasinecstasysheforgottoshop,orcookedtheeveningmealwithoutscalingthefishorcleaningthevegetables.152Her descriptionsofeucharistictrances,writtendownbyherconfessor,JohnMarienwerder,notonlymentionsensibleeffectssuchasvisionsofChristbleedingonthecross orofferingaheavenlybanquet,153theyalsomakeitclearthatshesawtheagonyofactualhungerforthehostasanecessaryprepara


Thosepeoplewhoreceiveme[inthehost]becauseitiscustomarytodosoorinordertowinfavororpraisefromothersreceivegreatdamnationintakingme,fortheydonothave theintensedesireoflove.IndeedIjustsaidtoyouthathewhodoesnothungerformybody...doesnotreallydesireeternallife.Foritisnecessarythatmanclamorandlaborfor me,thathewailaloudeitherhereinthisworldorinpurgatory.Andyoumusthaveforme,beforeconsumingthesacrament,agreatlaborandhungerandafternoon[i.e.,afterthe mass],youmusthaveagreathungerandlaborforeternallife....Hewhodoesnothungergreatlyformewillnotbefilledbymenorhavedelightinme.Forhowcananyonehave sweetnessanddelectationinthatfoodwhohasnothungeredforit?Andhowcanhebesatiatedandcontentedfromfoodinwhichhehasnotplacedallhishopeofdelight?154

Often,indeed,becauseofthefrenzy[aestus]ofthisdesireshewasnotabletoprayherheartgrievedsothatitseemedtoherasifshewantedtodieifshewasnotpermittedto receivethesacramentonthatday.Sometimes...shecouldhardlystandorwalk....Often...sheremainedinbedasifoppressedwithagraveillness.[SoGodorderedher confessortogivehercommunionthreetimesaweek.]...Butherdesirewasnotsatisfiedbythisfornowshehungeredinsuchintensedesireanddestitutionofallstrengththatit appearedtoherthatshecouldneverexpressherhungeroracceptintohermouthanycorporealfood....Andthisdesiregrewnightandday.155

Indeed,Dorothyfrequentlytoyedwiththeideaofextendingherexcruciatingfaststothehostitselffordespitehercravingfortheeucharist,sheexperienced overwhelmingsensationsofunworthinessandhadtobereassuredrepeatedlybyChristthathedesiredhertopartakeofthepreciousfoodofhisbody.156 OnefinalstoryfromthenorthofEuropeunderlineshowcentralfoodmotifshadbecomeinwomen'slivesbythefifteenthcentury.ColetteofCorbiewasfirstahermit andthentheinfluentialreformeroftheClares.157Shetraveledfrommonasterytomonasteryworkingforstrictobservanceandevenwithmalesupportdabbledin papalpolitics.ShewasanexactcontemporaryofLidwinaofSchiedam,whodiedin


1433attheageoffiftythree,and,aswithLidwina,theseveralsurvivingvitaeseemtobeembroideredwithcertainthemesthathagiographersandreadersconsidered appropriatetofemalesaints.158LikeLidwina,Colettesupposedlywentforlongperiodsoftimewithouteatingorsleeping.Herhagiographer,PeterofVaux, commentsproudlythatshe''wentbeyondtheFathers,"forshespentfortydaysandnightswithoutfoodordrink,"somethingthatisimpossibleoragainstnature...but notimpossibletooragainstGod."159LikeLidwina,Coletteexperiencedeucharisticecstasies.Likeherfastingcontemporary,shesupposedlyreceivedstigmata.160 AcopyofColette'sownexhortationtohernunssurvives.Whileitmentionsfastingamongothersevereausterities,itlaysnoparticularstressonfoodasceticism.161 Butinthehagiographicalaccounts,foodisacentraltheme.Colettesupposedlybegantofastasachild,givingawayherdinnertootherschoolchildren,runningfrom thefamilytabletowelcomebeggarsatthedoorandpressthemtoacceptherfood.Fromgirlhoodsheatenomeat.Throughoutherlifeshesentfoodfromhertableto thoseinthesurroundingcityandcountryside,andsometimesshemiraculouslymultipliedfoodorwineforhermonasteries.162Moreover,sheeffectedcureswithfood, puttingbreadshehadchewedintothemouthsoftwosicksistersor,onanotheroccasion,curingwithacrumbofbread.163Herkisshealedalepershewascuredby receivingtheVirgin'skissinavisionasicknunonceclaimedthatsherecoveredbecauseColetteappearedtoherinavisionandofferedhera"beautifulfruit"to eat.164Colettehealedanotherwomanbyblowingoverthewoman'scancerousfacewatershehadheldinhermouth.165Duringherlifetimeshecuredanunwho, possessedbythedevil,sufferedaterribleboutofbodilyrigidityandcouldnoteatordrink.166Afterherdeathwaterfromherrelicssupposedlyhealedawomanwho hadscarcelyeatenforthirteenyears.(Asadditionalevidenceoftheimportanceoffoodritualsinthisculture,weshouldnotethatthecuredwomanherselffirst acceptedthefoodoftheeucharistandthenfastedinthanksgivingforherrecovery.)167Colette'sbiographerstressesthatshenevermenstruated,"aspecialgracenot heardofinothers,"andthatbothinlifeandindeathherbodygaveoffonlysweetodors.168 SoimportantwastheeucharistinColette'spietythatsheheardmasseverydayandcommunicatedfrequentlybutshepreferredtodosoinprivatebecauseshecould notcontrolherweepingandtrances,anda


crowdoftengatheredtogawk.ShefrequentlysawChristinvisionsattheelevationandsometimes,outofreverenceandfrenzy,shewasalmostunabletoswallowthe host.Shecouldnoteataftermassandoftenremainedraptinecstasyformanyhours.169Once,whenthepriestfilledthechalicewithwaterbymistake,sheknewthat Godwasnotpresentatthemomentofconsecration.Onanotheroccasion,whenthepriestforgottoconsecrateahostforher,Christbroughtthewaferwithhisown hand.Aminiatureofthisscene,paintedbetween1468and1477forMargaretofYork,wifeofCharlestheBoldofBurgundy,showshowsuchanimmediateand individualrelationshipbetweenGodandthesoulcouldseemtobypassclericalauthority(seeplate11).170Onanotheroccasion,ColettesawavisionoftheChrist childonadish,carveduplikeapieceofmeatafterwards,asshebroodedoverthehorrifyingvision,sheknewthatitrepresentedChrist'sreparationforoursins.171 Imitatingthismaceratedfleshinherownbody,shebeatandstarvedherselfandsometimesbrieflydisplayedonherbodythemarksofChrist'sPassion.172 ThustheactiveandforcefulreformerColette,likehermorepassiveandpitifulcontemporaryLidwina,notonlyfastedfromordinaryfood,shealsofeastedonheavenly food.Indeed,Colettebecamefood.Inherasceticismandhertrances,shewasthetorturedfleshofChrist'sbrokenbody,offeredupforsin.Andasshemoved amonghersistersoramongthepoor,shenurturedtheminanotherway,throughhercomfortingpresence.Withherownmouthsheprovidedfoodtohealtheilland needy. Toamodernsensibility,thereisagreatdifferencebetweeninnermeditationthatvisualizesGodinfoodimagesandwhatpsychologiststodaycallsomatizationthat is,manifestationsinone'sbodyofemotionalandspiritualreactions(suchasstigmata,sweetmucusinthemouth,feelingsofbeingfilledorstifled,orspontaneous exudingsofsweatormilk).ButtoaGertrude,aLukardis,oraFloraofBeaulieu,suchexperiencesweremerelydifferingpointsonacontinuumthatwasencounter withGod.Tomedievalpeople,MechtildofHackeborn'svisionofthecommunioncupasChrist'sheartwasnotsimplyapoeticimageofatheologicaltenet,173nor wasColette'sinabilitytoeataftercommunionsimplyabodilyresponsetomentalexcitement.Whatisstrikingformypurposesthereforeisthatwhethertheyare ineffableexperiencesdescribedinpoeticlanguage,visionsseenwiththeeyesof


thebody,orfullbodilymanifestationsthemeetingswithGodthatmedievalwomenreceivedwereofteneatings,tastings,andsavorings.Themouth(breathing, kissing,spitting,swallowing,andsucking)wasawayofunitingwithGodandservingneighbor.DesireforChristwasfeltinmind,soul,andentrailsasinsatiablehunger orthirst.Abstinencefromordinarysustenancewasnotsomuchagoalinitselfasatributetotheoverwhelmingsweetness,theexhilaratingpain,ofthemeatanddrink thatGodwas. Italy MorevitaeofwomensaintscomefromItalythanfromanyotherregioninthelaterMiddleAges.Perhapsforthisveryreason,asscholarssuchasVauchez,Petroff, Weinstein,andBellhaverecentlyemphasized,Italianlivesfallintoaconsistentandpredictablepattern.Theyplaceastrongemphasisoncharitableactivityinthe world,lacedwithmiracle.Theyarealsostronglymaleoriented:thesewomensaintsoftensimultaneouslydominateandaredominatedbytheconfessorswho eventuallywritetheirbiographies.Thus,incontrastwithLowCountrywomenofthethirteenthcenturyorGermannunsoftheearlyfourteenth,Italianfemalesaints seemtobemoreisolatedfromotherwomen,withoutthesupportoforganizedfemalecommunities.Yet,asinnorthernstories,theunderlyingcrystallinestructureis there.Afewexampleswillshowtheprominenceofeucharisticdevotion,foodasceticism,feedingmiracles,andfoodimagesintheseItalianlives. EucharisticpietyisasignificantthemeinthevitaeofGherardescaofPisa(d.1260or1267),MargaretofCortona,AngelaofFoligno,AldaofSiena(d.1310),Agnes ofMontepulciano,CatherineofSiena,RitaofCascia(d.midfifteenthcentury),ColumbaofRieti,andCatherineofGenoa.AlthoughearlierItalianvitae,suchasthose ofGherardescaandUmiltaofFaenza(d.1310)sometimesdepicttheeucharistascleansingwatermorethannourishingbloodandstressseeingovereating,women's storiesingeneralmaketheroleofChrist'sbodyandbloodasholyfoodveryclear.174MargaretofCortona,AngelaofFoligno,ColumbaofRieti,andCatherineof Genoa,forexample,cravedfrequentreceptionandsubstitutedtheeucharistquiteexplicitlyforthefoodtheydeniedthemselvesinlongfasts.175


MargaretofCortona,oneofthemostinterestingofwomensaintsbecauseofherlowlyorigins,wasdirectedbyChristtocenterherpietyindailycommunionshe focusedonthehostbothheragonizedsenseofunworthinessandherdesperateneedforJesus'speciallove.Shecravedreceptionbutwasoftentooterrifiedtogo forwardtoreceive.176Sheadoredpriests.Jesussupposedlysaidtoherinavision:

Daughter,Icomplaintoyoubitterlyabouttheirreverenceofpriestswhotouchmedailyinsuchgreatnumberswithoutknowingorlovingme.Foriftheytrulyknewmetheywould knowthatthereisnobeautyinthecreatedworldsimilartothatofthosepriestswhocelebrate.Andtheywouldnotcometotouchmewithpollutedhands.177

Margaretwasgiventhegiftofdetectingbytasteunconsecratedhostsorthoseconsecratedbyunworthyclerics.178Jesuswarnedherinavisionnotonlyto"clingto thebreastsofconsolation"buttojoinwiththesorrowsofthecrossaswell.Inanothervisionhesaidtoher:"Youwishtobemydaughterofmilkbutyouwillbemy daughterofpoison,becauseofthepainsyousuffer."179ShespokerepeatedlyofChristas"livingbread"andsawherselfasanexampletoothers,bothofabstinence fromearthlyfoodandofheavenlyeatinganeatingthatwasexperiencedsimultaneouslyassufferingandasjoy.180 OtherItalianwomenalsolookedtotheeucharistwithobsessiveconcentrationofpurposeandhope.AngelaofFolignoacontemporaryofMargaretwho,like Margaret,wasreleasedtofollowareligiouslifebythedeathofamandescribedthehostassweeterthananyotherfood.Shesaidshewouldhavelikedtokeepit onhertongueagreatwhilelonger,ifshehadnotheardthatonemustswallowitinstantly:

Shesaidthenthatsometimes,whenshemadecommunion,thehostexpandedinhermouthandshetastedneitherthebreadnorthe[ordinary]meatwhichweknow.Certainlyit hadthesavorofmeatbutwithacompletelydifferenttaste,which"Idonotknowhowtocomparetoanythingelseinthisworld."Itwentdownwithgreateaseandsweetnessand notwiththedifficultytowhichshewasaccustomed.Shesaidthatitsoftenedquicklyandwasnothardasitusuallywas.Andithadsuchsweetnessthat"hadInothearditsaid thatapersonoughttoswallowquicklyIwouldhavehelditfreelyinmymouthwithgreatdelay.ButatsuchtimesIremembersuddenlythatIoughttoswallowquickly,andthe bodyofChristgoesdownwholewiththatsavorofunknownmeat,nor

Page142 doIneedtodrinkanythingafterwards.ButthisdoesnotnormallyhappenandsoImakeagreateffortthatnocrumbofthehostremainsbetweenmyteeth.Butwhenitdoes descendinthisway,itgivesmeagreatfeelingofpeace.Andthisisdiscernedoutwardlyinmybody,becauseitmakesmetrembleviolently,sothatonlywithgreateffortamIable tograspthechalice."181

AngelarepeatedlyreferredtoChristas"ourfood"and"ourtable,"andinavisionsawhimputthefriarsofFoligno,her"sons,"intohisside,whencetheyemergedwith lipsrosyfromdrinkingblood.182OnanotheroccasionChristappearedtoherallbleedingandgaveherhiswoundtosucksheprayedtobeallowedtodrinkhis sufferinganddeathbutknewshewasnotworthytodieamartyr.183 ThevitaofAlda(orAldobrandesca)ofSiena,whichsurvivesonlyinasixteenthcenturyversion,showsasimilarconcernwiththeeucharistasnurturingblood.Inone ofhereucharisticvisions,AldatastedadropofbloodfromChrist'ssideonanotheroccasionthedropfellontohergirdleandshesuckeditoutwithhermouth.In honorofsuchvisions,Aldahadapicturepaintedthat,reversingtheusualimageofthenursingmadonna,showedMarydrinkingfromChrist'ssidewhileholdinghimin herarms.184 FoodasceticismisalsocommonintheseItaliantexts,asselfdiscipline,aspreparationforeucharist,orasunionwiththecross.MargaretofCortona,forexample, undertookextendedfastsandstruggledtoconquerthirst.Sherefusedtokeepforherselfmorethancrumbsfromherbegging,givingthewholeloavestothepoor.She spokeofhereffortstoeatlessandlessasawaragainstthebodyinwhichnotreatyofpeacewaspossible.185Sofixatedonfooddidhergreedandguiltbecomethat thedeviltorturedherwithphantasmsandodorsofdelicaciesshehadneverevenseen.186 Somewomen,suchasCatherineofSiena,CatherineofGenoa,andColumbaofRieti,quicklybecameunabletoeat.Villanade'Botti(d.1361),likeAngelaof Foligno,foundthatshelostherappetiteforcorporealfoodwhenshewaspraying.187RitaofCascia,whoinheryouthtriedtotameandexpiatetheviolenceofherill temperedhusbandbyfastsandserviceofthepoor,atehardlyatallinlaterlifeherreligiouscompanionsbelievedshewassustainedbyfrequentcommunion.188But otherwomenfoundhungerdifficulttoconquer.ClareGambacortaofPisa(d.1419),whomixedasheswithherfoodtospoilthetasteandate


onlythescrapsleftonothers'plates,hadtoinflictpainonherselftodivertherattentionfromheraching,growlingstomach.189 Abstinenceandeucharisticdevotionarenotmerelyincidentalthemesinthesetexts.Wecanseehowintegraltheyareandhowintegrallytiedonetotheotherin AngelaofFoligno'sBookoftheExperienceoftheTrueFaithfulorBookofDivineConsolation,which,althoughwrittendownbyherconfessor,frequently includesherownwords.190Thebooktreatsfoodinpartasasymbolofhumancorruption.WhenAngelawantedtodeclareherformerhypocrisypublicly,she proposedtoparadethroughthestreetswithrottingmeatandfishtiedaroundherneck.191WhenshebegantoreceivethecomfortofGod'spresence,shefound,she tellsus,thatshescarcelyneededtoeatatall.Sometimesshewishedthatshemightbereleasedentirelyfromfoodinordertorevelonlyinthesweetnessofprayerand eucharist.192 ButfoodwasmoretoAngelathansimplyasymbolofhumancorruption.FoodwasphysicalityandAngelaunderstoodChristtobesayingtoherinvisionaftervision thatshemustfusewith,notflee,thephysicalitythatsufferedandbledonthecross.SoAngeladecidedtorejectthe"temptation"bothtoexhibitherguiltinthe symbolismofrottingfoodandtoceaseeatinginordertodallywithChrist.193Shecametoseeherdesiretoparadethroughthestreetsasthesinofdespair.Shelater saidofthisepisode,inoneofherfewextantletters:
Iwantedtoputacordaroundmythroatandhavemyselfledthroughpublicplaces...whilepeoplejeered:"SeethegreatmiracleofGodhehasmademanifestalltheiniquities andevildeeds,thehypocriticalactsandsins,whichshekepthiddenthroughherwholelife."YouknowthatIwastheninsuchdesolationthatIdespairedcompletelyofGodand hisgiftsandenteredintostrugglewithhim.194

Angelacamethroughherdespairtoavisionoftruehumility.ShearguedthatChristvaluedmeeknessofheartmorethanthe"works"offasting,abstinence,and poverty.ShereportedthatJesussaidtoherinavision:"Yourwholelifeyoureatinganddrinkingandsleepingandeverythingyoudoinlivingispleasingtome[if youloveme],"andshewrote:

Ohmysons,listen....[Christ]didnotsay:"Learnfastingfromme"...nor"Learn...poverty..."nor"Learntoworkmiracles,"...buthesaidonlythis:"LearnfrommeforIam meekandhumbleofheart."

Page144 Fortrulyhemadethishumilityofheartandpropercomportmentofbodythefoundationandmostfirmrootofallvirtuesbecauseneitherabstinencenortheharshnessoffasting, norexternalpovertyandvileclothing...norvirtuosityinmiraclesisworthanythingwithouthumilityofheart.Butwhenfoundedonthisroot,blessedareabstinenceand harshnessandvileclothingblessedandlivingaresuchworks.195

Fromadichotomyinwhichhumanfoodwasnegativeanddivinefoodareplacement,Angelaseemstohavemovedtoanotionthatonemusteatthebloodofsuffering, afoodbothearthlyanddivine.Oncethecrisisofherconversionwasover,foodasceticismbecamelessimportantinherspirituality.Bloodanddrinkingwereher dominantimagesforencounterwithGod.TheeucharistshetookcametobenotsomuchareplacementforearthlyfoodasthedyingfleshofJesus,withwhichshe mergedininfinitesweetnessandinfinitesuffering.196Shetoldherconfessor:

Once,whenIwasatVespersandwascontemplatingthecrucifix,...suddenlymysoulwasliftedintolove,andallthemembersofmybodyfeltaverygreatjoy.AndIsawandfelt thatChrist,withinme,embracedmysoulwiththatarmbywhichhewascrucified...andIfeltsuchgreatsecuritythatIcouldnotdoubtitwasGodevenifallmentoldmeto doubt....SoIrejoicewhenIseethathand,whichheholdsoutwiththesignsofthenails,sayingtome:"BeholdwhatIboreforyou." NowIcanfeelnosadnessatthePassion...forallmyjoyisinthatsufferingGodMan.AnditseemstomysoulthatitenterswithinthatwoundinthesideofChristandwalks therewithdelight.197

Themomentofcommunionapproached....AndIwaspresent[withtheangels],asIhadasked....AndIsawhim,withtheeyesofthespirit,veryclearly,firstliving,fullof suffering,bloodyandcrucifiedandthen[Isawhim]deadonthecross.IfeltitIhadsolivelyasadnessatthepitifulsightthatmyheartseemedalmosttobreak.Butontheother handIfeltgreatdelightsandavastjoyatthepresenceoftheangels.198

Inherdaytodayactivities,Angela,likemanyotherItaliantertiaries,cametoexpressthisimitatiocrucisbyfeedingandcaringforthesick.199Heretoo,perhaps becauseshecaredfortheirbodiesasasubstituteforJesus'own,sheusedmetaphorsofeatingquiteliterally.LikeCatherineofSiena,whodrankpus,andCatherine ofGenoa,whoatelice,Angela


drankwaterthatcamefromwashingthesoresoflepers.Oneofthescabsstuckinherthroat,shesaid,andtasted"assweetascommunion."200 InmanyoftheotherItalianvitae,asinAngela's,abstinencefromfoodanddevotiontotheeucharistareconnectedtothefeedingandservingofotherseitherby charityorbymiracle.MargaretofCortonaservedasadvisertomanyafflictedlikeherselfwithscrupulosity.201Shecaredforthesick.Shedetectedandexcoriated corruptclergy.202Christhimselfcommandedhertobeanexampleofabstinence,fasting,andpatience.203UmiltofFaenzawhosepiety,likeMargaret's,was characterizedbyeucharisticdevotionandabstinenceperformedafoodmultiplicationmiraclethat,accordingtoherhagiographer,shelikenedtothegospelmiracleof theloavesandfishes.204Umilt'sdiscipleMargaretofFaenza(d.1330)miraculouslymadewateredwinesweetandmultipliedloavesforworkmenatthe monastery.205AldaofSienacuredthesickservedthepoor,especiallyinheroldagedistributedtheproducefromherfarmtothedestituteandtwicechangedwater intowine.206AgnesofMontepulcianosawherprayersrewardedwitharainofmannafromheaven,andasimilarshowerblessedaspringshevisited.207She frequentlymultipliedoil,wine,andbreadforhersistersandoncechangedmeatintofishtomakeitmoreappropriateLentenfare.208CatherineofSienaherself reportedthatGodenabledAgnesandeighteennunstosurviveforthreedaysongreensalone,afterwhichhehelpedAgnesfeedthesistersfortwomealsonfivelittle rolls.209AfterherdeathAgnes'sbodyexudedsweetoilfromhandsandfeet,andtheoileffectedmanycures.210 ThethemeofexudingappearsinseveralItalianvitae,asitdoesinthosefromtheLowCountriesandGermany.Flemishwomenweremoreapttoexudemilk,Italian andGermanwomenoilormannabutinvitaefromallregionsthethemeisclear.RitaofCascia,forexample,whoclosedherbodytoordinaryeating,developeda permanentlyrunningsoreonherforehead(supposedlymadebythecrownofthorns)afterdeathsheexudedasweetodor.211Inasimilarstory,wearetoldthat MargaretofCittdiCastelloexudedoilafterdeathshealsosupposedlyeffectedcuresthroughthreepreciousstonesfoundinherheartduringautopsy.212Thebody ofRoseofViterbo("mannalikesweetsmellingoil."213Whetheroil,milk,ormanna,theprecioussubstance exudedbythewoman'sbodywasusuallyseenascuringandfeeding.Moreover,theexudingofex


traordinaryfluidswasaccompaniedbyextraordinaryclosure.Awomanwhosebodywascommunicatedtootherswasusuallyawomanwhoherselfateonlythe specialfoodofGodtheeucharist. InItaly,asintheLowCountriesandFrance,thevitaeoflatefourteenthandfifteenthcenturyabstainersareoftenmoreelaboratethanthirteenthcenturytexts.Their extravagantdetailstendtosuggesttomodernreaderseitherpathologyonthepartoftheirsubjectsoruncontrolledimaginationonthepartoftheirauthors.Yetitis fromtheselatetextsthelivesofLidwina,Colette,andColumbaofRietithatwegetourclearestsenseofthecrystallinestructureunderlyingnotmerelythebehavior ofsaintlywomenbutalsotheexpectationsofordinarywomenandmen,whichshapedthatbehavior.ThusthesixteenthcenturyvitaofColumbaofRieti(d.1501) canserveasasummaryofthepatternwehavelearnedtorecognizeintextsfromtheprecedingperiod.214Strugglingtocontrolherenvironmentthroughfasting,like RitaofCasciaandDorothyofMontau,consumedwithdesirefortheeucharist,likeMargaretofCortonaandIdaofLouvain,givingawayeverything,likeMargaretof Hungary,andafflictedwithdiabolicalvisionsoffood,likeAlpas,ElsbetAchler,andAngelaofFolignoColumbaofRietistarvedherselftodeathattheageofthirty four. Columba'shagiographerbeginshisstorybyunderliningthethemeoffood.HesuggeststhatColumba'sfuturesanctitywasforeshadowedbyhermother'sabstinence fromallfoodanddrinkexceptgreens,vinegar,andwildgrapesduringherpregnancy.LikeRoseofViterbo'shagiographer,hepresentstheholygirlasabstainingwhile stillababyatthebreast.215Atagefive,hetellsus,Columbamadeherselfahairshirtandwasteasedbyhermother'sfriendsforrefusingtoeat.216 Columba'sfoodasceticismhadapparentlyledtoaconflictofwillswithhermotherevenbeforeherparentsdecidedtofindahusbandforher.Thatdecision precipitatedfurtherconflict,duringwhich,likeClareandCatherineofSiena,Columbacutoffherhair.217Aspartofthisstruggle,shebegantofasttwodaysaweek andfiveLentsayear,takingonlywaterandbreadorunripefruit.Shealsopracticedflagellationandsleepdeprivation,andshegaveawaysomuchfamilyfoodthather mothercametoheroncetosaythattherewasnothingtoeat,atwhichpointColumbaperformedafoodmultiplicationmiracle.Whenhermotherandherconfessor triedtoenticeherwithherbsorvegetables,shemixedashes,dirt,orwaterintothefoodtospoilthetaste.218Shefell


intotranceswhiledoinghousework,onceevendroppingababyintothefire.219Herharassedmotherexclaimed:"Youdespisedahusband,youneglectyour householdchores,andnowyouremainatleisureforyourownpleasure.Daughter,Isayyoumustwork."ButColumbasawavisionofJesus,whosaid,"Followme." ShereturnedtohersenseswithgaietyandpointedouttohermotherthatGod'scommandsoverridethoseofparents.220Throughoutherlifetheextravagantself denialcontinued,asdidthepassionateserviceofothersandthestubbornnessaboutdecidingforherself.Sheclearlylosttheabilitytodealnormallywithbodily sensationsand,althoughfeelinghorroroffoodanddrink,sometimesdrankvinegarorlickedthedirtydisheswaitingtobewashed,withoutknowingwhatshewas doing.221 Columba'sfastingwasconnectedtoacravingfortheeucharist,whichshewaseventuallypermittedtoreceivedaily.222Althoughshecouldneverarticulateherjoyat receivingGod'sbody,shesometimescriedwhenshereturnedtohercellaftermassandfelthorrorwhenshecomparedordinaryfoodwiththecelestialsweetness.223 Thedevil,whocameinuglyvisionstotemptherwithbreadandfruitandwithanudemalebody,eventriedtoinduceinherdoubtsabouttransubstantiation.Whenhe toldhershewasguiltyofhomicidebecauseshewasstarvingherself,shecriedoutthatshewasonlydiscipliningtheflesh."Heeatsallthingswhorefresheshimselfon God,"sheasserted,"sinceinhimallthingsarecontained.""That'swhatyouthink!"repliedthedevil."Itcontainsonlyseeds,likeflourandbread."Butthenextday ColumbareceivedcomfortintheformofavisionofJesushangingonthecrossabovethechalice.Onanotheroccasion,afteranexhaustingsetofvisionsinwhichthe devilrepeatedlyforcedfoodtohermouth,shesuddenlylaughedandcriedout,''InthenameofJesus,takeitawayyoueat!"224 Columba,likeMargaretofCortona,reveredpriestsfortheirpowerovertheeucharistandevenshedtearsofloveandaweforherownspiritualfather.225Buther eucharisticvisionssometimesbypassedpriestlycontrol.Onenightshewasledtocommunionbythesaintsinavision,andthenextday,whenherconfessoraccused herofneglectingtheeucharist,shesaid,"Why,father,yougavemecommunionthismorningatthebigaltar."Hedeniedit,butwhenhelookedforthehost,hefoundit haddisappeared.226 Ifwereadbetweenthelinesofthevita,itisclear,inpartbecauseofthebiographer'sdefensiveness,thatshewasmuchcriticizedbyreligious


peopleanddidnotalwayssubmit.227Agroupofnunsoncetriedtoforcehertoeat,suspectingthatshestarvedherselfbecauseofunrequitedlove.228Althoughshe ateagrapeanddrankwaterbeforevisitorstodisproverumorsthatshewassubsistingontheeucharistalone,sheobeyedimmediatelywhenDominicorderedherina visiontoeatonlythesacrament.229Herpriestscouldnotdissuadeher.Receivingnothingbeyondthehostnotevenpurewatershedied. Likeotherfastingsaints,Columbafedandservedothers,bothbymiracleandbytheworkofherhands.Shenursedthesickduringtheplague.Shewashedher companions'feetatmeals.Whenapoorwidowlackedfood,Columbatoldhertogohomeandlookagain,andthewomanfoundsustenance.Onanotheroccasion Columbacausedalittlebitofflourtomakemuchbread.230 Withtheclinicaldetailthattellsusweareinthesixteenthcenturyratherthanthethirteenth,Columba'shagiographerunderlinesasthebiographersofAlpas,Colette, andLutgardhaddoneearlierthedryingupoftheascetic'sbody.AttemptingtoproveboththatColumbawaskepthealthybytheeucharistandthatherbodygave noevidencethatshehadeaten"heavy"food,especiallymeat,thebiographerdetailsherlovelysmell,herfailuretosweat,thepurityofherfingernails,thestrengthof herlimbsandteeth,andthebeautyofhercountenance.Hereportsthatshetoldherprioressthatshedidnotmenstruate.Healsoclaimsthatwaterranrightthrough herwhenshedrankandthatsheonlyoccasionallyeliminatedatinybitofyellowfecalmatter.231Butnomatterhowclosedandcontrolledherbodywas,the investigatorswhoopenedherchestfivedaysafterherdeathdiscoveredaroundherdryheartastreamofpureandlivingblood.232 ThusinColumba'slife,asinmanyotherfemalelivesfromalloverEurope,eucharisticdevotion,charitablefooddistribution,feedingmiracles,abstinence,andself starvationweremajorthemes.Suchvitaeclearlyindicatethatfastingandeucharisticpietywerecentralpracticesinwomen'ssearchforunionwithGod.Moreover, theselivessuggestthathagiographers,thosewhoreadtheirstories,andthosewhoreveredtheirsubjectsassociatedfasting,eating,andfeedingotherswiththe religiosityofwomen.AccountssuchasthevitaeofMaryofOignies,IdaofLouvain,LukardisofOberweimar,AngelaofFoligno,DorothyofMontau,Lidwinaof Schiedam,ColetteofCorbie,andColumbaherselfarenotmerelyfragmentsofdocumentationaboutasceticismanddevo


tion.Theyarepiecesofliteraturewhosedramaandpathosarewovenaroundthecentralmotifofbodiesasfood:God'sbody,dyinginorderthatChristiansmayeat andlive,andwomen'sbodies,receivingfood,refusingfood,becomingfood. Yethagiographynomatterhowelegantitsstructureisnotoriouslystereotypicalandexaggerated.Thestoriesofsaintssometimesexpressmoreclearlythe expectationsofauthorsandreadersthanthehopesandfearsintheheartsoftheirretiringandearnestsubjects.Wemustthereforeaskwhetherwomen'sownwritings suggestthesamefixationonfoodthattheirconfessorsandbiographersoftenbuiltintotheirvitae.Theanswer,asweshallseeinthenextchapter,isthattheydo.


5 FoodintheWritingsofWomenMystics
Lethimkissmewiththekissofhismouth:forthybreastsarebetter thanwine, Smellingsweetofthebestointments.Thynameisasoilpouredout: thereforeyoungmaidenshavelovedthee. Drawme:wewillrunaftertheetotheodourofthyointments.The kinghathbroughtmeintohisstorerooms:wewillbegladand rejoiceinthee,rememberingthybreastsmorethanwine. .......................... Isatdownunderhisshadow,whomIdesired:andhisfruitwassweet tomypalate. Hebroughtmeintothecellarofwine:hesetinordercharityinme. Staymeupwithflowers,compassmeaboutwithapples:becauseI languishwithlove. SONGOFSONGS1:13,2:35 Igaveyoumilktodrink,notmeatforyouwerenotableyet.But neitherindeedareyounowableforyouareyetcarnal. 1CORINTHIANS3:2

LatemedievalmysticsborrowedfromScripture,particularlyfromtheSongofSongs,thenotionofusingimagesoffoodandeatingtotalkaboutthesoul'sdesirefor God.Whentheythoughtabouteucharistoraboutmysticalunionitself,theythoughtofthesweetnessofthebridegroom'sbreasts,ofmilkandthehoneycomb,of flowingoil,andofthecellarofwine.Moreover,drawingonPaul'swords,theyconceivedofspiritualinstruction,evenofdivineillumination,asmilkofferedtothosenot yetgrowntoadulthood.ThustheysometimessawJesusortheapostlesandsaintsasnursingmothersorasabanquetofrefreshmentandlove.1 Tomedievalexegetesandspiritualwriters,suchthemeswerenotmere


metaphors.Intellect,soul,andsensoryfacultieswerenotdivided,withaseparatevocabularytorefertoeach.Rather,Godwasknownwithsensesthatwereafusion ofallthehumanbeing'scapacitiestoexperience.WhenmedievalwritersspokeofeatingortastingorsavoringGod,theymeantnotmerelytodrawananalogytoa particularbodilypleasurebut,rather,todenotedirectlyanexperiencing,afeeling/knowingofGodintowhichtheentirepersonwascaughtup.Themysticalwriter RudolphBiberach(,goodtaste)andsapere(totasteorsavor)arerelatedetymologically:"totaste"is"toknow."2 As WilliamofSt.Thierryputitinthetwelfthcentury:''...gustare,hocestintelligere."3 Thusalmostallmedievalmysticssometimesspeakof"tastingGod,"andtheverbitselfisakindofbridgebetweenthephysicalactofeatingthehostandtheinner experienceofrestinginthesweetness(fruitio)ofmysticalunion.ItisexactlybecausemysticsexperiencedGodwithmorethanintellect,andfeltcomfortableusing sensuallanguagetoexpresstheexperience,thattheyandtheirhagiographerssometimesdifferedoverwhetheravisionwasseenwiththeeyesofthebodyortheeyes ofthemind.Aninner,glorious,wordlessmoment,describedinhighlyaffectivelanguagetoasisteroraconfessor,easilybecameavisionoranapparitionoramiracle asitwasretoldbyoneexcitedhearerafteranother.BernardofClairvaux,forexample,saidthatthingscomefromGodwithoutimages,andGertrudeofHelfta's biographersquotedBernardinanefforttoexplainthatGertrude'svisionsweremerelyChrist'swayofteachingherwhatultimatelysurpassesallsenses.Gertrude's sisters,however,weresureshereceivedChrist'sheartasfoodanddrink,hidinitasthedoveintherocks,ornursedfromitthroughhisside.4 Becauseofexegeticaltraditionandbecauseofthecentralplaceoftheeucharistintheliturgy,verbssuchasmanducare(tochew),pascere,pasci(tofeed),sapereor gustare(totaste),edere(todevour),esurire(tohunger),andfruor(todelightin,withconnotationsoftofructify)camenaturallytolatemedievalspiritualwriters.But manyotherequallysensualverbswereavailableforexpressingthesearchforandenjoymentofGodverbsofseeing,ofhearing,oftouchingandthesewordstoo reverberatewithcomplexbiblicalandliturgicalresonances.Godcouldbelight,water,heat,word,orsong,aswellasthebreadofangelsorsweetwine.5 TheSongof Songssuggestedmetaphorsofsexualunionandfertilityatleastasmuchasmetaphorsofdrunkennessandfeasting.6 .


Andmanyhighlyaffectivewriters,suchasRuysbroeck,Rolle,andSuso,seemtohavepreferredimagesoftheseaorofmelodytoimageryoffood,despitetheir eucharisticpiety.YetwomenmysticsinthelaterMiddleAgeswereparticularlyfondnotonlyofimagesoftastinganddevouringbutalsoofextended,elaborate metaphorsofhungerandofbread,blood,andfood.Ifhandbooksandsurveyaccountsofthehistoryofpietyhavetendedtoassociatefemalespiritualitywithnuptial oreroticmetaphors,7 itappearstobemorebecausemodernsensibilitiesaretitillatedbysuchimagesthanbecausetheyarewomen'smostcommonmetaphorsfor unionwiththedivineorbecausetheyrepresentadistinctivelyfemalepatternofexpression.Whatdoesseemmorecharacteristicofwomenmysticsthanofmen, however,ishungeringforGod. InthepagesthatfollowIanalyzethewordsthatwomenthemselveswroteorspoke.Imighthavechosenotherfiguresfordetailedconsiderationforexample,Angela ofFolignoorMechtildofMagdeburg.IhavedecidedtotreatHadewijch,BeatriceofNazareth,andthetwoItalianCatherinesinpartbecauseIcaninthatwaylimit myselftotworegions,treatingtworepresentativeseachofnorthernandsouthernpiety.IhavealsochosenthesefourfiguresbecauseIcan,ineachsection,couplea womanwhoseownwritingsurvives,articulatedinseveraldistinctgenres,withawomanwhoseideaswerepartiallymediatedbutbynomeansentirelymaskedby thosewhorecordedthem. Atfirstglancethischaptermayseemmerelytocontinueexplanationanddepictionofthemestreatedinchapter4.Thisisnotso.Thewomenconsideredinthe previouschapterareseen,sotospeak,fromtheoutside.Occasionallytheir"sayings"havebeenrecordedbyhagiographerssometimesafewlettersordirectaccounts ofvisionshavesurvived.Butforthemostpart,theirvoicesaresilent.ThusIhadtoinducetheirtheologyfromtheirbehavioranenterpriseofuncertainreliability,as medievalinquisitorialrecordsshowonlytooclearly.Incontrast,thewomenIconsiderinthepresentchaptertellushowtheygavemeaningtotheirexperiences.They articulateamysticaltheologyofconsiderablepowerandbeauty.Andinthattheologytheytellusthattoofferandtobecomefood(i.e.,macerated,torn,andnurturing flesh)istoserveandtosave.Itisnecessarytolistenwithsomecaretotheirvoices,foralthoughthesewomenhavebeenmuchstudiedbyscholars,thecomplexityof theirideashasseldombeenunderstood.8 .


HadewijchandBeatriceofNazareth Sometimeswefindimageryofeating,devouring,andhungeringinmysticalwritersofwhoselivesweknowlittle.ThisisthecasewithHadewijch,9 thefirstgreatpoet intheFlemishlanguage,whoprobablywrotebetween1220and1240,wasprobablytheleaderofabeguinegroupfromwhichshewasatsomepointexiled,andwas perhapsactuallyaccusedofquietism,achargesheseemstohavebeenanxioustorefute.10Ofherownreligiouspracticesweknowonlywhatissuggestedbyobscure autobiographicalfragmentsinherpoems,letters,andvisions.Shewarnsagainstgluttony,urgingherdaughtersthattheyshouldneverhave"taste"foranythingoutside God,11andshewasclearlydeeplydevotedtotheeucharist,thereceptionofwhichismentionedasprovidingtheoccasionforatleastfourofherthirteenrecorded visions.12ButeventhoughweknowlittleofHadewijch'sspiritualpractices,wecanseethepoweroffoodasanimageinherwriting.Hungeringanddevouring,ifnot hercentralmetaphors,arenonethelessrepeatedlyusedinherpoemsandletterstotalkaboutthe"love"thatishercentralconcernalovethatisbothGodandthe searchforGod.13Moreover,asPaulMommaersandJ.Reynaerthavepointedout,themysticalonenesssheachievesnotanecstatictranscendingofhumannessbut ajoiningwithJesus'"concrete,disconcerting,humanHumanity"isanexperienceshecalls''tasting":
TheCountenancewhichhetheremadevisiblewasinvisibleandinaccessibletothesightforallcreatureswhoneverlivedhumananddivineloveinonesimpleBeing,andwho couldnotgrasporcherishintheundividedtastetheonenature.14 Iwaschosen[toreceiverevelations]inorderthatImighttasteManandGodinoneknowledge[daticmenscheendegodineenreconstsmakensoude].15

TheuniontowardwhichHadewijchstrainedwitheveryfiberofherbeingwasbestspokenofinparadoxes,shefelt,becauseitwasthesoul'sonlygoal,yetimpossible ofmorethanmomentaryattainment.Thusitwasbestarticulatedinthecriesofpain,theimagesofhellandloneliness,thatreflectthemystic'sfailuretoretainit. Hadewijchwrotebothsomeofthemostaffective,sensual,eveneroticdescriptionsofunionwith


Christeverpennedandsomeofthefiercestcriticismofaffectivespirituality,denyingthatloveiseversweetness,joy,orpeace.Exactlybecausefinalrestisnever possibleinthislife,HadewijchagainandagainchallengedherspiritualdaughterstofusewiththehumanityofChristbeforeattemptingto"becomeGodwithGod"(i.e., torestinsweetness).16TheHadewijchwhocoulddescribehersoulmeltingeroticallyintothebeautifulhumanJesusatthemomentofeatinganddrinkinghisbodyin communionalsowrote:

Hellistheseventhname OfthisLovewhereinIsuffer. ForthereisnothingLovedoesnotengulfanddamn. ....................... AsHellturnseverythingtoruin, InLovenothingelseisacquired Butdisgustandtorturewithoutpity Forevertobeinunrest, Foreverassaultandnewpersecution Tobewhollydevouredandengulfed[alverslonden endealverswolghen] Inherunfathomableessence, Tofounderunceasinglyinheatandcold, Inthedeep,insurmountabledarknessofLove. Thisoutdoesthetormentsofhell.17

ToHadewijch,onesoughtunionwithahumanChristinafrenzyofsufferingthatincludedandtranscendedpleasureandpain. Forsuchunion,bothhungerandeatingwerepowerfulimages.Hadewijchwishedtoexpressthetotalincorporationofhumanityintohumanitydivinity(eatingofGod bytheselfandoftheselfbyGod),yetshealsofeltanachingdesirethatyearnedforafillingbeyondsatiety.Tohungerandtodevour,forher,hadclearovertonesof physicalityjoiningphysicality.Toeatmeantbothtofusewith,ineroticunionofmouthtomouth,andtobecomepregnantwith,tohavegrowwithinone'sbelly.Yet suchunionwasunionwithsufferingfor"frenzieddevouring"carriedwithitconnotationsoffailureevertobefilled,evertostaytheagonizedlongingthatreturnedand returnedandreturned. HadewijchsometimesspeaksofthesoulasfedbyChristintheeucharistorinecstasy.SheborrowsfromWilliamofSt.Thierrytheimage


ofthesoulrearedbyChrist,"nursedwithmotherlycare...[and]disciplinedbytherodoffatherlymercy."18Shesayslove"nourishes[thehumble]withherfood."19 Andshedescribesthebeginningsofherownmysticallifeinlanguagethatusesdevour,swallow,anddrinktoexpressasweetengulfingofselfinGod:
SinceIwastenyearsoldIhavebeensooverwhelmedbyintenselovethatIshouldhavedied,duringthefirsttwoyearswhenIbeganthis,ifGodhadnotgivenmeotherformsof strength....AndthroughallthesetokenswithwhichImetintheintimateexchangeoflovebetweenhimandmeforasitisthecustomoffriendsbetweenthemselvestohide littleandrevealmuch,whatismostexperiencedistheclosefeelingofanother,whentheyrelish,devour,drink,swallowupeachother[Endeindoersmakene,Endeindoeretene, Endeindoerdrinckene,Endeinverswelgheneelcanderen]bythesetokensthatGod,myLove,impartedtome...hegaveme...confidenceinhim....SometimesLoveso enlightensmethatIknowwhatiswantinginmethatIdonotcontentmyBelovedaccordingtohissublimityandsometimesthesweetnatureofLoveblindsmetosuchadegree thatwhenIcantasteandfeelher[teghesmakeneEndetegheuoelne]itisenoughforme.20

Sometimes,drawingontheSongsofSongs,sheweavestogetherlanguageofkissingandeatingandflowingoil,expressingaclearsensethatthefoodbodyGodgives intheeucharistisreceivedbyChristiansasbotheroticandnourishingsweetness:
Hedelivereduptodeathhissubstance,thatistosayhisholyBody...andhegavehimselftobeeatenanddrunk,asoftenaswewill....Yes,muchsmallerthananatom comparedtotheentireworldiswhatwereceivefromGodcomparedtowhatwecouldhavefromGod,ifwetrustedinhimandwouldreceiveitfromhim.Alas,howmanysoulsnow remainthusunfed,andhowfewconsumehimamongthosewhohavetherighttoeatanddrink! Herelaxedtimethatis,heispatienttowaitforouradvancetoagoodlifewhenwewill.Weseehismouthbroughtclosetoustokisshimwhowishesit.Hisarmsareoutstretched: Hewhowishestobeembracedmaythrowhimselfintothem.21

Theunionofmouthtomouthshedescribesissometimesfranklyerotic,underliningtheextenttowhichallthesensesareinvolvedinthisknowingandexperiencingof God:

Page156 Theypenetrateeachotherinsuchawaythatneitherofthetwodistinguisheshimselffromtheother.Buttheyabideinoneanotherinfruition,mouthinmouth,heartinheart,body inbody,soulinsoul.22

Inherpoem"Love'sSevenNames"sheassertsthatwedoeatGod:'smostintimateunion Isthrougheating,tastingandseeinginteriorly. Heeatsuswethinkweeathim, Andwedoeathim,ofthiswecanbecertain.23

Inthesestanzas,eatingisacentralmetaphornotmerelybecausetheeucharististheplaceinChristianritualinwhichGodismostintimatelyreceivedbutalsobecause toeatandtobeeatenexpressthatinterpenetrationandmutualengulfing,thatfusionoffleshlyhumannesswithfleshlyhumanness,thatHadewijchsawasnecessaryfor unitingwithaGodwhoisman.Moreover,inoneofhervisionsHadewijchherselfexperiencedwhatsheevokesinherpoetry.HeraccountofthismeetingwithGod readslikeadescriptionofsexualorgasm(anditisonlyourmodernsensibilitythatmakesthesuggestionashockingone):

HecameintheformandclothingofaMan,ashewasonthedaywhenhegavehisBodyforthefirsttime...hegavehimselftomeintheshapeoftheSacrament,initsoutward form...andthenhegavemetodrinkfromthechalice....Afterthathecamehimselftome,tookmeentirelyinhisarms,andpressedmetohimandallmymembersfelthisinfull felicity,inaccordancewiththedesireofmyheartandmyhumanity[namierehertenbegherten.namieremenscheit].SoIwasoutwardlysatisfiedandfullytransported.Alsothen, forashortwhile,Ihadthestrengthtobearthisbutsoon,afterashorttime,Ilostthatmanlybeautyoutwardlyinthesightofhisform.Isawhimcompletelycometonoughtand sofadeandallatoncedissolvethatIcouldnolongerdistinguishhimwithinme.Thenitwastomeasifwewereonewithoutdifference.

Hadewijchgoesontosuggestthatsuchinner"dissolving"isonewiththe"outward"seeing,feeling,andtastingofthesacrament.24 Eatingorbeingfedisnot,toHadewijch,merelyaunioninwhichGodtakestheinitiative,aswallowingordevouringofthesoulbyGod.Thesoultoogivesfood.It "suckles"whatitloves.AnditreachesouttotasteandmasticatethesweetnessoftheLord.Inthepoemhereditorcalls"WereIButLove,"Hadewijchspeaksofour ownlovingasakindoffeeding:

Page157 IgreetwhatIlove Withmyheart'sblood. .......... Ilong,Ikeepvigil,Itaste[Jchake,icwake,ic smake] ..................... Isuffer,Istriveaftertheheight, Isucklewithmybood[Jcsoghemetminnenbloede] Igreetthesweetnessthatcan Alleviatemymadness[orewoede]ofLove.25

Inherpoem"Love'sGrowth"shespeaksofbeingpregnantwithLove,asweetchild,whichiscarriedandnourishedinpainandfinally"whollyengulfsfromwithin"the motheringsoul.26Thus,toHadewijch,biologicalimagesfortheloveofferedandreceivedbytheselfareimagesoftheutmostintimacy.Toloveistogiveone'sbodily fluidasfood,tocarryafoetuswithinoneself,tochewortobecheweditisnotmerelytokissbutalsotofeeltheotherwithinone'sownbowelsorheart.Toloveisto engulfandbeengulfed,tomasticateandtoassimilate,toflowoutwithnurturesothatone'sbodybecomesfoodforanother. ButmetaphorsofeatingareusuallytoHadewijchnotmetaphorsofengulfingandincorporatingbutmetaphorsofemptinessandhunger.Nomatterhowmuchone "tastes,"oneisneverfull.ThemoreprofoundtheintimacywithGod,thegreatertheunrequitedcraving.Hadewijchwrites:

WhenanyoneseeksLoveandundertakesherservice,hemustdoallthingsforherglory,forduringthistimeheishumanandneedyandthenhemustworkchivalrouslyinall things,begenerous,serve,andshowmercy,foreverythingfailshimandleaveshiminwant.27

Andwedoeathim,ofthiswecanbecertain. Butbecauseheremainssoundevoured, Andsountouched,andsoundesired, Eachofusremainsuneatenbyhim Andseparatedsofarfromeachother. Butlethimwhoisheldcaptivebythesechains Notceasetoeathisfill,

Page158 Ifhewishestoknowandtastebeyondhisdreams TheGodheadandtheManhood!28

HewhoknowsLoveandhercomingsand goings Hasexperiencedandcanunderstand Whyitistrulyappropriate ThatHellshouldbethehighestnameof Love.29

Ultimately,toHadewijch,loveismostcloselyapproachedinparadox.Thushercentralfoodimagesareimagesofaneatingthatleavesonehungry,ofanunfulfilled cravingthatneverthelessistheonlyfood.
WhatissweetestinLoveishertempestuousness, Herdeepestabyssishermostbeautifulform .................... Todieofhungerforheristofeedandtaste Herdespairisassurance Hersorestwoundingisallcuring Towasteawayforhersakeistobeinrepose .................... Hertendercareenlargesourwounds ................ Hertableishunger.30

WeallindeedwishtobeGodwithGod,butGodknowstherearefewofuswhowanttoliveasmenwithhisHumanity,orwanttocarryhiscrosswithhim,orwanttohangonthe cross....ButbeforeLovethusburstsherdikes,andbeforesheravishesmanoutofhimself...,hemustofferhernobleserviceandthelifeofexile.31

Inavision,shereceivedachalicefullofbloodwhenshedrankit,sherealizeditwasthechaliceofpatience.32AndinthesamevisionGodtoldher:"Sinceyouarea humanbeing,liveinmiseryasman[mensch]."33Shespokeofexpandinghersuffering,herterriblecravingforGod,intosuchcompassionforothersthatshewould havebravedGod'scondemnationtobringthemtolovehim.Heragonywasthusakindofservice,


whichonceevenmanagedtocoerceGodintoreleasingsoulsfromtheirdeservedjudgment.34ButshelearnedthatthepowerofGod'sawfuldecisionlaybeyond eventheserviceofsuffering.Shewrote:
IhaveneverexperiencedLoveinanysortofwayasrepose....ForIwasahumancreature,andLoveisterribleandimplacable,devouringandburning....Nowforpersons,my reposelayinlovingeachoftheminwhatwaspropertohim....AsforpersonswhofailedGodandwerestrangerstohim,theyweighedheavyonme.ForIwassoladenwithhis loveandcaptivatedbyitthatIcouldscarcelyendurethatanyoneshouldlovehimlessthanI.Andcharityforotherswoundedmecruelly,thatheshouldletthesesoulsbesuch strangerstohim....Iwouldgladlyhavepurchasedloveforthembyacceptingthatheshouldlovethemandhateme....ButthesovereignpowerthatisactualLovesparesno one....ThispowerheldmebackonceagainwhenIhadwishedtofreeallmen.35

Thus,toHadewijch,thesoulshouldstrivenotsomuchtorestinsatietyastosufferadeeperhungerbeyondfilling.Forthetruestsatietyisthepainofdesirethetruest reposeisthehorrorofGod'spower.AndallweattainfullnessorhungeristhegiftofLove.
ForIdependwhollyon[Love], IfIshalleverascendcleartohersummit. WhateverelseIdid, Myhunger[hongher]wouldremainasstrongasever: Didshenotgivemefullsatisfactioninher. SoIremainonLove'sside, Whatevermayhappentomeafterthat: Thepainofhungerforher,thejoyofsatisfactioninher, Notodesires,oryestodelight.36

Hadewijch'sreasonforstressinghungerratherthanreposeisnotmerelyexperiential.Itdoesnotliesimplyinhersensethatdesiregrowsevergreaterasittastesmore oftheineffablesweetness.ForHadewijch'slanguagereflectsdoctrineaswell.ItreflectsherconvictionthattheGodwemeetishumanityaswellasdivinity,and nowheremorehumanthanwhenhisfleshbecomesfood.37"Dearchild,"shewrotetoadisciple,"youhavemuchtodoifyouaretolivetheDivinityandthe Humanity."38"[Christsaid]:'IfyouwishtobelikemeinmyHumanity,asyoudesiretopossessmewhollyinmyDivinityandHumanity,youshalldesiretobepoor, miserable,anddespisedbyallmenandallgriefswilltaste


sweetertoyouthanallearthlypleasures.'"39Hunger,then,toHadewijch,isincorporationwithChrist'ssufferinghumanity,whichisourpathtohisdivinity.Themore wehungerwithChrist,themorewearefilled.Themoreweunitewith"eat"theloneliness,thedeath,thebodyofChristonthecross,themorefullyGodunites withus,swellingourfullnessandourdesire.

Inseparablesatietyandhunger AretheappanageoflavishLove .............. Satiety:forLovecomes,andtheycannotbearher Hunger:forshewithdraws,andtheycomplain. ..................... HowdoesLove'scomingsatiate? Filledwithwonder,wetastewhatsheis, Shegrantspossessingofhersublimethrone: Sheimpartsthegreattreasureofherriches. HowdoesLove'srefusalcreatehunger? Becausewecannotcomeatwhatwewishtoknow Orenjoywhatwedesire: Thatincreasesourhungeroverandover. ................... Maynewlightgiveyounewardor Newworks,newdelightstothefull NewassaultsofLove,newhungersovast ThatnewLovemaydevourneweternity!40

ThusweseethatthefoodmetaphorsinwhichHadewijchspeaksofhermysticalcravingexpressherconfidencethatweexperienceGodthroughalloursenses.Our knowingisatasting,aswelling,abeingfull,aflowingoutthatengagesallourhumanity.SuchmetaphorsalsoexpressherconvictionthatthesweetnessofGod's comingisinfinitepain,evenmadness,forhowevermuchwetaste,wecravemore.Thefullerourdesire,thehungrieroursoul.And,finally,suchmetaphorsofbodily encounterconjuringupastheydoteethandmouths,bowelsandbreasts,fleshchewedandswallowedandmadeintonewfleshrevealhowmuch,toHadewijch, theGodwhoistheinfiniteabyssbeyondalllanguageandmetaphorisalsofleshlyhumanityahumanitythatsuffersandfeeds. Hadewijch'ssenseofunionwithGodasfrenzy,likehereucharisticfer


vorandherpassionateimagesofdevouringanddesire,findsaparallelinthevitaofherFlemishcontemporary,BeatriceofNazareth.InBeatrice,thefrenzybecomes illness,"insanity,"inimageandinfacttheeucharistbecomesacascadeofblood,withwhichthewoman'sbodyunitesitself.AboutBeatrice'slifeweknowenoughto seethatasceticismandeucharisticdevotionwerecentraltoheractualpiety,thatshesoughthysteriaasameansoffusingwithChrist'scross,andthatfromthisfusion camehealth,whichspilledoverintobledintoserviceforothers. Beatricecamefromareligiousfamily.Whenshewassevenhermotherdied,andherfathercommittedhertothebeguinesofLautolearnherletters.Shewaslater educatedatoneoftheCistercianmonasteriesherfatherhadfounded,andshemadeherprofessionthereatsixteen.Ataboutagethirtysevenshebecameprioressat Nazareth,yetanotherofherfather'sfoundations,andservedinthiscapacityuntilherdeathatsixtyeight.41Beatricewrotedownherspiritualexperiences,inserting amongthemshortessaysonasceticormysticaltopics,atleastoneofwhichhassurvivedintheoriginallanguage.Thewholeformsakindofspiritualautobiography. AfterBeatrice'sdeath,ananonymousconfessorofNazarethtranslatedtheautobiographyintoaLatinthat,wherewecancompareittoherFlemishoriginal,appears bothfloridandessentiallytruthful.42ThisautobiographymakesitclearthatBeatricetorturedherbodyinextremeasceticismflagellatingherself,sleepingonstones, walkingonice,bindingthornsbetweenherbreastsandaroundherloins,and,eveninillness,eatingonlydrybreadandthatdevotiontotheeucharistwasattheheart ofherpiety.43 ToBeatrice,illness,whichischieflyinsanity(orewoetinFlemish,insaniaamorisoraestusinLatin),istheessentialthelivedmetaphorforunionwithChrist.44 Forthisillness,however,food/drinking/bloodisamajorimageandbothfood/drinking/bloodandfrenzy/hysteria/insanityare,toBeatrice,imagesofphysicality,of unionwiththeagonizedhumanbodyofChristonthecross.SuchunioncametoBeatricemostfrequentlyatreceptionofcommunion,areceptionthatproducedillness andhealth,45foritledthebodytolanguishbeyondconsciousnessandyettopouroutinbloodforthesisters.46 Beatrice'sfrenziedcenteringofherlifeintheeucharist,hervacillationbetweenjoyandterror,reflectstheambivalenceaboutcommunionfoundinthirteenthcentury theology.Aswesawinchapter2above,theologiansoftheperiodbothurgedandwarnedagainstfrequentreception.Bea


tricelikeGertrudetheGreatandMargaretofCortonarespondedtosuchwarningsbothwithagonizedfeelingsofunworthiness,offearofChristthejudge,and withcravingsfortheholyfood.47Beatrice'sunionwithChristintheeucharistwasthusbothawefulandintimate,intenselyeroticandexcruciatinglypainfulas paradoxicalastheimagesofloveinHadewijch'spoems.Once,onthesecondSundayinEpiphany,whensheproposedtogotocommunion,she"sawhim[i.e., Jesus],thesweetestspouseofthesoul,standingonthealtar,"withhisoutstretchedarms,drawinghertohim,andshe"desiredthesavingreceptionofhisbody,in marveloustasting."

Refreshedbythismosthealthgivingcommunion,inthemarvelousembraceofthesamedivinity,shesuddenlyfeltherwholesoul,diffusedthroughallthemembersofherbody, soviolentlycaughtupthatthesamelittlebodyfeltitselfinallitsindividualmembersstronglygatheredintotheembrace.Indeed,intheunionofthissweetembrace,theLord appliedtheheartofhischosenonetohisownheart,andheabsorbedherwholespiritwithinhimselfandthesoulofBeatricetastedthereaheavenlyfloodofcharity....Atthis taste,losingtheuseofhercorporealsenses,shefelltoearthandherfeetcouldnotholdher....Andthenunwhocaredforherinhersicknesswentbeforeherholdingherbyher arms...,and[shefelldown].Andafterwards,whenshecamebacktoherself,thenunputherinherbedwhereshelayforawholedayinebriatedininestimablesweetnessofmind, jubilantandexulting,intranquilpeaceofconscience,restingwithChrist.48

OnotheroccasionsherdesireforChristwassuchtorturethatshefearedtodieofit.Drawingonherowndescription,herhagiographertellsusthatshelanguished morethanayearinthefollowingway:
Thefervorofthisdesireinflamedhermindsomuchthatasoftenassheremembered[Christ'sdeathandherownexile,shecried].Andherheart,foralongperiodoftimelaidopen bydesire,andherarteries,alsoopened,frequentlybrought[toher]ahorrorofdeath,sincetheycouldnotbebroughtbacktotheirnaturalcondition,becauseoftheimpedimentof herdesire....Indeedsuchwasthewoundeddevotion[sauciatadeuotio]ofthisholywoman,suchthedesireforcelestialjoys,suchtheaffection,atoncewoundedand languishinginlove[vulneratasimuletamorslanguens],that,inthefervorofherdesire,riversofcopiousbloodfrequentlypouredfromhermouthandnostrils....Sofinallythis violentdesirecontinuallydominatedinhermind,evergrowing,untilveryoften,des

Page163 tituteoftheobedienceofhercorporealsenses,shewasnotabletodiscernbytheirserviceswhatwasoutsideher....Howeveronegreatsolaceremained:...thevivifying consolationofthesacramentoftheLord'sbodyandblood....Thiswasthehighestsolaceoftheholywoman,thisheroneandonlyrefugefromallthemiseriesofthehuman condition,thisatoncethenourishmentthatsustainedher[sustentationispabulum],andthesavingprovision[viaticum]onthewayofpresentexile,andafoodofmedicinalvalue inherviolentseizuresandoutbursts.49

OccasionallyBeatrice'sdesireliterallychokedher.Once,uponhearingthewordpreachedintheconvent,''herheartwasshattered.""Desertingitsnaturalplaceitrose uptoherthroatandremainedthereforalongspaceoftime,tremblingandpalpitating,fromwhichshecontractedagreatillness."50Afterherfirstmysticaltrance,her laughterbecamesouncontrolledthatGodhadtoputoutthebedroomlampbyamiracletohidethecontortionsofherfacefromhersisters.51Afewyearslater,she begantomeditateon"howChristfedherwiththemilkofconsolationandmaternalaffection,"andshebegantothinkthatiftheLorddidallthosebenefitsforher,then alsohesufferedallhispainsforher.Soshestrove"todiscoverhowtoshapeherselftosuchtorture[orinsanity]...andsofollowperfectlyChrist'sfootsteps."And sheconsultedherspiritualadviseraboutthedesirabilityof"moldingherselftothewayof...madnessorfoolishness"forChristi.e.,ofdrivingherselfmad.Buther advisercounseledagainstit.52 AccordingtoBeatrice'sbiographer,shecameaftermanyyearstoastateinwhichthesacramentcuredherfromallsickness,inwhichherinebriationandjoyinChrist flowedoutintooverpoweringcompassion.Shethenservedthesickandthepoor,readingtheheartsofthoseindistressandevenarguingthecasesofcriminalsbefore thelocaljudge.53Moreover,Beatrice'sownwordssuggestthatsheherselfsawsuchapatterninherlife,amovementfromsicknesstoservice.Inherlittletreatiseon thesevenstepsoflove,whichsurvivesinherownversion,shedescribesthestagesas:(1)thesearchforpurity,(2)disinterestedlove,(3)torturebecauseonecannot loveenough,(4)thefirstexperienceofabsorptioninGod,(5)insanity[orewoet],(6)triumphantlove,and(7)theviolentdeathofloveeternal,thefinalfusionwith Christ.Thestepsalternatebetweentortureandpeace.54ThefinalstageisasparadoxicalasHadewijch'snotionofloveashell.Init,"theheartbecomescrazywithin," themindis"suspended,"andthesenses"aredrawntoward


joy.""Lovecalls[thesoul]anddismissesit,sweetensitandtorturesit,givesdeathandofferslife,giveshealthandthenwoundsagain,givesinsanityandwisdom."55 Alongthewaytoultimateunion,however,thesoulisdescribedinimagesofserving.Atthesecondstageitisaservingmaidatthesixthstage,amotherrulingalarge family.56 ThroughoutBeatrice'swriting,drinkingisacentralimageofunion,bleedingacentralimageofbothsufferingandjoy.Beatricespeaksofthefourthstageofloveasa cupbrimmingover.57Ofthefifthstageshewrites:

Meanwhilelove,whichmovessoviolentlyandtumultuouslyintheheart,growsbeyondmeasureandoverflowssointhesoulthattheheartthinksitselfmuchwounded,and thesewoundsaredailyrenewedandmademorepainful....Andthusitseemstoherthatherveinsareopenedandherbloodflows,hermarrowisweakened,...andherchest burnsandherthroatdriesup....Inthistimeshefeelsherheartpiercedbyanarrowuptothethroatandfinallyeventothebrain....Andbyallthese[assaults]sheismuch wounded,andherhearttrulyrejoicesandlosesallitsstrength.Andtrulyhersoulisnourished,andherloveisfed,andhermindissuspended....Andalwayshersoulismore andmoreexcitedandluredonward,neversaturatedorsatiated.Forthemoreitistorturedandwounded,themoreitisrenewedandcalmed,andthatwhichprofoundlywoundsit alonegivestoithealth.58

Shefrequentlysawvisionsofbloodatmass.Once,whenshereceivedthesacramentandmeditatedonChrist'swounds,she"sawthatallthebloodwhichflowedfrom thosewoundsfloodedintoherheart...sothatshewaswashedperfectlyclean....Andinthisfireoflovewhichburnedwithinheracertainspecialfriendwas broughtintothesightofherheartandbothwereunitedsoinChristthatonespiritwasmadefromtwo."59Inanothersetpiece,aChristmasmeditationonthe mysteriesoftheIncarnation,Beatrice'sbasicmetaphorisdrinkingChrist,asrivulets,asstreams,orasamightyriver.Thosewhodrinkrivuletsarethosewhostrivefor virtuesthosewhodrinkstreamsarethosewhosecompassiongrowsinmemoryofthePassion.Buthighestarethosewhoimitateandfusewiththecross,forthey drinkChristhimself.60 Thus,toBeatrice,insanitywhichisalsohealthwasbothanimageofunionandawayoflife.DrinkingJesus'bloodwasbothametaphorforimitatioChristianda ritualact(thereceptionofcommunion)thatlayattheheartofreligiouspractice.Bleedingwasametaphorforpainand


lossofselfcontrolitwasalsoametaphorforjoyandredemption.Anditwasabodilyfunctionofthewomanmysticwholayinbed,outofhersenseswithinebriation, andwhorosetoadvisetroubledsistersandvisitorsfromtheworldoutsidetheconvent. ToHadewijch,hungeranddevouringwerepowerfulandcentralimagesforthelovethatisunion.Tohercontemporary,Beatrice,drinkingandbleedingwereimages fortheinsanitythatisunion.Bothmysticsthusproceedtodivinitythroughahumanitythatisintenselyphysical.TheirlanguageexpressesaspiritualityinwhichGodis notmerelydescribedasifhewereabodybutiseatenanddrunkbecauseheisabody.AndbecausethepainofGod'sbodilinessistheinstrumentofsalvation, imitationofthatGodisthroughthewounds,laughter,tears,suffocation,andhungerthatoccurintheself(bodyandsoul)ofthemysticstrugglingtowardecstasy. CatherineofSienaandCatherineofGenoa Ifwemoveonahundredyearsormoreandmanymilestothesouth,wefindinthetwogreatestwomenwritersofmedievalItaly,CatherineofSiena(d.1380)and CatherineofGenoa(d.1510),asimilarconcentrationoneatinganddrinking,onbreadandblood,asthecrucialimagesforencounterwithGod.Inbothcases,we knowenoughaboutthewomen'sactuallivestobesurethatobsessivefastingandeucharisticpietywerekeyelementsintheirreligiouspractices.Wealsoknowthat fastingandfeedingbecamelivedmetaphorsforthem,asillnessandbleedingdidforBeatriceofNazareth.BothCatherinesfedthedestitute,byordinarycharityand bymiracle.Bothatethefilthofthesicktheytended.BothfeltthatitwasintheexcruciatingpainofmorethanearthlyhungerthattheyfusedwiththeagonyofChriston thecrossandofferedupsuchagonyforthesalvationoftheworld. ManycontemporaryandnearcontemporaryaccountsofthelifeandmiraclesofCatherineofSienasurvive61andwehave,inaddition,herownwritings(dictatedbut certainlyauthentic)i.e.,theDialogue,hervoluminouscorrespondence,andsomeofherprayers.62Notsurprisingly,thesematerialssometimesgivedivergent interpretations,particularlyofhermiraclesandvisions.Andtwentiethcenturyscholarshavedebatedthedatesofcertainkeyeventsinherlife(particularlyinher adoles


cence).63Nevertheless,somethingsarenotindoubt.ItisclearthatnoteatingwasacentralelementinCatherine'sbehavior,thateucharisticpietywasatthecoreof herreligiouspractice,64thatfoodespeciallybloodasfoodwasthecentralmetaphorinherprolixmetaphoricalwriting,andthather(predominantlymale)advisers andfollowerssawnoteating,eating,andfeedingashighlysignificantaspectsofherimpactonothers.65 ThereisreasontosuspectthatRaymondofCapuawhosebiographyofCatherinemostscholarshavepreferredasthebasicsourceforherlifehadhisown reasonsforemphasizingherdecidedlyoddeatingbehavior.Raymondhimselfhadpoorhealthandfeltmuchguiltabouthisowndifficultiesinfasting.Hewas, moreover,apropagandistforstrictDominicanpracticeandfoundCatherineusefulasamodeloffasting,vigils,andselfabnegation.Raymondhimselfwasclearlyless criticalofCatherine'sinabilitytoeatthanherpreviousconfessorshadbeeninpartbecauseofhisowndistrustofdoctors.66Heenjoyedassociatingbothfastingand miraculousfeedingwithwomensaints.HenotonlywroteabiographyofAgnesofMontepulciano,inwhoseliferainsofmannaarethecharacteristicmiracle,67healso introducedAgnesintohisvitaofCatherine,68andhemayhavebeenoneofthereasonsforCatherine'sinterestinAgnes,whichisreflectedinherletters,inthe Dialogue,andinhervisitstoAgnes'smonastery.69HisLifeofCatherinecertainlylaysmorestressonherinabilitytoeatthansheherselfdoesinherletters.For example,althoughRaymondandCatherineagreeontheimportancetoherofMaryMagdalen,RaymondsaysatleastthreetimesthattheMagdalenisamodelfor CatherinebecausetheMagdalenfastedforthirtythreeyears,70whereasCatherineherselfalwayspresentsMaryMagdalenasamodelbecauseshestoodunderthe crossandwasinundatedwiththebloodofChrist.71Furthermore,Raymond'saccountmayemphasizenursingandfeedingmiraclesandvisionssomewhatmorethan othersources.Raymond,forexample,placesavisionofChristasnursingmotherjustafterthecrucialmomentinwhichCatherinedrinkspusfromthediseasedbreast ofthetertiaryAndrea,whereastheanonymousMiracoli(Miracles)placesatthisturningpointavisionofmarriagewithChrist.72But,inthiscase,thereisnogreat needforskepticismCatherine'sownlettersarefilledwithimagesofnursingfromthebreastofChrist.73Thus,regardlessoftheinterestRaymondandothermale advisersmayhavehadinassociatingimagesoffeedingandnursingwith


womensaintsorinreveringtheirselfsacrificethroughfasting,boththewidevarietyofextantsourcesandCatherine'sownwordsmakeclearthecentralityoffoodin herspirituality. IfwecantrustRaymond'saccount,CatherinewashermotherLapa'stwentythirdchild,theonlyoneLapanursedatherownbreastandlaterherfavorite.Catherine's twinsister,Giovanna,wassentouttoawetnurseanddied.Thelastchild,borntoLapawhenCatherinewasweaned,wasgiventhenameofthedeadtwin.No particularlysubtlepsychologicalanalysisisnecessarytosuggestthatsuchaconfigurationofevents(i.e.,thedeathofone'ssisterbecauseonewaschosenfornursing andtheconstantreminderthenofthedeadtwininthenameoftheverychildwhosupplantedoneastheyoungest)mightpreconditionafavoredgirlchildtoguiltand guiltassociatedwithfoodandnursing.Moreover,Raymondreports(andthereisnoreasontodoubtthis)thatCatherine'soldersisterBonaventurastarvedherselfafter marriagebecauseofthedissolutebehaviorofherhusband74afastingthatsuccessfullymanipulatedtheyoungmanintoreformandthatthissameBonaventura latertemptedCatherineintodisplayingthemildvanityofelegantdress.ShortlyafterCatherineagreedtomakeherselfpretty,Bonaventuradiedinchildbirth.(Lapa's lastchild,Giovanna,calledNanna,diedaboutthesametime.)75CatherinethushadinherbelovedsisterBonaventuraagraphicillustrationofthesuccessthatfasting couldachieveandofthedangersofmarriageandpregnancy.ItdoesnotseemsurprisingthatwhatevertheexactchronologyofCatherine'semergingvocation,she rejectedmarriageandfood.76Furthermore,sinceonesourcereportsthattherewastalklaterofmarryinghertoBonaventura'swidower,wemayalsosuspectthat Catherinefeltguiltaboutsurvivingasareplacementforbothhersistersandthusdeterminedtosubstitutefortheirsufferingratherthanfortheirpleasure.77 Catherineclearlybeganfastingasachildanddevelopedadistasteformeatquiteearly.78ShetooktheDesertFathersasmodels.(Severalsourcestellofherrunning awaytoacaveasalittlegirl.)79Shethendevelopedanintenseadolescentconflictwithherfamily,especiallyhermother,overherasceticismandherrefusalto considermarriageattheheightofthisconflictshecutoffherhair,shescaldedherselfatthehotbathstowhichshewastakenonvacation,andshedevelopedapox fromwhichshemadenoefforttorecover.Inthecourseofthestrugglewithherfamily,Catherinewentthroughaperiodofwithdrawalduring


whichshepracticedextremesleepdeprivationaswellasselfstarvation.BothRaymondofCapuaandThomasAntoniideSenis(alsoknownasCaffarini)associate foodvisionsvisionsoffruittreesorofnursingfromthesideofChristwiththisperiodofherlife,althoughtheydonotgivethesamefoodvisions.80 RaymondreportsthatChristsummonedCatherineoutofherwithdrawalbycommandinghertoeatagainwithherfamilyattable,somethingshewasphysicallyunable todo.81Hesaysthatshespokeofthepainofeatingas"dealingoutjustice[i.e.,punishment]tothismiserablesinner[i.e.,herself]"82andthatshefocusedallher hungerontheeucharist.83SeveraleyewitnessesalongwithRaymondreportseeinghershovetwigsdownherthroattobringupthefoodshecouldnotbeartohave restinherstomach.Otheraccountsreportspontaneousvomiting.TheMiracolidescribesCatherine,likeAlpas,chewingandsuckingmorselsoffoodwhichshethen spitout.84Raymondwrote:

Thehabitofreceivingcommunionpracticallyeverydaystruckrootinherandbecamepartofherlife....Herlongingformoreandmorefrequentcommunionwassointensethat whenshecouldnotreceiveitherverybodyfeltthedeprivation,andherforcesseemedtodroop....Afterthevisionjustdescribed[i.e.,thevisionofdrinkingfromthewoundin Christ'sside],andespeciallywhenevershereceivedHolyCommunion,averytorrentofheavenlygracesandconsolationsfloodedhersoul.Theseweresoabundantthattheir effortsbrimmedoveruponherbodyalso,checkingthenaturalflowofitsvitaljuices,andsoalteringtheactionofherstomachthatitcouldnolongerassimilatefood.Indeed,the takingoffoodbecametohernotmerelyunnecessarybutactuallyimpossible,excepttotheaccompanimentofgreatbodilysuffering.Iffoodwaseverforceddownherthroat, intensepainfollowed,nodigestiontookplace,andallthathadbeenviolentlyforceddownwasviolentlyforcedbackagain. ...Imyselfsawithappen,notonce,butagainandagain,thatheremaciatedbodywouldbereducedtothelastextremity,unabletotakeanythingtorestoreitsforcesbutadrink ofcoldwater...andthensuddenlyshewouldseize...anopportunityoftakingonsomeworkforthehonorofGod'snameorthegoodofsouls,andlikeaflash,withoutthehelp ofanyotherrestorative[i.e.,withouteating],...allherforceswouldrevive.85



toananonymousdetractor(probablyin1373or1374)bysayingthatshemadeanefforttoeatonceortwiceadayandsuggestingthatGodsenttheinfirmitytocure her"gluttony"(elvitiodellagola).87RudolphBellhascarefullydocumentedthestagesofherinedia.Fromaboutagesixteen,shesubsistedonbread,water,andraw vegetables.Fromabouttwentythreeshegaveupbread,survivingontheeucharist,coldwater,andbitsoffood(mostlybitterherbs)thatshesuckedandthenspitout orswallowedandvomitedup.(Raymondcallsthis"eatingnothing.")InJanuary,1380,whenshewasaboutthirtythreeyearsold,shegaveupwaterforanentire month,offeringhersufferingasexpiationforthecrisisofthechurchinItaly.AlthoughsheendedhertotalfastinFebruary,shediedonApril29,1380,emaciatedand wrackedbystomachpains.88 Catherineclearlylosttheabilitytoreadbodilysensationsinwhatweconsideranormalmanner.Forexample,sheseemstohaveseenanyhungerpangsas"greed,"to havelosttheabilitytofeel"cold,"andtohavefeltpanicatthepassageofanyfooddownherthroat.89Sometimessheseemscutloosefromanyordinarysenseofego boundariesatall,aswhensheblamesherselfforRaymond'scowardiceorforalltheillsoftheworld.90Herhagiographerscommentonher"restlessenergy"and sleeplessness,whichincreasedassheatelessandless.91Onemightinterpretasbingeeatingherpatternoflongfastsfollowedbyeatingseveraltimesaday92orher practiceofforcingherselffirsttoeatandthentovomit.Moreover,shedevelopedacomplexcasuistryaboutherselfstarvation,arguingtoherfirstconfessorandlater toRaymondthat,sinceeatingcausedhertorture,itwasthesinofsuicideforhertoeatafarworsehomicideoftheselfthanstarvingoneself,becauseitwas homicidebygreed.93Sympatheticscholarshavesometimessuggestedthatsheprogressedfromviewingasceticpracticesasanendtoseeingthemasameanstokill thewill,andherletterssuggestthis.94ButalthoughshewrotetoheranonymouscorrespondentthatsheprayedtoGodtoremovehereatinginfirmity,itwasexactly herconsideredandmatureunderstandingofitasaninfirmity(ratherthanavoluntarypracticeoradelusionofthedevil)thatallowedhertoretainthebehaviorwithout anyefforttoalterit.ApassageintheDialoguewhereshesaysthatAgnesofMontepulcianowasabletosurviveonvegetablesaloneonlybecauseshewas''perfect" suggeststhatCatherinemayhaveseen(andcultivated)herownnoneatingasamarkofGod'sfavor,despiteherprotestations


thatitwasanabnormalphysicalcondition,notareligiouspracticeatall.95 AfterCatherine'speriodofwithdrawalintoacellinherfather'shouse,96sherejoinedherfamilyandplungedintoacombinationoffasting,sleeplessness,and hyperactivity,particularlyfrenetichouseworkandfeedingofothers.Shedidthelaundryatnight.Whenthehouseholdservantgotsick,Catherinecarriedoutthe servant'sworkandnursedherinherillnessaswell.97Shegaveawaygreatquantitiesoffood,andononeoccasion,whensheangeredherfatherbygivingawaythe bestwine,Godmiraculouslymadethecaskflowagain.98Thetenyearsofherextremeinediawere,byallaccounts,filledwithcaringforthepoorandsick,oftenby preparingfoodforthematoddhours,99andherchiefandrepeatedmiracleswerecuresofillness(thechiefmiracleperformedbyallsaints,ofcourse)andmiraculous feedingsorfoodmultiplications.100Raymonddrawstheanalogybetweenoneofhermiraclesandthegospelfeedingofthefivethousand.101InthemiracleofAlessia's corn,thefoodmultiplicationwasthreefold:first,sourwheatturnedsweetsecond,theflourmademorebreadthanitshouldhavefinally,theloavesthemselves multiplied.102CatherineherselfintheDialoguerevealsherowninterestinfeedingmiraclesbyrecountingthoseofDominicandAgnes,althoughherbasicconcernin thetreatiseisspiritualteaching,notmiracles.103ThomasAntoniideSenisreportstwooccasionsonwhichshemiraculouslyrestoredbreastmilktowomenwhose breastshadgonedry.104Moreover,Catherineoftencombinedhealingwithfeeding.Forexample,shegavewinetosomeoneshecured,andshediagnoseda possessedmanasneedingfood.105Inthemostvividlydescribedofthemiraclesthatfollowedherdeath,Catherinemiraculouslypreparedthefamilydinnerfora womanwhohadgonetochurchinsteadofcookingforhersons.106Raymond,inrecountingherfeedingmiracles,underlinesboththecontrastbetweenherownclosed bodyandherbountyinfeedingothers,andthefactthatfeedingisamaternalroleparalleltogivingbirth.Hesays:
Thewholecitywasincommotion.Everybody...flockedtocatchsightofher."Whatawoman!"theysaid."Onewhodrinksnowineherself,butcanbyamiraclefillwithwinean emptycask!"107 Takenote,dearReader[ofthismiracleinwhichbreadismultiplied].HowgreatmusthavebeenthemeritofthismaidenwhentheQueenofHeavenherselfassistedherinmaking breadforherchildren.Insodoing

Page171 theMotheroftheWordofGodgaveustounderstandthat,asthroughCatherineshesupplieduswithsuchwholesomebreadtofeedourbodies,sotooshepurposedbymeans ofhertosupplyusalsowiththewordofsalvationwhichisthebreadthatfeedsthespirit.Andindeedallofus,,habituallycalledCatherine "mother."...Shetrulywasamothertous,whocontinuallygavebirthtousfromtheuterusofhermind,enduringforusthegroansandpangsoflabor[nosnonabsquegemitibus etanxietatibusparturiebatexuterosuaementis],andfedus[nosnutriebat]assiduouslyonthebreadofsoundandsavingdoctrine.108

Indeed,Catherinesawhersuffering(whichincludedherpainfulandgrowinginabilitytoeat)asservice.Severalsourcesreporthermiraculous"death"and "resurrection,"andtheMiracolisaysexplicitlythatsheagreedtocontinuelivingonlybecausetheVirginMarypromisedthatGodwouldfreesoulsfrompurgatory becauseofherpain.109Shetriedtosubstituteherownagoniesforherfather'stimeinpurgatory.110Ontheoccasionofhermother's''death"withoutconfession CatherinesimplyinsistedthatGodbringLapabacktolifebecauseGodhadalreadyagreedtosaveCatherine'sfamilyasarewardforhersuffering.111Like Hadewijch,Lutgard,BeatriceofNazareth,LukardisofOberweimar,andMargaretofCortona,CatherinesawhersufferingasquiteliterallymergedbothwithChrist's agonyonthecrossandwiththepainsofpurgatory.Shethereforeknewwithutterconfidencethatherpainsdidsavesouls. ServingaswellassufferingthuslayattheheartofCatherine'slifebothwereexplictlyunderlinednotonlybywhatshedidbutalsobythemaleswhochronicledher storyandcorrespondedwithher.Repeatedlytheyemphasizeherfoodasceticism,usuallyadmiringlyrepeatedlytheycallher"mamma"repeatedlytheyspeakofher innursingmetaphors.Forexample,inhispanegyricwrittensoonafterherdeath,WilliamFlete,anEnglishhermitofconsiderablereputation,reportedthesweetodor thatcamefromherclothesduringlife,thebloodthatflowedfromhermouthinhereucharisticecstasies,theagonyshesufferedwhensheattemptedtoeat,andthe "food"sheofferedtoher"sons"byherholywords.112 AccountsofCatherine'slifeaccentuatenotonlyherfoodabstentionandfeedingofotherstheyalsounderlinehersubstitutionofthefilthofdiseaseandthebloodof Christ'sagonyforordinaryfood.Severalofherhagiographersreportthatshetwiceforcedherselftoovercomenausea


bythrustinghermouthintotheputrifyingbreastofadyingwomanorbydrinkingpus,andthereportsstresstheseincidentsasturningpointsinherdevelopinginedia, hereucharisticcraving,andhergrowingcompulsiontoserveothersbysuffering.113ShetoldRaymond:"NeverinmylifehaveItastedanyfoodanddrinksweeteror moreexquisite[thanthispus]."114

[And]onthenightfollowing...avision[ofChristwithhisfivewounds]wasgrantedtoherasshewasatprayer...."Mybeloved,"[Christ]saidtoher,"youhavenowgone throughmanystrugglesformysake....Previouslyyouhadrenouncedallthatthebodytakespleasurein....Butyesterdaytheintensityofyourardentloveformeovercame eventheinstinctivereflexesofyourbodyitself:youforcedyourselftoswallowwithoutaqualmadrinkfromwhichnaturerecoiledindisgust....Asyouthenwentfarbeyond whatmerehumannaturecouldeverhaveachieved,soItodayshallgiveyouadrinkthattranscendsinperfectionanythathumannaturecanprovide...."Withthat,hetenderly placedhisrighthandonherneck,anddrewhertowardthewoundinhisside.''Drink,daughter,frommyside,"hesaid,"andbythatdraughtyoursoulshallbecomeenraptured withsuchdelightthatyourverybody,whichformysakeyouhavedenied,shallbeinundatedwithitsoverflowinggoodness."Drawnclose...totheoutletoftheFountainof Life,shefastenedherlipsuponthatsacredwound,andstillmoreeagerlythemouthofhersoul,andtheresheslakedherthirst.115

Fromthattimeon,saysRaymond,shecouldnotdigestordinaryfood.116But,althoughshecouldswallownocorporealfood,shefeastednotonlyonpusbutalsoon theeucharist.117 ThevariousaccountsofCatherine'slifeallstresshereucharisticdevotion.Likeotherfastingwomen,Catherinesubstitutedfrequentcommunionforordinaryeating, althoughsheencounteredcriticismforthisfromconfessors,family,andherfellowtertiaries.118LikeMargaretofCortona,shedetectedanunconsecratedhost,yet alsolikeMargaretshereveredpriestspassionatelyfortheirabilitytocelebratemass.119Raymondrecountsherecstasies,trances,frenzies,bleedings,andtearsatthe eucharist,andheassociateshercravingforChrist'sblood,likeherdrinkingofpus,withanursingChrist.120HereportsoneoccasiononwhichGodinspiredher confessortocelebratebecauseofCatherine'sdesperateneedtocommunicate.LaterCatherinesupposedlysaid(inatraditionalmetaphor,found,forexample,inthe AncreneRiwleandtheRevelationsofGertrudeofHelfta):

Page173 Father,doyouknowwhattheLorddidtomysoulthatday?Hebehavedlikeamotherwithherfavoritechild.Shewillshowitthebreast,butholditawayfromituntilitcriesas soonasitbeginstocry,shewilllaughforawhileandclaspittoherand,coveringitwithkisses,delightedlygiveitherfullbreast.SotheLordbehavedwithmethatdayhe showedmehismostsacredsidefromafarandIcriedfromtheintensityofmylongingtoputmymouthtothesacredwound.Afterhehadlaughedforalittlewhileatmytearsat leastthatiswhatheseemedtodohecameuptome,claspedmysoulinhisarms,andputmymouthtowherehismostsacredwoundwas,thatistosay,thewoundinhisside. ThenwithitsgreatlongingmysoulenteredrightintothatwoundandfoundsuchsweetnessandsuchknowledgeoftheDivinitytherethatifyoucouldeverappreciateityou wouldmarvelthatmyheartdidnotbreak,andwonderhoweverImanagedtogoonlivinginthebodyinsuchanexcessofardourandlove.121

WhenwecompareRaymond'saccountofCatherine'swordswithCatherine'sownletters,wefindthatRaymondhasnotmisledus.TheimageofthenursingChristis oneofherfavoritemetaphorsandiscloselyassociatedwiththeeucharist.122ButinCatherine'swordsthereisadifferentemphasis,onereminiscentofAngelaof Foligno's.MuchmorethaninRaymond'sparaphrase,Catherineherselfstressesservice,thedrinkingofpainaswellascomfort,andtheactiveseekingofbreast (Christ)bytheinfant(soul).123ShewritestoaFlorentineabbess:

Wecannotnourishothersunlesswenourishourselvesatthebreastsofdivinecharity....Yes,mother,wemustdoasalittlechilddoeswhowantsmilk.Ittakesthebreastofits mother,appliesitsmouth,andbymeansofthefleshitdrawsmilk.Wemustdothesameifwewouldbenourished.WemustattachourselvestothebreastofChristcrucified, whichisthesourceofcharity,andbymeansofthatfleshwedrawmilk.ThemeansisChrist'shumanitywhichsufferedpain,andwecannotwithoutpaingetthatmilkthatcomes fromcharity.124

AgainandagaininthelettersandintheDialogue,CatherinedescribestheholysoulclimbingupChrist'sbody,seekingthebreast,anddrinkingbitternessaswellas comfort,likethemedicineasickchildsometimestakesinwithitsmother'smilk.125IntheDialoguesheputsthefollowingwordsintoGod'smouth:
NowAdam'ssinoozedwithadeadlypus,butyouweretooweakenedtodrainityourself.Butwhenthegreatdoctorcame(myonlybegottenson)hetendedthatwound,drinking himselfthebittermedicine....Andhe

Page174 didasthewetnursewhoherselfdrinksthemedicinethebabyneeds....Mysonwasyourwetnurse,andhejoinedthebignessandstrengthofhisdivinitywithyournatureto drinkthebittermedicineofhispainfuldeathonthecrosssothathemighthealandgivelifetoyouwhowerebabiesweakenedbysin.126

InadditiontothemanyeucharisticmiraclesandvisionsrecountedbyCatherine'shagiographers,wehaveCatherine'sowndescriptionsofthecentralityoftheeucharist. Sheurgesanumberofhercorrespondentstofrequentcommunion.127IntheDialogue,shetells,inrichlymetaphoricallanguage,ofhervisions.Shespeaksofsmelling thestenchofsin,oftastingthefragranceofthesacramentshesaysthatthetasteofbloodwas"wonderfullypresentto[her]mouthandbodilytasteforseveraldays" afterreceiving.128ShesaysexplicitlythatGodprovidestheeucharistasasubstitutefor"heavyphysicalbread,"whichexcitesgluttonyandlust.Shealsosaysexplicitly thatministers,whomsherespectsandfearsbecauseoftheircontroloftheholyfood,sometimesdenythesoulthefooditcraves.129Andshetellsoftwomiraclesin whichChristfedherdirectlyinvisionsbecauseserversorcelebrantswouldnot.130 ThevisionsthatCatherine'sbiographersassociatedwithturningpointsinherlifeallhadastheircentralthemetheredemptionofhumanityasphysicalitybythe substitutionofChrist'sfleshforhumanfleshliness.Raymondreported,forexample,thatJesusexchangedheartswithCatherineandtookatunicoutofhissidetokeep herwarm.131JustasChristenabledLutgardofAywiresandDoucelineofMarseillestoavoidordinarybodilycontactwithothers,yetdrewthemintohisown physicalitythroughthefusionofmouthtomouthandhearttoheart,soChristenabledCatherinetofusewithhisbody.132Noteveryvisionisreportedbyall biographersandnotallareemphasizedbyCatherineherself,133butwherewecancompareherowndescriptionswiththoseofherhagiographers,theemphasison redeemedfleshandphysicalitybecomesevenmorestriking.Forexample,severalsourcestellusthatasachildshesawavisionofChristasbridegroomandpope(or bishop),andthat,aftershemarriedChrist(aneventclearlymodeledonCatherineofAlexandria'smysticalmarriage),sherejectedearthlybridegrooms.134Inher hagiographers'accounts,Catherinewasmarriedwitharingofsilverorgoldandjewels,whichRaymondsaysshecouldalwayssee.ButCath


erineherself,inletterafterletter,sayswedonotmarryChristwithgoldorsilverbutwiththeringofChrist'sforeskin,givenintheCircumcisionandaccompaniedby painandthesheddingofblood.135ThusthosewhoadmiredCatherinesawherasputtingonquiteliterallythefleshofChrist,which,asholyflesh,protectedherfrom theordinarybodilysensationsofhungerandthirstandcold.ButCatherineherselfsawthatfleshlessassubstituteandprotectionthanasbloodandagony,shedforthe sakeoftheworld. AlthoughCatherineabhorredherownflesh,condemningitasa"dungheap,"136shesawthefleshlinessofChristnotassomesortofmiraculousprotectiontosaveus fromhumanvulnerabilitybutasthe"way"or"bridge"toleadustosalvationthroughsuffering.137SheevensaidthattheringoffleshwithwhichChristmarriesusinthe Circumcisionisasignthatheisthespouseofourhumanity.138Thus,hatefulasbodymayhavebeentoCatherine,itwasbodythatshesawasunitingustothebody ofGod.AnditunitedustoGodbysuffering.139 Thethemeofsuffering,whichringsthroughoutCatherine'svoluminouscorrespondence,is,ofcourse,atraditionalChristiantheme.Indeedthereisprobablynota singleoriginalimageinallthehundredsofletters.ButnoonewhohasreadCatherine'sworkcanfailtorealizethateatingandbloodweresoprominentinher interpretationofreligiousexperienceastogiveauniquenotetoherwriting,despiteitsessentiallyderivative,evenmonotonous,content. Metaphorsofeating,drinking,hungering,andvomiting,offood,blood,tables,andservantsarecentralinCatherine'swritings.140ToeattoCatherinemeanstobeor tobecome,totakeinortolove.HerstandardformulationofChristianobligationisto"eatatthetableofthecrossthefoodofthehonorofGodandthesalvationof souls."141Mostfundamentally,forCatherinetoeatandtohungerhavethesamemeaning:oneeatsbutisneverfull,desiresbutisneversatiated.142Bothareactive, notpassive,images.143Bothstresspainmorethanjoy.144Bothmean,mostbasically,tosufferandtoservetosufferbecauseinhungeronejoinswith,"eats,"Christ onthecrosstoservebecausetohunger/sufferistoexpiatethesinsoftheworld.ForCatherine,thehungeringofordinaryChristiansisservicebecauseitfusesnot onlywiththesufferingsofthoseinpurgatorybutalsowiththedeaththroesofChristthatarealsothebleeding/feedingofanursingmother.145ToalaymanCatherine wrote:

Page176 Seatyourselfatthetableofthecross....There,allinebriatedwiththepreciousblood,takethefoodofsouls,sufferingpain,opprobrium,curses,villainy,hunger,thirst,and nudity....Youmustsufferpainandbeinshadow.Mysoulknowsit,anditishungryforyoursalvation.146

[Jesus]madeofhisbloodadrinkandhisfleshafoodforallthosewhowishit.Thereisnoothermeansformantobesatisfied.Hecanappeasehishungerandthirstonlyinthis blood....Amancanpossessthewholeworldandnotbesatisfied(fortheworldislessthanman)untilbloodsatisfieshim,foronlythatbloodisunitedtothedivinity....Eight daysafterhisbirth,ChristspilledalittleofitintheCircumcision,butitwasnotenoughtocoverman....Thenonthecrossthelance...openedhisheart.TheHolySpirittellsus tohaverecoursetotheblood.... Andthenthesoulbecomeslikeadrunkenmanthemorehedrinks,themorehewantstodrinkthemoreitbearsthecrossthemoreitwantstobearit.Andthepainsareits refreshmentandthetearswhichithasshedforthememoryofthebloodareitsdrink.Andthesighsareitsfood.147

DearestmotherandsistersinsweetJesusChrist,I,Catherine,slaveoftheslavesofJesusChrist,writetoyouinhispreciousblood,withthedesiretoseeyouconfirmedintrue andperfectcharitysothatyoubetruenursesofyoursouls.Forwecannotnourishothersiffirstwedonotnourishourownsoulswithtrueandrealvirtues....Doasthechild doeswho,wantingtotakemilk,takesthemother'sbreastandplacesitinhismouthanddrawstohimselfthemilkbymeansoftheflesh.So...wemustattachourselvestothe breastofthecrucifiedChrist,inwhomwefindthemotherofcharity,anddrawfromtherebymeansofhisflesh(thatis,thehumanity)themilkthatnourishesoursoul....Foritis Christ'shumanitythatsuffered,nothisdivinityand,withoutsuffering,wecannotnourishourselveswiththismilkwhichwedrawfromcharity.148

Divinegoodnesshasplacedyouinthemysticalbodyoftheholychurch,hasnourishedyouonthebreastofthisgentlespouse,sothatyoucaneatonthetableofthecrossthe holyfoodofthehonorofGodandthesalvationofsouls.Itwantsyoutobenourishedonlybythecross,byfatiguesofbodyandanguishesofdesire.150


Toanothercardinalsheexplained:"GivethebloodofChristtoyoursoulthatitmaybearoused...andruntothebattletofightmanfully....Lether[yoursoul]seat herselfatthetableofthecrossandlethertheretakethefoodofsoulsforthehonorofGod,sufferingwithpatience,bearingthefaultsofneighboringreatcompassion, andacceptingallinjustice."151 Catherinestressesexplicitlythatoneshould"eatsoulsonthetableofthecross"inplaceofordinaryfood.152ShedescribesherprayersandsufferingforRaymondby saying:"Sweetestfather,yoursoul...hasbecomefoodtomeandnomomentpassesinwhichIdonottakethisfoodonthetableofthesweetsacrificedLambwith ardentlove."153Sometimesthespiritualfoodofwhichshespeaksisbreadormeat.ShecallsChristthebreadofangels.154Sheevenspeaksoftheeucharisticlamb as"roastednotboiled"onthe"spitofthecross.''155AndinseveralletterssheelaboratestheunusualTrinityoftable(Father),food(Son),andservant(Holy Spirit).156ButmuchmorefrequentlyinCatherine'susagethesoul"eats"liquidsmilkorwineorblood.AndbloodisCatherine'scentralimage.Almostallherletters beginwithgreetingsinthesacredblood,andshescreamedout"Blood!blood!"onherdeathbed.157AlthoughdevotiontothebloodofChristhadalonghistoryinlate medievalItalyandChrist'sbloodwas,toearlierdevotees,mostfundamentallyasymbolofthewashingawayofsin,bloodtoCatherinewasfoodorlife.158Blood "feeds"or"iseaten"inherlettersalmostasfrequentlyasit"cleanses"or"washes."159TwoaspectsofthereligiousworldofthefourteenthcenturyasCatherine experiencedithelpexplainwhybloodasfoodwascentraltoherthought:herreverencefortheclergy,andherdevotiontothehumanityofChrist. Catherinereveredpriestsas"littlechrists"herawe,likeMargaretofCortona's,centeredontheircontroloftheeucharist,whichshecraved.160ButinCatherine'sday thecupwasdeniedtothelaityaltogether,andCatherine'sextravagantrespectforpriests'authoritythusfocusedontheircontrolofandaccesstotheawesomeand taboochalice.Itissignificantthatsherepeatedlyreferredtoclergyas"ministersoftheblood,"not"ofthebody."161Shecalledthepope"vicarofChrist'sblood"and saidthatheheld"thekeysoftheblood."162Ineucharisticmiracles,itwasbloodthatremainedinhermouthorpouredfromit,althoughwhatsheactuallyreceivedwas bread(interpreted,ofcourse,asbothelementsinthetheologicaldoctrineofconcomitance).163 Bloodmayalsohavehad,toCatherine,otherassociationswithan


authorityandpowersheherselfwieldedonlyindirectly,throughprayerorpersuasion.Bloodwasingeneralamorepublicandsocialsymbolthanbread,aswellasa moreambivalentsymbol.Breadsymbolizedhouseholdandcharityandsupportoflife,butbloodsymbolizedwar,civilstrife,andexecutions.Moreover,itwasthe supportoflifeevenmorebasicallythanbread,becauseitcoursedthroughtheveinsaslifeitself.164InthefamousincidentinwhichCatherinestoodbeneaththe scaffoldtoreceivetheheadofayoungmanexecutedforapoliticalcrime,thebloodthatcoveredherandsmelledsosweetwasclearlyasymbolofpoliticsandthe publicarena,ofsufferingandinjustice,andoflifeitselfallofwhichcouldberedeemedonlybyassimilationtoChrist'sinnocentblood,onwhichwefeedinsuffering andservice.165 Catherine'scravingforbloodwasnotmerelyacravingforencounterinChristwithallthatwasdeniedhersociallyandpolitically:thechalice,thepoweroftheclergy, thepublicarena.ShealsocravedbloodbecauseshecravedidentificationwiththehumanityofChrist,andshesawthishumanityasphysicality.Althoughscholarshave sometimesseenthespiritualityofalllatemedievalwomenas"erotic"or"nuptial,"166Catherine'ssenseofthefleshisextremelyunerotic.Shewrites,especiallyto women,of"puttingonthenuptialgarment,"butthephrasemeanssuffering.167InherrepeateddescriptionsofclimbingupChrist'sbodyfromfoottosidetomouth,the bodyiseitherafemalebodythatnursesorapieceoffleshthatoneputsononeselforsinksinto.168PhysicalityistheforeskinoftheCircumcisionfleshthat bleeds.169CatherineunderstoodunionwithChristnotasaneroticfusingwithamalefigurebutasatakinginandatakingonabecomingofChrist'sfleshitself. Infact,CatherineclearlyassociatedChrist'sphysicalitywiththefemalebody,underliningtherebybothhercapacityforassimilationtoChristandhercapacity,likehis, forservice.Shecalledhumanity"Adam"aswellas"Eve,"ofcourse.170But,adoptingboththegenderstereotypesofherdayandtheageoldChristiannotionof femaleweakness,sheassociatedfleshlinessandsensualityespeciallywith"woman."171ShestressedrepeatedlythatMaryprovidedinherwombthestuff(i.e.,the menstrualmatter)fromwhichtheSpiritfashionedChrist'shumanbody.172AndsherepeatedlycalledChrist'swoundabreast.173Indeed,toCatherineChristwasa nursingmothermoreoftenthanabridegroom. Catherine'simageofChristasmaternal,whichhadalongancestryintwelfthandthirteenthcenturyspirituality,mustbeunderstood


againstthebackgroundofcontemporaryphysiologicaltheory.174Medievalnaturalphilosophersthoughtthatbreastmilkwasblood.Thusbloodwasthequintessential foodanditwaspouredoutasfoodorprovidedasthebasicstuffoflifeonlybyfemalebodies.Therefore,asIshalldiscussatgreaterlengthinchapter9,thefemale bodywasanobviousimageforaGodwhodiedtogivebirthtotheworldandbledtofeedallsouls.Catherineherselfnotedexplicitlythatthefemalebodyisfoodand thereforeanappropriateimageforbothmaleandfemaleselfsacrifice.WhenshewrotetoherownnaturalbrotherabouthisobligationstoLapa,shestressedthata mother'sbodygivesfleshtoandfeedsitschild.175Shecontinuedthisthemewhenshedescribedcharity:

Onhowsweetamotherischarity!Shenourishesonherbreastthechildren[i.e.,thevirtues]towhomshegivesbirth....Sheisafood,whichnurturesthesoulinitshunger.... Andthesoul,consumedinthisfurnace,wantstoeatthefoodforever,andthemoreiteatsthemoreithungers.176

Shewrotetoacleric:"Befaithful.RunwithMary'sdesiretohonorGodandsavesouls....Guardyourownsoulandbodysoyoucannourishothersoulsandgive birthtothem."177 AttheheartofCatherine'sunderstandingof"eating,""hungering,"and"bleeding,"therefore,wasidentificationofservingwithsuffering.Forexample,Catherinewrote totheQueenofHungaryaboutacrusade:

Truly,noblemother,whenthesoulbeholdsthelambonthewoodoftheholycross,becauseofitsineffableloveforcreation,sheconceivessuchagreatloveforthesalvationof soulsthatshewouldgiveherselfupahundredthousandtimestodeathtosaveevenonesoulfrometernaldeath.AndonecannotmakeasacrificemorepleasingtoGodthanthis. Youknowthathelovesthisnourishmentsomuchthathedidnotfear,intakingiton,bitterness,suffering,death,oroutrage.Evenouringratitudedidnotstophimfromrunning, inebriatedandpassionateforoursalvation,totheopprobriumofthecross.SoIinviteyou...tothisfood.Youhavefoundtheplacewhereonemusttakeitandthefruitisripe.... TheplaceisthegardenofHolyChurch,andthereisplantedthetreeonwhichhangsthefruit,Christ.178

ToCatherine,sufferingwasservingbecauseChristhadbecomefleshafleshthat,bybleedinganddying,savedtheworld.Notresurrectionthenbutincarnationwas atthecenterofhertheology.179Itwasinsuf


fering,notintriumph,thatshesawherselfbecomingChristChristasfoodandChristasredemption.Heragoniesofstarvation,illness,andstigmataweretheagonies ofthecrossandofpurgatory.Suchsufferingwasfertileandgenerative,foritwasthesourceofsalvation.Asshewrotetooneofherconfessors:"Theimmaculatelamb [Christ]isfood,table,andservant."Thistable,saidCatherine,offeredthefruitsoftrueandperfectvirtues."Andwewhoeatatthattablebecomelikethefood[i.e., Christ],actingnotforourownutilitybutforthehonorofGodandthesalvationofneighbor."180 Thus,throughoutCatherine'sletters,herconcernforsavingsoulsthroughherownagonywasexpressedinthepairedmetaphorsoffeedingandfasting.Feedingand fastingwerecentralpracticesinherlifeaswell.Catherinerejectedfood,assherejectedherownfleshyetshegavefoodtothepoorandhungry.Andsheateboth pusandtheeucharist,confidentthatthebodyofGodandthebodiesofherneighborswere,forherselfandforothers,thewayofsalvation.Whenweturntotheother greatItalianCatherine,CatherineofGenoa,thetheoristofpurgatory,wefindasimilarconceptionofsufferingasservice.TothislaterCatherine,astoherforerunner, foodisthefundamentalmetaphorforsuffering,forservice,andforlove. ThreeworkssurvivethatreflectCatherineofGenoa'steachings,althoughnonewaswrittenbyher.Allthreewereputtogethershortlyafterherdeath,andtwo,the LifeandtheDialogue,arepartlyautobiographical.TheLifeisbasedonheractsandsayings,takendownafter1495byherconfessor,Marabotto,herspiritualson, EttoreVernazza,andpossiblyothers.TheDialogue,whichtreatsherinnerhistory,isprobablyacombinationofthreeworks.Inthelastpartanunknownauthor recountsandinterpretsCatherine'sfinalillnessanddeathinexcruciatingdetail.Thefirsttwopartsgenerallyagreedtobeofhigherliteraryqualityarealsoof uncertainauthorship.AnearlytraditionattributesthefirstparttoCatherineherself,butsomescholarsarguethatsheisunlikelytohavedictatedsuchasophisticated useofdialogueform.AllscholarsagreethatTheTreatiseonPurgatoryreflectsherownideasonpurgation,atleastinitsoriginalform(i.e.,thefirstsevenchapters). ItwasprobablywrittendownbyVernazzacertaintheologicalglosseswereintroducedbeforetheofficialpublicationin1551.181Thus,althoughnosinglesentenceof Catherine'sworkcanbetrustedasherownlanguage,thetreatisestakentogethergiveaclearpictureoftheinnerandouter


lifeofawomaninwhosepietyfasting,eucharist,andsufferingwerethecentralfoci.182 Bornin1447andrefusedpermissiontoenteraconventatthirteen,Catherinewasplungedintodepressionbyhermarriageatagesixteentoayoungnobleman, GiulianoAdorno.Herdespairatthemarriage,intowhichshewasforcedforfinancialandpoliticalreasonsbyanolderbrothertwoyearsafterherfather'sdeath,was perhapsincreasedbothbythefactthatGiuliano'sfamilywasanenemyofherownandbywhatlaterscholarshavecalledGiuliano'swastefulanddissolutebehavior. (Although"dissoluteness"ishardtoevaluateacrossthecenturiesandmightwellbeexacerbatedbyawife'sdepression,itiscertainthatGiulianosquanderedhisfamily money,forhewentbankruptabout1474,andthathehadamistressandanillegitimatechild.)Afterfiveyearsofsevereaccidiaandwithdrawal,Catherinemadean efforttoreturntosociallife.ShecollapsedintoevenmoreacutedepressionatChristmas1472.Anumberofthingsthenhappened. Manyscholars,wishingtoorganizemysticalandsaintlybiographiesaroundturningpointsandintoneatstages,seeasuddenconversionatherLentenconfessionof March,1473,andhersubsequentvisionofChristcarryingthecross.Itismoreaccurate,however,toseeaperiodofaboutthreeyears(orperhapslonger)during whichcertainexternalconstraintsonCatherine'slifewereremovedandsheforgedforherself,outofaperiodofsevereselfabnegation,anewlifepatterninwhich fasting,eucharisticdevotion,serving,andunionwithChristwerethecentralmotifs.183Thefirstmonthsaftertheconfessionandvisionof1473weremonthsofvirulent asceticism,includingacutefooddeprivationandillness.Then,betweenMarch,1473,andMarch,1476,Catherine'shusbandwentbankruptandCatherinelearnedof hismistressandillegitimatechild.Theseeventsnormallydeeplyhumiliatingwereperhapsfreeingtoawomanwhohatedhermarriage.Inanycase,theyprovided forheranopportunitytothrowherselfintocareofthepoorandsickandidentificationwiththeirsufferinganddestitution.By1476Giulianohadagreedtoachaste marriageby1478hejoinedherinvoluntarypovertyandinthehospitalworkinwhichtheyspenttherestoftheirlives.ItwasduringtheseyearsthatCatherine developedaregularpatternoffastingandeucharisticcravingshewaspermitteddailycommunionfrom1474on.184Thispatternlasteduntilshewasfiftytwoyears old,atwhichpointsherelaxedherrigidfastingbehaviorsimultaneously


withrelinquishingresponsibilityforhersoulintothehandsofaconfessorandspiritualdirector.185(Shehadspentheradultyearswithoutone.)Shediedatsixtythree, inanacuteillnessthatonceagainmadeeatingimpossible.186 LikeAngelaofFolignoandCatherineofSiena,CatherineofGenoainthelongperiodbetween1476and1499combinedperiodicinediawitheatingbothfilthand thebodyofGod.Moreover,likehertwopredecessors,sheexplicitlyconnectstheseformsofeatingandnoteating.Catherinetookinillnessandfilthbymouth.187 Shekissedatertiarysufferingfromplagueandcaughtthedisease.Sherubbedhernoseinpusandatescabsandliceinordertoovercomehernauseaatillness.188In theinitialcrisisafterMarch,1473,sheattackedherbodyferociously,adulteratingherfoodtokillhersenseoftaste.Shealmostcompletelyceasedtoeatandshetried tostopsleeping.Shewasafflictedwithatrocioushungerandthirst.After1476shesettledintoapatternoffastingeveryAdventandLentononlywater,vinegar,and salt,duringwhichperiodshewasunabletokeepfoodinherstomachwithoutvomiting.Sheappearstohaveworriedaboutherinedia,fearingitmightbeprideor morbidselfpunishment,foroneversionoftheLifereportsinpassingthatsheaskedherconfessorwhethersheshouldforceherselftoeat.189LikeCatherineofSiena, shedevelopedwhatappearstousabizarrerelationshiptobodilysensations,experiencingburningorextremecold,heaviness,convulsions,andinvisiblestigmata.190 Shesometimesbitorburnedherselfwhileintrances.191Shefelthungerandthirstsoextremeshelickedtheearthinagony,yetsheclaimedsheexperiencednodesire toeat.192Shespokeexplicitlyoftheneedtodestroywhatwewouldcalltheegoorbreakitsboundaries,insistingonusingweinsteadofthepronounIorher name.193YetboththeLifeandtheDialogueinsistonthecentralitytoherofeatingholyfood.Shetellsusthatthreedaysafterherconfessionof1473she"feltthepull ofHolyCommunion,whichfromthatdayneverlefther."194OneversionoftheLifeattributestohersentimentsthat,whetherauthenticorinauthenticforCatherine herself,aretypicaloflatefifteenthcenturyreligiouswomen:
WhenshewasatmassshewasoftensooccupiedinteriorlywithherLord,thatshedidnothearawordbutwhenthetimecametoreceivecommunionsheaccusedherself,and wouldsay:"Oh!myLord,itseemstomethatifIweredead,Ishouldcometolife,inordertoreceivethee,and

Page183 ifanunconsecratedhostweregiventome,thatIshouldknowitbythetaste,asoneknowswinefromwater."195

Shesaidrepeatedlythatshefelthungeronlyforcommunion.196 ThesecondofCatherine'sspiritualdialoguesweavestogetherthesethemesofeatingandnoteatinginawaythatclearlyimpliesthateatingpainandeatingChrist substituteforeatingordinaryfood.197Inthisdialogue,thepersonificationHumanity(i.e.,humanfrailty)firstattacksitsownneedforfriendsandforfood.Onceit conquersordinaryhunger,itallowsitselftodesiretruenourishment,andGodgivescommunion.HumanityisthensoinebriatedwithsweetnessthatSoul(another personification)isfrightenedandasksGodtoremovethefeelingsofbliss.CatherinecommentsthatSouldoesnotwantsweetnessorreward,butGodsendsit.She alsosuggeststhatGodsendsserviceofthesicktogiveHumanitysomethingtodo,198andshespeaksofservinginfoodmetaphors,as"kneadingbread"or "fasting,"199justbeforeshetellsofeating"liceasbigaspearls""manytimes."200Thus,inCatherine'slife,assheherselfinterpretsitintheDialogue,ordinaryfoodisa symbolforinept,rebelliousbody(whichsheoftencalls''humanity"[umanit]).201ButfoodisalsoasymbolofGod.Forfoodiseucharist,thatcelestialsweetness throughwhichthesoulachievesmysticalunion.Andfoodisthefilthandhorrorofsuffering,throughwhichonealsojoinsGodandservesone'sfellowcreatures.Desire forGodishungerinsatiablehunger.202ThefoodthatisGodandthefoodthatisneighborarethusthenourishmentwecrave,inebriatedyetunfilled. AtthecoreofCatherine'sspiritualityissuffering,thatparadoxicalsufferingwhichforher,asforHadewijchandBeatrice,isultimatepainandtheecstasybeyond.The sufferingispurgatory,andinasense,therefore,purgatoryitselfisbothChrist'sdeathagoniesonthecrossandtheagoniesofthesoulasitisannihilatedinthefiery bliss,thedevouringmouth,ofGod.203Catherine'spurgatoryisChrist'slove,withwhichwecanneverfullyjoin.ItisimitatioChristi,butanimitationeverfully achieved.Itexpiatesoursinsandthoseofothers,butitisnotsomuchaplaceoratimeasanexperienceofpurging,andwecouldnotwishitamomentshorter,for ourselvesorforothers.Catherinewrites:
Inpurgatory,greatjoyandgreatsufferingdonotexcludeoneanother....Andifthelivingweretoofferalmsforthebenefitofthesoulsinpurgatory,toshortentheassignedtime oftheirpurgation,stillthosesouls

Page184 couldnotturnwithaffectiontowatch,butwouldleaveallthingstoGod,whoispaidashewishes....Whathewillsforthemiswhatgivesthemjoy.204

ToCatherine,purgingisasufferingsovastthatinitfuseone'sowncleansing,one'sneighbor'sexpiation,andthedeathagoniesofChrist.Insufferingoneistherefore servingneighborandhungeringforGod. Catherinesaysexplicitlythatofallthemetaphorsonemightchooseforthismomentwhichisattheheartoftheuniverse,themetaphorsheprefersisthatofhungerfor bread.IntheTreatiseonPurgatoryshewrites:

JoyinGod...istheendofthesesouls....Noimageormetaphorcanadequatelyconveythistruth.Oneexample,however,comestomind.Letusimaginethatinthewholeworld therewasbutonebreadandthatitcouldsatisfythehungerofall.Justtolookatitwouldbetonourishoneself.Thatbreadiswhatahealthyman,withanappetite,wouldseek andwhenhecouldnotfinditoreatit,hishungerwouldincreaseindefinitely.Awarethatthatbreadalonecouldassuagehishunger,hewouldalsoknowthatwithoutithishunger couldneverabate.Suchisthehellofthehungrywho,theclosertheycometothisbread,themoretheyareawarethattheydonotasyethaveit.Theiryearningforthatbread increases,becauseitistheirjoy.Weretheytoknowthattheywouldneverseethebread,thatwouldbeperfecthell,thecaseofthedamnedsoulswhonolongerhopetoseethe truebreadandthetrueGod.Thehungrysoulsinpurgatory,however,thoughtheydonotseeasmuchofthebreadastheywouldwish,hopetoseeitandfullyenjoyitoneday. This,then,istheirsuffering,thewaitingforthebreadthatwilltakeawaytheirhunger.205

ThroughoutCatherine'steachings,hungerandfire(reflectingherownbodilyexperiencesofatrocioushungerandburningflashes)arethebasicimagesfordesireand forencounterwithGod.IntheLifeasinthePurgatory,wefindeatingbreadasanelaboratespiritualmetaphor.Inchapter32(ofthe1551edition)theannihilationof ordinaryfoodbyadevouringbodybecomesanimageforthepurificationevenannihilationoftheselfinmysticalunion.HeretherecorderofCatherine'ssayings reports:


Page185 passesawayforifnatureretainedit,havingnoneedofit,thebodywoulddie.Nowifthatbreadshouldsaytothebody:Whydoyoudeprivemeofmyexistence,forbymy natureIamnotsatisfiedtobethusreducedtonothingness?IfIcould,Iwoulddefendmyselffromthee,foritisnaturalforeverycreaturetopreserveitself,thebodywould answer:Bread,thybeingisdesignedformysupport,whichismoreworthythanthee,andhencethoushouldstbemorecontentwiththeendforwhichthouwastcreated,than withthyownbeingforifitwerenotforthyend,thybeingwouldhavenovaluebuttobethrownaside,assomethingworthlessanddead.Itisthyendwhichgivestheeadignity towhichthoucanstnotattainbutbymeansofthyannihilation.Ifthouwouldstliveforthyend,thouwouldstnotcareforthybeing,butwouldstsay:Quickly,quickly,takeme frommyself,andletmeattainmyendforwhichIamcreated."206

Christ'sblood,bothasdrinkandascleansingwater,wasalsoakeymetaphortoCatherine.ShereceivedavisionofthebleedingChristafterhertraumaticLenten confessionof1473.AndtheredactorofherLifereportsthat:
filledwithcompassionfortheblindnessofman,shesaid"Ifbytakingmybloodandgivingittomantodrink,Icouldmakeknowntohimthistruth[aboutlove],Iwouldgiveitall forloveofhim.Icannotendurethethoughtthatman,createdforthegoodthatIseeandknow,shouldloseit....IfIknewhow,Iwouldleavenothingundonetomakeknownhow dreadfulathingisthisprivationoftheloveofGod."207

ThusCatherineofGenoausedhungerasametaphorforinsatiabledesire,eatingasametaphorforlove,andbreadasasymbolofselfandofGod.Sheconsciously andexplicitlychosefoodashercentralimageformysticalunion.Moreover,Catherinelivedthesefiguresofspeech.Fasting,feedingothers,andfeastingonthe eucharistwerenot,toher,occasionalpractices.TheywerethewayshelovedherneighboranddrewnearherGod. Notallwomenwriters,ofcourse,madefoodsocentralanimageasdidHadewijch,Beatrice,andthetwoCatherines.TotheGermanmysticsHildegardofBingen, ElizabethofSchnau,GertrudetheGreat,andMechtildofHackebornitwasausefulmetaphorbutnotacentralonenorwasfoodacrucialimagetoJulianof NorwichorMargaretofOingt.AndMargaretPorete,whoseMirrorofSimpleSoulswascondemnedintheearlyfourteenthcentury,rejectedthewholetraditionof affective


spiritualitywithanattackon"works"(suchasfastingandcommunion)thatwentfarbeyondTauler'sorEckhart's.But,toallthesewriters(exceptMargaretPorete), thehumanityofChrist,understoodasphysicality,wascrucialandeucharisticdevotionwasimportanttothemall.208Moreover,thereareotherwomenwritersfrom theperiod,forexampleMechtildofMagdeburg,AngelaofFoligno,andMargeryKempe,towhomfoodpracticesandfoodimageswerefundamental.209Andinthe fourgreatwritersexaminedhere,food,hunger,eating,andfeedingwerefarmorevibrantandcompleximagesthantheyeverweretomalewriters,eventhosesuchas RuysbroeckandTaulerwhohelpedelaboratelatemedievaleucharisticdevotion.210Furthermore,toeachwomantheimageresonatedwithitsownparticularpower. Hadewijch'sunionwithGodwaseroticandanguishedherbasicfoodmetaphorwashunger.Beatrice'sunionwasinsaneandfrantichermetaphorsweredrinkingand bleeding.CatherineofSiena'sencounterwithGodwasinsufferingandservingherrichimagesrevolvedmostbasicallyaroundeatingandblood.ToCatherineof Genoa,unionwassuffering,evenannihilationthemetaphorwaseatingandbeingeaten.Whattiesthesedistinctivespiritualitiestogetheristhesamepatternwefindin women'slives,asseenbythemselvesandbymalebiographers.Itisathreefoldpattern:womenfast,womenfeedothers,andwomeneat(butneverordinaryfood). Womenfastandhungerbecomesanimageforexcruciating,neversatiatedloveofGod.Womenfeedandtheirbodiesbecomeanimageofsufferingpouredout forothers.Womeneatandwhethertheydevourthefilthofsickbodiesorthebloodandfleshoftheeucharist,thefoodsareChrist'ssufferingandChrist'shumanity, withwhichonemustjoinbeforeapproachingtriumph,glory,ordivinity.




6 FoodAsControlofSelf
Itisanoftendiscussedquestionwhyanorexianervosaissoconspicuouslylessfrequentinmalesthaninfemales.Itmaywellberelatedtopubescenceitself,tothepsychological effectsofthemalesexhormones....Itisquitepossiblethatthecharacteristicslavelikeattachmentofachildtothemotherismoreapttodevelopinagirlandeffortstosolve psychologicalproblemsthroughmanipulationofthebodyarealsoconsideredcharacteristicallyfemale.Itisprobablethatitisunusualforaboytobecaughtinthisdevelopmental impasse.Inaddition,malepubescencewillfloodaboy,evenonewhohasthistypeofattachment,withsuchpowerfulnewsensationsofamoreaggressiveselfawarenessthatthe eventofpubertymakesanewselfassertionpossible. HILDEBRUCH EatingDisorders (1973)1

Whyisfoodsocentralathemeinthereligiosityofmedievalwomen?Theansweriscomplicated,anditwillnotdotorushtoasingleexplanation.Indeed,the remainderofthisbookprovidesseveralanswersandgroupsthemintotwokinds.Inthischapterandthenext,Idescribethevariousfunctionsfoodservedfor womenthemanifoldwaysinwhicheating,feeding,andnoteatingenabledthemtocontroltheirbodiesandtheirworld.Inthelastthreechapters,Itreatthesymbolic meaningsfoodheldforwomenandthesignificance,forbothsexes,ofthenotionthatwomanisfood.Ifthereasoninginchapters6and7attimesfinds,inwordsand deeds,importthatmedievalpeoplewouldnothaverecognized,thefinalchapterstakeseriouslythesignificancesmedievalwomenandmenattributedtotheirown experience. Myfullexplanation,then,ismultifaceted.ButIcanbeginsimply.Foodisimportanttowomenreligiouslybecauseitisimportantsocially. Itisafactcrossculturallythatfoodisparticularlyawomancontrolledresource.Inthemajorityofcultures,foodpreparationisawom


an'srole.2 ItwascertainlysoinmedievalEurope.OneoftheearliestextantFrenchcookbooks,thefourteenthcenturyViandier,assumesthatbasiccookeryisdone bywomen.Theauthorsayshedoesnotdescribethepreparationofcertainitems,suchascabbage,leeks,andvealwithsaffronandpeppersauce,because"women andtheirmistressesandeveryoneknowhowtocookthem."3 But,beyondwomen,"everyone"didnotknow.WhenanelderlyParisianhusbandwroteanowfamous bookofhousekeepingadviceforhisyoungbrideabout1392,hisbookrevealedthathehimselfwasnotacook.Arecenthistorianpointsoutthathe"describescertain aspectsofcookeryanyworkingcookwouldhavetakenforgranted."4 Althoughthefirstcookbookswerewrittenbymenandthejobofchefinthewealthiest householdswenttomales,everyoneagreedthatthebasicsocialresponsibilityforfoodpreparationwaswoman's5 Indeed,cookingwassomuchawoman'srolethatitappeared,tomen,notmerelyarcanebutthreatening.Whenmedievalmenprojectedtheirhostilitytowardwomen intosuspicionofwhatwentoninthewomen'squarters,theyfrequentlyspokeofwomen'scontroloffood.6 Mensuspectedwomen(especiallywives)ofmanipulating thembyaddingpotionsorpoisonstotheirmeals.TheDecretumofBurchardofWorms,compiledbetween1008and1012,liststhespellsandincantationsresorted tobywomenmostoftheminvolvemanipulatingfoodforexample,increasingordecreasingthesexualardorofahusbandbyaddingtohisfoodsuchthingsas menstrualblood,semen,ordoughkneadedwithawoman'sbuttocks.7 Therearemanyreasonsfortheassociationofwomenandfoodpreparationthatisfoundinsomanycultures.Onereasonseemstobethebiologicalanalogy.Through lactation,womanistheessentialfoodproviderandpreparer.AsthenovelistEliasCanettiexpressesit:
Inafamilythehusbandcontributesfoodandthewifepreparesitforhim.Thefactthathehabituallyeatswhatshehaspreparedconstitutesthestrongestlinkbetweenthem. Themother...isthecoreandveryheartofthisinstitution.Amotherisonewhogivesherownbodytobeeaten.Shefirstnourishesthechildinherwombandthengivesither milk.Thisactivitycontinuesinalessconcentratedformthroughoutmanyyears....Herpassionistogivefood.8


Indeed,inanumberofcultures(e.g.,modernLatinAmerica,Indonesia)womenprepareandservefoodbutdonoteatwiththefamily.Inmostcomplexsocieties, evenupperclasswomenwhoarefreedfromthetaskoffoodpreparationstillhavetheresponsibilityofsupervisingthosewhocook.Thereiscertainlyreasontothink thateatingintheEuropeanMiddleAgeswasstereotypedasamaleactivityandfoodpreparationasafemaleone.Thesexeswereoftenseparatedatmedieval banquets,andwomenweresometimesrelegatedtowatchingfromthegalleries.9 ThehistoryofWesterncooking,asreflectedincookbooks,diaries,andmemoirs, suggeststhat"heavy"food,especiallymeat,wasseenasmoreappropriateformenandlighterfoodforwomen,10inpartbecausemeathad,forathousandyears, beenseenasanaggravatoroflust.11Cookbookscameincreasinglytosuggestthatwomenwhopreparedthemealshardlyneededtoeatatall.12Wenowknow thatsuchnotions,bythenineteenthcentury,actuallyproduceddietarydeficienciesinwomen13indeed,thetwentiethcenturyWesterncrazeforfemaledietingmay owesomethingtothisolderassumptionthatwomenpreparefoodandmeneatit. Thistraditionalassociationofwomenwithfoodpreparationratherthanfoodconsumptionhelpsustounderstandcertainaspectsofthereligioussignificanceoffood. Topreparefoodistocontrolfood.Moreover,foodisnotmerelyaresourcethatwomencontrolitistheresourcethatwomencontrolbothforthemselvesandfor others.InthelongcourseofWesternhistory,economicresourceswerecontrolledbyhusbands,fathers,uncles,orbrothers.Yethumanbeingscanrenounce,ordeny themselves,onlythatwhichtheycontrol.Thus,inperiodssuchasthelaterMiddleAgesinwhichworlddenialwasafavoritereligiousresponse,womenfounditeasier torenouncefoodthananythingelse(forexample,money,sexualactivity,orfamilyties).14Itwasfarmoredifficulttofleeone'sfamily,todenyafather'splansforone's betrothal,ortorefusesexualrelationstoahusbandthanitwastostopeating.Inperiodsinwhichcharityandserviceweredeeplyvalued,womenfoundfoodthe easiestthingtogiveaway.Slippingoutofthekitchenorbanquethallwithfoodforthepoorwasthemostconvenient,theleastostentatious,service.Moreover,both women'sfooddistributionandtheirfastingappearedculturallyacceptableformsofasceticism,becausewhatwomenordinarilydidmostvisiblyashousewives, mothers,orthemis


tressesofgreatcastleswastoprepareandservefoodratherthantoeatit.Yetifwomen'sfooddistributionorfoodavoidancebecameacuteenoughtodisrupttheir roleasfoodpreparer,itcouldwreakhavocwithsocialrelations.ItcouldthereforeapointtowhichIshallreturnbeanextremelyeffectiveformofmanipulation. Atthesimplestlevelofexplanation,therefore,wecansaythatmedievalwomenfastedandfedothersbecausepreparationanddistributionoffoodwerewomen's specialconcerns.Itisworthnotingthatinmanycultures,fastingasareligiousactivityisdoneprimarilybywomen,althoughfastingasscientificexperimentoras politicalprotestisusuallyperformedbymen.AmongEskimos,forexample,itiscustomaryforthehusbandtogooutfishingwhilethewiferemainsathomefastingfor agoodcatch.15InOldTestamentJudaism,fastingisalmosttheonlyreligiousactforwhichwomen(e.g.,Judith,Esther,Sarah,themothersofSamuelandSamson) areprominentmodelsofpiety.InIndia,wherethehungerstrikewasusedveryeffectivelybyGandhiandhisfollowersasapoliticalweapon,fastingisperformed primarilybywomenwhenitisofferedasareligiousactforprivateorfamilialgains.(Themostcommonpatternisforawomantofastinordertogainaspecific benefitforamalerelative.)16Gandhiinfactlearnedfastingfromhisdevoutmother,whoaddedfaststothealreadystrictHinduschedule.17IntheEuropeantradition also,thehungerstrikehasbeeneffectivelyusedbymenforpoliticalpurposes.ItsrecentpopularitywiththeIrishRepublicanArmyhasalongandspecifictradition behindit.MedievalIreland(likemedievalIndia)hadanactuallegalprocedureof"fastingtodestrain,"inwhichacreditorfastedagainstadebtortogainrepaymentora manfastedagainsthisadversarytogainrestitution.18InTudor/StuartEnglandandamongthePuritansintheNewWorld,publicfasts,proclaimedbythegovernment toexpiateorprotestparticularevents,becameincreasinglypolitical.The1774fastoftheMassachusettsandVirginiacoloniststoexpressdissatisfactionwithEngland wasthefirstmodernmasspoliticalprotestbyfasting.19But,aswehaveseen,fastingasanindividualactofworldrenunciationhasbeenmorecentralinthereligiosity ofEuropeanwomenthanofmen.20 Fastingandcharitablefooddistribution,andtheirmiraculouscounterpartssurvivingontheeucharistalone,foodmultiplicationmiracles,thefemalebodythatexudes foodorcuringliquidwerethus,inonesense,religiousexpressionsofsocialfacts.Theymanifestedinreligious


behaviorthesexualdivisionoflabor.Sincelatemedievalspiritualityvaluedbothrenunciationandservice,eachgenderrenouncedanddistributedwhatitmost effectivelycontrolled:mengaveupmoney,property,andprogenywomengaveupfood.Moreover,suchadivisionofreligiousresponseclearlysuitedmedievalmen. Severalscholarshavepointedoutthatlatetwelfthandearlythirteenthcenturywomen(e.g.,ClareofAssisiandMaryofOignies)whowishedtofollowthenewideal ofmendicantpovertythatis,torenounceeconomicsupportsweresimplynotpermittedeitherbytheirfamiliesorbyreligiousauthoritiestodoso.21Theolder aristocracyandthenewurbanpatriciatemightalloworencouragedaughterstowithdrawintoconventsorhermitcellsortoperformfastsandvigilsundertheirfathers' oruncles'orhusbands'roofs,butwomenwanderingandbeggingandlivingwithoutservantswenttoofar.SowomensuchasMaryandClareandIdaofLouvain substitutedfastingforotherwaysofstrippingtheselfofpleasureandsupport.ThethirteenthcenturyhagiographerThomasofCantimprcommentedexplicitlythat ChristinatheAstonishinggaveupfoodbecauseshehadnothingelsetogiveupforChrist.22Betweenthetwelfthandthesixteenthcentury,beguines,tertiaries,devout laywomenwhoresidedinthehousesoffathersorspouses,andevennunswhoseconventlifeseemedtotheminsufficientlyausterewereabletorenouncetheworldin themidstofabundancebyrefusingtoeatordrinkanythingthatwaspaidforbyfamilywealth.MargeryKempefastedatherhusband'stableCatherineofSienaand IdaofLouvainrefusedfoodprovidedbytheirfathersElizabethofHungarylivedamongherhusband'srelativesbutrefusedtoeatanyfoodexceptthatpurchasedwith herdowry.23Becausefoodpreparationwaswoman'ssphere,foodasceticismandfooddistributionwereforwomenobviousmodesofimitatingthevulnerabilityand generosityofChrist.Moreover,fastingandfeedingwereactsofcharityandofselfdenudingthatcouldbeperformedevenwhenawomanwasunabletodetermine theframeworkofinstitutionsoreconomicsupportswithinwhichshelived. Theissueofcontrolis,however,muchmorebasicthanthisanalysissuggests.Foodrelatedbehaviorwascentraltowomensociallyandreligiouslynotonlybecause foodwasaresourcewomencontrolledbutalsobecausebymeansoffoodwomencontrolledthemselvesandtheirworld.Bodilyfunctions,sensations,fertility,and sexualityhusbands,mothers,fathers,andchildrenreligioussuperiorsandconfessorsGodinhismaj


estyandtheboundariesofone'sown''self"allcouldbemanipulatedbyabstainingfromandbestowingfood.Inordertounderstandthis,wemustlookcloselyat women'sfastingandfeedingbehavior.ItseemswisetobeginwiththequestionIearlierpostponed,thequestionoftheapplicabilityofmodernpsychologicalormedical models.Forinthefloodofrecentwritingonfood"disorders,"theissueofcontrolhasbeencentral.And,asseveralrecentwritershavenoticed,thefastingbehaviorof somemedievalwomenclearlyfitsratherwellthemodernsyndromeknownasanorexianervosa.Howhelpful,then,aremodernclinicaldefinitionsforour understandingoflatemedievalpiety? WasWomen'sFastingAnorexiaNervosa? Theideathatsomesaintlyormysticalwomenofthelatemedieval/earlymodernperiodwereanorecticsisnotnew.Infact,historiansofmedicinehaveviedwitheach otherinfindingtheearliestcasesofeatingdisorders.Onemedicalhistorianhasarguedthatitisonlyintheseventeenthcenturythatwefindanaccountoffemalefasting sufficientlydetailedtofitmodernclinicaldefinitions.24Butsomehaveseenanorecticoranorexialikebehaviorinearliercases.25Inabizarrecommunicationtoa Britishmedicaljournal,onedoctorrecentlyarguedthatthelegendofthebeardedfemalesaintWilgefortiswhichwasexplainedbythegreatBollandistscholar Delehayeasspringingfrommisperceptionofaveiledcrucifixisanearlyandcompletedescriptionofthecomplexoffeatures(includinghirsutism)consideredby psychologiststocharacterizeanorexia.26EarlierinthiscenturyCatholicscholarssuchasPaterandThurstonstrovetodifferentiate"natural"(whichsometimesmeant pathological,i.e.,anorecticorhysterical)and"miraculous"(i.e.,supernaturallyproduced)fasting.27Andanumberofrecentscholarshavementionedinpassing sometimesquitedefensivelythepossibilitythatprominentmedievalsaintssuchasCatherineofSienaandCatherineofGenoasufferedfromanorexianervosa. RudolphBellhasrecentlypublishedacarefulanddetailedstudyofanorexiaamongItalianwomenfromtheeleventhtotheseventeenthcentury.28 Manyofthesediscussions,whethertheygrantorrefusethelabelanorexianervosatoearlycasesoffemalefasting,seemtoassumethatweareinthepresenceofa trendwhichwecancalleitherthe"seculariza


tion"orthe"medicalization"ofbehavior.29Theyassume,thatis,thatmedievalpeoplegavetheologicalsignificancetobehaviorthatpsychiatristsanddoctorstodaysee insecularterms,whethermedical,psychoanalytical,orpsychodynamic.Thustheysometimessuggestthatmedievalwomenandtheirconfessorsattributenoteatingto divineordemonicinspirationwhereasmodernwomenandtheirtherapistsblameiteitheronpsycheoronbiochemistry.(Thisclaimcanbeusedeithertosupportthe notionthatsuchfastingisanorexianervosa,becauseitisthesamephenomenondifferentlyinterpreted,ortodenythenotionthatsuchfastingisanorexia,because "anorexia"isamodernculturalconstruct.)Theargumentisrelatedtotheidea,whichhasbeenmuchfoughtoverbyhistoriansofpsychiatry,thatlatemedievalwitches and/ortheirvictimswerefrequentlythesociety'smentallyilloftenhystericsandsometimesanorecticswhosebehaviorwasattributedbytheologianstobothmoral failinganddemonicpossession.30But,inordertounderstandmedievalbehavior,thefirstthingwemustnoteisthatsuchaclaimisnotquiteright.Itisnotquitetrue (althoughthereareelementsoftruthinit)tosaythatfastingwastheologizedintheMiddleAgesandissecularizedormedicalizedtoday.AsthecasesIdiscussabove makeclear,medievalpeopledidnotseeallrefusaltoeatas"fasting"(i.e.,asceticism)orallextendedabstinenceasmiraculous.Andthecaseofthemodernmystic SimoneWeilandhermanyadmirers,likethecaseoftheGermanstigmaticTheresaofKonnersreuth,makesitclearthatnotallfemaleabstinenceinthetwentieth centuryismedicallyorpsychologicallyinterpreted.31 Medievalwritershadinfactanumberofparadigmsforexplainingextendedperiodsofnoteating.Noteatingwassometimesseenassupernaturallycausedeither miraculousordemonic.Itwassometimesseenasnaturallycausedassuch,itwassometimesbutbynomeansalwaysinterpretedasaconditiontobecured.(Both miraculousandnaturalisticexplanationsweresometimesusedbytheologiansastheCouncilofTrentusedthecaseofNicholasofFluetoprovethedoctrineof transubstantiation.)Noteatingwassometimesinterpretedasdeliberatefraudorasselfdelusion.Wecanfindallthreeparadigmseveninearlysaints'livesand chronicles.Thenotionthatrefusaltoeatcanbefraudulentorattentiongettingbehavior,orillness,wasnonewdiscoveryinthesixteenthandseventeenthcenturies. Inediaappearsinanumberofmedievaldocumentsassimplyaphys


iologicalcondition.TheauthoroftheninthcenturylifeofWalburga,forexample,presentsacaseofloathingforfoodasanillness,whichthesaintcures.Afifteenth centurylifeofColetteofCorbiealsotreatsinabilitytoeatasanillness.32RogerBaconsaidofathirteenthcenturyEnglishwomanthathersurvivalwithouteatingwas notmiraculous,"butratheraworkofnature,"andgaveasomewhattorturedbutingeniousexplanationofhowthebalanceofelementsinherbodymightmakethis possiblesincenothingcameinasfood,butnothingwentoutasexcrement.ThomasNetter,inafifteenthcenturytheologicaltreatise,arguedthatJoantheMeatless distinguishedconsecratedfromunconsecratedhostsbyanaturalskill,becauseherconditionwassuchthatshecouldnotbearanybodilyfood.CatherineofSiena herselfreferredtoherinabilitytoeatasan"infirmity,"notavoluntaryreligiouspractice.LidwinaofSchiedamclaimedthatshedeservednopraiseforabstinencesince shewasinfactunabletoeat.AlpasofCudotindicatedherunderstandingofherconditionasanillness(whichwastobepatientlyborne)byhavingavisionofthedevil asadoctorwhoofferedtocureit.Asearlyastheninthcentury,chroniclerswerebusycollectingstoriesoffreaksandmarvelsanddidnotpresentallcasesofwomen whorefusedtoeatasexamplesofsanctityorillustrationsofGod'spower.TheveryfactthatsupposedsaintssuchasJohntheGoodofMantuaandColumbaofRieti sometimesatebeforeanaudiencetodemonstratethattheycouldeati.e.,thattheirabstinencewasvoluntarysuggeststhatmedievalinterpretersdrewaclear distinctionbetweeninabilitytoeatandasceticism.Someauthorsfoundonlythelatteramarkofsanctity,althoughsome(forexample,ElsbetAchler'shagiographer)did presentanysurvivingwithouteatingasamarkofdivinefavor. Medievalpeoplethemselvesthoughtthatselfstarvationwassometimesadelusionandsometimesacarefullyorchestratedfraud.Whenwenotethechargesagainst whichholywomendefendedthemselvesweseequiteclearlywhatanumberoftheircontemporariessuspected.CatherineofSienawasaccusedofbeingdeluded, evenofbeingawitch.ColumbaofRietiwasaccusedofmerelywastingawayfromlovesickness.BothCatherineandColumbadefendedthemselvesagainstthe chargethattheirrefusaltoeatwasaformofsuicideandthereforeamortalsin.ItwasCatherine'sowndefinitionofherbehaviorasaninfirmitythatenabledherto claimthateatingwouldbeanevenmoregrievoussuicide.Moreover,ifElsbetAchlerdidnothidefoodunderherbed,someone


elsehidittheretocreatetheillusionofthefraudhersisterssuspected.33Andinthefifteenthandsixteenthcenturiesseveralfraudulentfasterswereunmasked.34The factthattherewere"frauds"indicatesthatthosewho"pretended"expectedtogainprestigewhetherasfreakorassaint.Buttheratherdefensivetoneof hagiographers(suchasthebiographerofColumbaofRieti)whoclaimedthatfastingsaintsshowednosignsofemaciationindicatesthat"miraculousabstinences"were asregularlydoubtedasapplauded. Itthusappearsthatmedievalwritersthemselvesspokeratherdifferentlyoffastingasvoluntarypenanceandofcasesofwomen,especiallyyounggirls,whowere unabletoeat.Iftheydidnottreattheselattercasesasmattersfordoctorsalone,theyalsodidnotseethemsimplyasaspectsofpenitentialasceticism.Medieval peoplethemselveswereclearaboutthedifferencebetweenchoosingtorenouncefood,oneofthepleasuresofcivilization,andbeinginthethroesofabehaviorpattern thatmadeeatingimpossible.TheyevenoccasionallysawsaintssuchasColetteandWalburga,whochosenottoeat,aspatronsandcurersofthosewhosufferedfrom whatwewouldcallfooddisorders.Ifmedievalchroniclersreportedcertainrefusalstoeatasfreakishbehaviornotnecessarilyconnectedtoreligiosity,whatthenisto preventusfromseeingthemascasesofanorexianervosa,having,assomecurrentmedicalopinionargues,abiochemicalbasis? Twentiethcenturyworkonanorexiaandthecloselyrelateddisorderbulimia(bingeeating)offersmanyexplanationsofthesyndrome.Psychodynamicinterpretation relatesthebehaviortoneurosis,generatedfundamentallybyanovercontrollingparentbehavioristtheoryseesbingeingorselfstarvationaslearnedbehavior socioculturaltheoryrelatesfooddisorderstotheculturalrequirementsofslimnessandnurturingimposedonwomen.Biochemicalexplanationshavebeenparticularly popularrecently.Onecurrentvariantseesanorexiabulimiaasatypeofbiologicallycauseddepressionwithapharmacologicalcure.(Inthepastfewyearsresearchers havehadnotablesuccesscuringbingeeatingwithdrugslongusedtotreatbiochemicallycauseddepression.)35Moreover,researchonthephysiologicalbasesof psychologicaldifferencesbetweenthesexessuggeststhatdifferencesinmaleandfemalemetabolismmakeiteasierforwomentofast,andeventhatmenandwomen cravedifferenttypesoffood(particularlyproteinandcarbohydrates,respectively)becausethesefoodsactuallytastedifferenttothemandareusedbytheir


bodiesindifferentways.36Thereisthusevidencethatsomeeatingbehaviorthatdepartssignificantlyfromtheordinarydoesinfacthaveaphysiologicalbasis,and nothingonecouldadduceaboutmedievalpeoplewouldeitherconfirmordenythisconclusion.37 Evenforthemodernperiod,however,therearefactsthatconfutearigidlybiochemicalexplanation.Mostresearchersagreethattheincidenceofbulimiaandanorexia isincreasingrapidlytoday,althoughrecenttalkofan"epidemic"maybejournalisticoverreaction.38Nobehaviorwithapurelybiologicalcausecouldfluctuateas drasticallyinincidenceasanorexiaisagreedtodo.Thebehavior,then,whateverbasisitmayinsomecaseshaveinthephysiologyandthefamilyhistoryofindividuals, isalso,intheveryparticularformittakes,learnedanditislearnedfromaculturethathascomplexandlongstandingtraditionsaboutwomen,aboutbodies,and aboutfood.Whateverbiologicalorpsychologicalunderpinningsitmayhave,twentiethcenturyanorexiahasaculturalcontext.39 Thesameistrueformedievalcasesoffooddelusionandmiraculousabstinence.Althoughsomemedievalwomenforexample,AlpasandLidwinaofSchiedam wereunabletoeatforgravephysicalreasons,thereismuchevidencetosuggestthatthevirtuosofastingbehaviorofwomenmustbeexplainedprimarilyinacultural context.Thefirstandmostbasicargumentforaculturalexplanationcomesfromthedistributionofmedievalcases. Miraculousabstinenceitselfisattributedonlytomeninthepatristicperiod.SeveraloftheDesertFathersofthethirdandfourthcenturiesweresaidtosubsistonthe eucharistalone.Whensuchstoriesaretakenupbytheologiansinthefifteenthcenturyasproofofdoctrinalmatterstheybeginonceagaintobetoldoccasionallyof men.Butinthelonginterveningmedievalperiodtheyaretoldonlyofwomen.40Nobiologicalcausecouldpossiblyexplainsuchdiscrepanciesindistribution.Evenif weassumethattheincidenceofabehaviorremainsconstantandmerelythereportingofitchanges(anassumptionwearehardlyentitledtomake),thenthereporting itselfbecomestheinterestingandretrievablephenomenon.Andwhatischosenforreportingisclearlyculturallyconditioned.Moreover,themedievalevidencesuggests thatculturalmodelsarecrucialinproducingfoodrelatedbehavior. Whereextendedabstinenceisreportedformen,themodeloftheDesertFathersisclearlyatwork.Thestory,toldinLidwina'svita,ofa


certainGerardwhowentfromColognetoEgypt,climbedatree,andlivedtheremiraculouslyforyearsonmannafromheavenissoobviouslyaretellingofpatristic materialthatitdeserveslittlecredenceascontemporaryreporting.Andmanythirteenth,fourteenth,andfifteenthcenturywomen(forexample,MaryofOignies, CatherineofSiena,Colette)wereseenbytheiradmirersthroughlensesshapedbypatristiclegend.Thisisaculturalmodelinthemostobvioussense.Theninth centurylifeofWalburgasuggestsafarmoresubtleshapingofbehaviorbyculturalexpectation.ThestoriesofIrchinbaldandFrideradetoldthere(seeabove,pp.89 90)arebothstoriesofindividualswho,forreasonsthatareundoubtedlypartlyphysiological,haveuncontrollablefoodreactionsfirsthunger,thenrevulsion.The actionofthesaint'srelicsandtheexpectationsofobserversproduceoppositeresultsinthetwocases,however.Walburga"cures"themanshefailsto"cure"the woman,andanotherinterpretationisthenplacedonthewoman'sbehavior.Asthestorygoes,theman'sgluttonyisfollowedbyloathingforfood,andthesaint'srelics thenenablehimtoreturntonormaleating.Butthegirl'sgluttony,whichdidnotenduntilsheconfesseditasaterribleguilt,wasfollowedbyfoodrevulsionthata sympatheticnuncouldnotcure.Thosearoundthegirlthencametoseethenoteatingasamarvelandhaditattestedtobyapriest.Itseemslikelythatthedivergent outcomesofthetwostorieshadsomethingtodowiththeexpectationsofthosewhoviewedthetwoafflictedpeople.Noteatingseemedtothemamoreappropriate storyforawoman.Asgluttonyinawomanwasamoreterribleguilt,soinher,noteatingwaslesslikelytobe"cured"orinneedof"cure."Thustheprevalenceofnot eatingamongwomenseemstohavesomethingtodowithwhichbehaviorstheculturesawasbehaviors"tobecured.'' Whatdetermineswhetheranepisodeisseenassomething"tobecured"inagivencultureiscomplex.ButforthelateMiddleAgesthereisclearevidencethat behaviorandoccurrencesthatbothweandmedievalpeopleseeas"illnesses"arelesslikelytobedescribedassomething"tobecured"whentheyhappentowomen thanwhentheyhappentomen.Women'sillnesswas"tobeendured,"not"cured."Patientsufferingofdiseaseorinjurywasamajorwayofgainingsanctityforfemales butnotformales.AsWeinsteinandBellhavedemonstrated,womenaccountforonly17.5percentofthosecanonizedinthelaterMiddleAges,buttheyaccountfor 53.2percentofthosesaintsinwhoselivespatientbear


ingofinfirmitywasthecentralfactorinreputationforsanctity.ErnstBenzhascataloguedtheprominenceofsicknessasathemeinwomen'svisions.41Indeed,the vitaeofsomewomensaints,suchasSerafinaofSanGimignano(d.1253),haveastheirsolethemethesaint'sillness.42Andmanyholywomendesiredtobeill. Villanade'BottirefusedprayersforreliefofsicknessGertrudeofHelftaembracedheadachesasasourceofgraceBeatriceofNazareth,whodesiredthetormentsof illness,washealedalmostagainstherwishesMargaretofYpressodesiredtojoinwithChrist'ssufferingthatsheprayedforherinfirmitiestolastbeyondthegrave.43 DauphineofPuimichel(d.1360)evensuggestedthatifpeopleknewhowusefuldiseaseswereforselfdiscipline,theywouldpurchasetheminthemarketplace.44 JulianofNorwichaskedforandreceivedthegraceofsicknessanddeathinliteralimitatioChristi.Inherthirtiethyear,she"died"andreturnedtolife,whilereceiving avisionoftheCrucifixionwith"theredbloodrunningdown...,hotandflowingfreelyandcopiously,alivingstream."45 Notjustillnessingeneralbutthespecificillnessofnotbeingabletoeatwasembracedbymedievalwomen.AlpasandLidwinarejoicedintheirinediaandsawthe desiretobecuredasa,temptation.CatherineofSienarefutedchargesofsuicideorstubbornnessbyinterpretinghereatingbehaviorasinfirmity. Ofcourse,noteveryonesawillnessasdesirable.Lidwinaherselfhatedherillnesswhenshewasfirstafflicted.Theheroicembracingofsicknesscharacterizedonly saints.Butitseemstohavecharacterizedsaintlywomenfarmoreoftenthansaintlymen. ThegrowingincidenceofcasesoffemaleabstinenceinthelaterMiddleAgesoccursinthecontextofothernewmiracles.Miraculousabstinenceincreasesasfemale eucharisticdevotionincreasesandassuchdevotionbecomesmoreandmoreliterallytheconvictionthattakingtheeucharistisfeedingonthebodyofGod.Miraculous abstinencealsoincreasesmarkedlyinthecenturiesinwhichstigmataandothermiraclesofbodilymanipulationfirstappear.Betweenthelatetwelfthcenturyandthe sixteenth,manywomenwerereportedtoexperiencethewoundsofChristappearingupontheirbodiesandbleedingamiracleneverbeforereported.46Francisof Assisi(andthemodernfigurePadrePio)aretheonlymaleswhoarebelievedtohavepossessedallfiveofChrist'swoundsinvisiblestigmataandtheyarenotsaidto havedisplayedperiodicbleeding.47ButmanycaseswerereportedinthelateMiddleAges


ofwomenwhodisplayedfullstigmatawhichbledinarhythmicpatternmostfrequently,onFridays.Allcasesofredmarks(calledespousalrings)appearing miraculouslyaroundfingersare,nottoosurprisingly,female.Mostcasesofbodilyelongationarefemale.Andinthemedievalandmodernperiodsmoststoriesof sweetsmellingbodies,livinganddead,aretoldaboutwomen,although(liketalesofsurvivingontheeucharist)suchstoriesaretoldofmeninantiquity.48Ishall returntothesignificanceofthesenewmiraclesbelow.Mypointhereisthatabstinencebecomesanimportantcharacteristicofwomen'spietyinthesameperiodthat seesanincreaseinseveraltypesoffemalemiraclesofbodilymanipulationandanincreaseintheextentandliteralismofwomen'sdevotiontoholyfood.Thuscultural aswellasbiologicalcausesclearlyliebehindwomen'sfasting,forfastingisonlyoneaspectofabroadspectrumofbehaviorsthatappearinthelaterMiddleAges becauseofchangingculturalvaluesandimages. Doesitmakesense,however,toapplythelabelanorexianervosatothefastingbehavioroflatemedievalwomenifweuseapsychologicalratherthanabiochemical understandingofanorexia?Theanswerdependsinpartonwhichdefinitionofanorexiawechoose.Currentpsychologicaldefinitionsdiffer,andmanyaresonarrow andcultureboundastobequiteobviouslyinapplicabletowomen'sbehaviorbeforethenineteenthcentury.49Ifanorexiaisdefinedas"therelentlesspursuitof thinness"oras"dieting"thathasgoneoutofcontrol,thenanorexiacanbediagnosedonlyinculturesthatassociatethinnesswithbeauty.50Anddietingwasnot,of course,amedievalpractice,northinnessamedievalvalue.51Butotherpsychologicaldefinitionsofanorexiaareconsiderablysubtlerandmoreflexiblethanthosethat connectitnarrowlytotwentiethcenturynotionsoffemaleattractiveness. TheGermanAmericanpsychiatristHildeBruchdescribesanorexiaas"selfinflictedstarvationintheabsenceofrecognizableorganicdiseaseandinthemidstofample food."52TheItalianpsychiatristMaraSelviniPalazzoliseesanorexia/bulimiaasadeliberatestruggleagainstpersistenthunger,althoughthehungerisusuallydeniedor disguised.Theactofeating,saysPalazzoli,fillsanorectics"withfearandanxiety,and...theyconsider[it]degradingandselfdefeating,"althoughtheyoften compulsivelyurgefoodonothers.53Theseexpertsagreethatthephysicalsymptomsofanorexia,whichmaybesimplytheresultsofstarvation,arefatigue,anemia, andamenorrhea.Thepsychologicalsymptomsaredis


turbanceinbodyconcept,disturbanceinperceptionofbodilyfunctions(oftencombinedwithsleeplessnessandfoodrelatedhyperactivity),and"aparalyzingsenseof ineffectiveness."Anorecticstypicallyfeelthemselvestobepuppets,manipulatedbyothers,unabletoassertthemselvesagainstortopleaseacontrollingparent usuallyanenergeticandlovingmother.Noteatingis,forthem,anexperienceofcontrolcontrolofself,whichtheysubstituteforthecontrolofcircumstancestheyare unabletoachieve.Theytendtoseetheselfassplitortoloseallsenseof"ego."Theyarenotoriouslydifficulttotreatinpsychotherapybecausetheylieandtheextent oftheirdishonestysuggeststhattheyareincapableofperceivingtheirbodilyurgesandtheirfoodrelatedbehaviorrealistically.Theyareafraidoftouchingandbeing touched,andtheyfearanddisliketheirowncorporality.Theonsetofthesyndromecomestypicallyforgirlswhoarethevastmajorityofthevictimsatpuberty. Menstruation,likehunger,isseenasshameful,violating,andthreateningbody,likefood,isseenasfrighteningandpowerfulsexualmaturationisseenasvulnerability, aslossofwhatlittlecapacityforselfdeterminationthechildhadpossessed.Modernpsychodynamicexplanationsofanorexia/bulimiathusseecontrolasthebasic issue.In"typical"anorexia,thewomanstarvesherselfasawayofassertingpowerovermanipulatingherbody,whichishatedandfeared.Andprimaryanorexiais thusdistinguishedfromatypicalanorexia(whichsomewriters,forexampleBruch,alsocall"hysteria"),inwhichthewomanisobsessivelyconcernedwithfoodandits significancebutmanipulationofbodysizeisincidental.Treatmentofanorexia,whetherinindividualorfamilytherapy,focusesonintrafamilydynamics,particularlythe motherdaughterrelationshipittriestorestoretothegirl,whohasspentherlifepleasingothers,somesenseofsettingandmeetingherownstandards.54 Howwelldoesthismorecomplexdelineationofanorexianervosadescribemedievalbehavior?Somemedievalvitaedepictextravagantfastingthatappearscloserto atypicalanorexia(orhysteria)thantoprimaryanorexia."Hysteria"isnolongerrecognizedbypsychiatristsasadiagnosis,andthehystericalbehaviorsomuchstudied inthenineteenthandearlytwentiethcenturiesbyCharcotandFreudis,inthelatetwentiethcentury,foundonlyintheThirdWorldorinveryruralareasofEurope.55 Butsomemedievalsaintsinwhoselivesfoodwasacentralobsessionseemclosertoclassicnineteenthcenturyhystericsthantomod


erncasesoftypicalanorexia.ThetermhystericalseemstofitatleastsomeofthebehaviorofBeatriceofOrnacieuxandBeatriceofNazareth,whoexperiencedthe kindofchokingsensations,knownasglobushystericus,oftencharacteristicofhysteriaoracuteanxiety.56ThetermalsoappearstodescribeIdaofLouvainand RitaofCascia,whosebodiesbrokeoutinsores(sometimesstigmata)thatappearedordisappearedwithvariouslevelsofreligiousexcitement,aswellasIdaofLau, ChristinatheAstonishing,andthemanyotherwomenwhoexperiencedtrances,"fits,"andnosebleedsbroughtonbymysticaldesire.Thespasmsdescribedinthevita ofLukardisofOberweimar,inwhichherspinewasarchedandherlegsandheaddrawnbacksotightlythatherbodynearlyformedacircle,arearecognizedformof hystericalbehaviorknownasopisthotonos.(Twofamousmodern"fastinggirls,"MargaretWeisandSarahJacobs,sufferedfromsimilarattacks.)57Moreover,in somecasesofextendedstarvation,theinediaappearstobemerelyonemanifestationofgeneraldepression.JaneMaryofMaill,AngelaofFoligno,andCatherineof Genoa,forexample,themselvesconnectedtheirinabilitytoeattowhatmedievalpeoplecalledaccidiaakindofspiritualslothordespair.Andtheyseemtohave recognizedmarriageasitscause.Suchwomenmightperhapsbetterbelabeleddepressivesthananorectics.Butthedistinctionisunimportant.AsInotedabove,some recentmedicalresearchhypothesizesthatanorexia/bulimiaisaformofdepression. Despitethefactthatsomeextendedstarvationseemsbetterdescribedasdepressionorhysteria,apsychologicalorpsychodynamicdefinitionofanorexiaseemsatfirst glanceapplicabletosomemedievalwomen,amongthemMaryofOignies,JulianaofCornillon,MargaretofYpres,JaneMaryofMaill,ElizabethandMargaretof Hungary,ElsbetAchler,AngelaofFoligno,MargaretofCortona,CatherineofSiena,ColumbaofRieti,andCatherineofGenoa.Thesewomenwentthroughintense periodsofinabilitytoeat,oftenbeginninginadolescence.Theyateandvomiteduntiltheydamagedtheirthroatsanddigestivesystems.Someofthem(forexample, AngelaofFolignoandCatherineofGenoa)later"recovered,"atleastpartly,fromtheirfastingsome(forexample,ElsbetAchler,CatherineofSiena,andColumbaof Rieti)died.Likemodernanorectics,manyofthesesaintslost"normal"bodyconceptorperception.Theysometimesexperiencedstrangesensationsofswellingor flying.DorothyofMontauandIdaofLouvain,forexample,swelledas


ifpregnantwithChrist58DoucelineofMarseilleslevitatedBeatriceofOrnacieuxmovedmiraculouslythroughoroverwalls.BothCatherineofSienaandCatherine ofGenoalosttheabilitytogaugetemperature CatherineofGenoaexperiencedextremeandmysteriousperiodsoffreezingorburningandonoccasionCatherineofSiena,ColumbaofRieti,andLidwinaof Schiedamallfailedtoperceivefireashot.Manyofthesewomensteadfastlydeniedbeinghungryalthoughtheiractionsbetrayedagoniesofgreedandthirst,whichthey focusedontheeucharist.IdaofLouvainattackedalockedpyxwithherbarehands,desperateforthehost.59CatherineofGenoa,ColumbaofRieti,andElsbet Achlerseemnottohaveknownthattheywerelickingdirtydishes,drinkingvinegar,orhoardingfoodtoassuagethehungertheydeniedfeeling. Manyofthesewomendisplayedtheeuphoria,thesleeplessnessandhyperactivity,andthecasuistrycharacteristicofpresentdayanorectics.Anumberoffemalesaints (forexample,MaryofOigniesandColette)supposedlydidnotsleepatall,andthetownofficialsofSchiedamtestifiedthatLidwinadidnotsleep.Aswesawin chapter5,CatherineofSienapreparedfoodforherfamilyanddidtheirlaundryatnightwhenhermothertriedtoforcehertogotobed,shesurreptitiouslysubstituted aboardforthemattress.MaryofOignies,ElizabethofHungary,MargaretofHungary,andAngelaofFolignofedothersfranticallyandobsessivelyandElizabeth,like modernanorectics,rivetedattentiononhereatingbehaviorbyinquiringintothesourceofeverymorseloffood.CatherineofSienaandColumbaofRietideveloped intenseandtheologicallyelaboratedefensesoftheirrefusaltoeat.Manyofthesefastingwomenalsocombinedselfdenialwithanacutesenseofunworthinessand inabilitytoact.MargaretofCortona,BeatriceofNazareth,andJulianaofCornillon,forexample,sufferedrepeatedperiodsofselfdoubtCatherineofGenoa developedthetheorythatoneshoulddestroytheegosocompletelythatthefirstpersonsingularpronounwoulddisappearaltogetherfromone'sspeech.60 Itthusseemspossibletoapplytosomeextendedfastingdonebymedievalwomenthemodernpsychologicallabelsanorexianervosaandbulimia.Thereare, however,problemswithsuchapplication.Thefirstproblemisthemostobvious:ourinformationaboutthebehaviorofthesewomenisoftentoofragmentarytoallow usto"diagnose"(orclassify)themproperlyortoextrapolatefrombehaviortocause,yetthepsychodynamicdefinitionassumesacauseinfamilysituationand interac


tions,particularlyintherelationshipofmotherandchild.Someofthemedievalcasesthatlookmostlikemodern"fooddisorders"mayhaveoriginsthathavenothingto dowithfamilydynamics.Forexample,Alpas,Lidwina,andDorothyofMontaurefusedtoeatandfeltaguiltoverhungersensationsthatresemblesmodernanorectic behavior.Allthreeexperiencedconflictwiththeirmotherswhenyoung.ButtheyclearlysufferedfromotherseriousdiseasesinAlpas'scasepossiblyleprosy,in Lidwina'sgangrene,inDorothy'ssomesortofdefectintheautoimmunesystem.61Thusitisimpossible,fromtheevidencewehave,toknowtowhatexactlyone shouldattributetheiroddsenseofbodilyfunctions,theirfoodcravingandvomiting.Moreover,modernresearchershavebeenaware,sincetheCarnegieInstitute experimentsoftheearlyyearsofthiscentury,thatstarvationorfastingitselfproducesqueerbehaviorpatternsandmentalreactionssuchasexaggeratedand exhibitionistclaims,paranoia,sleeplessness,inabilitytogaugebodytemperature,andeuphoria.62Itisthuspossiblethatsomemedievalwomenwhochosetofast developed,asaresultofstarvation,thosepsychologicalcharacteristicsthatsomerecenttherapistsseeassymptomsoreven"causes"ofthementaldiseaseanorexia nervosa.63 Thepsychodynamictheoryofanorexia/bulimiais,moreover,likeotherdiagnosticconceptsinmodernpsychiatry,bothreductionistandindividualisticinitsapproachto causation.Justasrecentbiochemicaldefinitionsofanorexia/bulimiadisplaythemodernWesterntendencytoreducementalandemotionalexperiencetophysiological phenomena,sopsychodynamicdefinitionsreduceittodynamicsinthepsycheorthepsyche'spersonalhistory.Suchdefinitionsassumethattheinterpretationgiven tobehaviorbythebehaverisanepiphenomenon.Whatagirlorwomansaysabouthereatingbehavioristhuslabeled"rationalization"or"symptom."Accordingto suchinterpretation,CatherineofGenoa'snotionthatherthirstwasdiabolicallyinducedorCatherineofSiena'sargumentthateatingissuicidecanbeseenas"casuistry" or"avoidancetactics"andthereforeasfurtherevidenceoftheinaccurateperceptionofbodilysensationsthatcharacterizesanorectics.Suchlabelingis,inonesense, quiteplausible,ofcoursethetwoCatherinesdoseemoccasionallytohaveusedreligiouscategoriestodistancethemselvesfromtheirownbehavior.Buteveninthese twoexamplessuchexplanationdismissesideas(theconceptsofthedevilandsuicide)thatwouldneedhistoricalandculturalexplanationiftakenseriously.Moreover, themysticaltheory


advancedbythetwoCatherines,BeatriceofNazareth,MaryofOignies,andHadewijch(likethetheoriesofthemodernmysticSimoneWeil)shouldsurelynotbe treatedas(i.e.,reducedto)casuistryorlossofegoboundaries.Thenotionofsubstitutingone'sownsufferingthroughillnessandstarvationfortheguiltanddestitution ofothersisnot"symptom"itistheology. Finally,explanationsthatworkbackwardfromagivenbehaviortolocateitssourcesinfamilydynamicscan,ascriticsofpsychoanalysisoftenpointout,explainonly individualcases.SuchexplanationscanaccountfortheguiltanddepressionofparticularwomenforAngelaofFoligno'sorMargeryKempe'sshameoversexin marriage,forexample,orCatherineofSiena'sguiltaboutherpositionasfavoritechildandsurvivor.64Suchexplanationscannot,however,accountforawidespread patternofwomenwhorefusetoeat,becausetheexplanationsdonottakeseriouslyenoughthesymbolsinvolved"food"and"body"orseethattheirmeaningqua symbolscomesfromtheculture,notfromtheeventsofaspecificlife.Thecourseofanindividuallifecanneverexplainwhythedepressionorguiltinthatlifeexpresses itselfinsymbolssuchas"blood"and"hunger"orwhyaparticulartheologicalnotion,suchastheideaofservicethroughsuffering,emergesasasolution.Wecannot understandthevoluntarystarvationofanyparticularwomanunlessweunderstandfullywhatfoodmeanstothoseamongwhomshelives.Ifwetakeseriouslythe imagesandsymbolsinwhichguilt,responsibility,joy,andunhappinessmanifestthemselves,sociologicalandculturalexplanationsarenecessary.Modern psychodynamicdefinitionscutaportionofthebehaviorofmedievalwomenofffromitsbroaderandrichercontext. ThuswhateverphysiologicalandpsychodynamicfactorsmayhaveinfluencedmedievalbehaviorandIdismissneithersetoffactorsculturalsettingwascrucial. Biology,psyche,andcultureinterpenetratedandinfluencedeachother.Thismeansthat"medievalanorexia"isnotquitetherighttopicforhistoricalinvestigation.We shouldnotisolatetheratherrarephenomenoncalledbycontemporaries"miraculousabstinence"or"fastinggirls"fromthebroaderphenomenonoftheoverpowering concernwithfoodwithfeastaswellasfastthatcharacterizesthelivesandwritingsofmedievalwomen.Notonlydidmedievalwomendenythemselvesfood,they alsobecamefoodintheirowneyesandintheeyesofmaleadmirers.AndwhentheyateGod,theywere


notmerelyfocusingtheirhungersensations(otherwiseunrecognized)ontheeucharist.Theywerealsoreversingtheirordinaryculturalroleoffoodpreparersandfood abstainers.Theywere"eating"aGodwhoseediblebodyanursingbodywasinsomesenseseenasfemaleandthereforeasfood.Moreover,womenmanipulated farmorethantheirownbodiesthroughfasting.Theymanipulatedtheirfamilies,theirreligioussuperiors,andGodhimself.Fastingwasnotmerelyasubstitutionof pathologicalandselfdefeatingcontrolofselfforunattainablecontrolofcircumstance.Itwaspartofsufferingandsufferingwasconsideredaneffectiveactivity,which redeemedbothindividualandcosmos.Women'sinediawasthereforenotsomuchbizarrebehaviorafflictingafewindividuals,aspartofabroaderpatternthat includedeucharisticdevotion,foodmultiplicationmiracles,devotiontoChrist'shumanity,thetheologyofpurgatory,andcareofthesick.Suchfastingcanbe understoodonlyifweunderstandthelatemedievalnotionofimitatioChristiasfusionwiththesufferingphysicalityofChrist,andlatemedievalnotionsofthefemale asflesh. ThusitisnotparticularlyhelpfultoknowthatCatherineofSienacanbesaidtobe,inthemodernsense,anorecticorevenbulimic(althoughthestatementisclearly true).Thequestionis:whyisfoodsocentraltowomen?Moderndefinitionsofanorexia,whilehelpfulinpointingoutthat"control"isakeyissueinanorecticbehavior, obscureourperceptionofsuchbehaviorbyglossingoverthefactthatfoodandcorporalityareatstake.Psychologiststodaynotethatanorecticsareusuallyfemale andthatwomentendtomanipulatetheirbodieswhereasmenmanipulatetheirenvironments.65But,asthequotationwithwhichIopenedthischaptersuggests,they donotknowwhy.Becausetheydonottakeseriouslythesymbolsusedinwomen'sexperienceortheideologiesformulatedaboutit,theyhavecutthephenomenonof refusaltoeatofffromitscontextoffoodrelatedbehavior.Moreover,theyhaveneglectedfemaleattitudestowardsufferingandgenerativity.Yetonesuspectssuch attitudestobepartofthecontextinwhichmoderngirls,aswellasmedievalones,viewbothbodiesandfood. Iwill,then,leaveasidethefactthatsomeofthefastingbehavioroflatemedievalwomencanbedescribedbythemodernpsychologicalandmedicaltermanorexia nervosaandaddress,rather,thequestionofwhysomuchofthereligiousbehaviorandthereligiouslanguageofthesewomenrevolvedaroundfood.


FoodasControlofBody: TheAsceticContextandtheQuestionofDualism Isuggestedabovethatwomenusedfoodinawidevarietyofwaysbecausefoodwasthebasicresourceoverwhichtheyhadmostcontrol.Womendidnotmerely abstainfromfood.Theyalsodistributedfood,bothprosaicallyandmiraculously.TheymergedwithChristthroughfood.Inmiraculousexuding,theybecamefood.In short,womenhadmanywaysofmanipulatingandcontrollingselfandenvironmentthroughfoodrelatedbehavior,forfoodformedthecontextandshapeofwomen's worldoftheirresponsibilitiesandprivilegesmorefundamentallythanitdidtheworldofmen.Tosaythis,however,ismerelytoskimthesurface.Italmostreduces tosayingthatwomenusedfood,asfactandassymbol,becauseitwastheretobeused.Clearly,then,wemustprobebeyondthis.Wemustaskonadeeperlevel aboutboththefunctionandthemeaningofeatingandnoteating. Todosoistoconfrontdirectlysomeextremelydifficultproblemsinhistoricalinterpretation.Itisultimatelytoconfrontboththequestionofthenatureofasceticismand thequestionofthebasicstructurespsychological,social,andreligiousofwomen'slivesinthelaterMiddleAges.Inansweringthesequestions,Imustpropose someverylargerevisionsofwhathasalwaysbeenassumedaboutwomenandmedievalChristianity.Toputitverysimply,intheselastfivechaptersIarguethatthe extremeasceticismandliteralismofwomen'sspiritualitywerenot,atthedeepestlevel,masochismordualismbut,rather,effortstogainpowerandtogivemeaning.I alsoarguethatalthoughmenandwomenagreedinseeingfoodasafemaleconcern,thesymbolhadprofoundlydifferentandasymmetricalmeaningstothetwosexes becausemenandwomenhaddifferentsocial,psychological,andreligiousexperiences. Letmebegin,then,withthewaywomenexertedcontrolovertheirownbodiesthroughfasting,forwhateverotherfunctionfoodhadformedievalwomen,itwas clearlyameansbywhichtheymanipulatedphysicality.Theinterpretationhistoriansofreligionhavegiventothisphenomenonhasbeenmonolithicsomuchsothatit hascometoseemcommonsense.Latemedievalwomenhatedtheirbodiesandtheirsexuality,wearetold,andpunishedthemthroughfastingandotherformsofself mutilation.Theyinternalizedamisogynytowhichthephilosophical,scientific,theological,andfolktraditionsandthestructuresof


churchandsocietyallcontributed.66Somehistorianshaverespondedtowomen'sasceticpracticeswithembarrassmentorevenangerothershaverespondedwith compassion.Conservativehistoriansoftheologyhavesometimesblamedthewomen.67Historiansofmedicineorpsychiatryhavesometimesblamedsociety.68 Marxistandfeministhistorianshaveoftenblamedthechurch.69But,whateveritscause,women'sasceticismhasseemedtomodernscholarsselfevidentlydualistic andpathologicalanefforttofleeordestroythefleshsothatthespiritmightreturntoGod.Ithasgenerallymetwithrepugnanceor,occasionally,withvoyeuristic prurience.Thosewhohavefeltitnecessarytodefendthepast(alwaysariskyundertaking)havethushadeithertotaketheoffensiveandblameinstitutionsor individualswho''oppressed"womenortoignorethefullrangeandextremismoftheselftorturingbehaviorandconcentrateonotheraspectsofwomen'sspirituality.70 Butwhenweplaceeventhemostextravagantfastingandselfmutilationinitsmedievalcontextitisnotclearthatsuchbehaviorwasrootedeitherinselfhatredorin dualism.71 Thereisnoquestionthattheexperiencingofpainwasaprominentaspectofthespiritualityofbothlatemedievalwomenandlatemedievalmen.Thereisnoquestion alsothatitwasmoreprominentinwomen'sreligiosity.IpointedoutabovethecentralityofillnessselfinducedorGodgiveninwomen'sclaimstosanctity.And womenwhowerenotill(forexample,MechtildofMagdeburgandHadewijch)frequentlydesiredtoidentifywithChristthroughlonelinessandpersecution.Some Italiansaintsdrankpusorscabsfromlepers'sores,eatingandincorporatingdisease,andthedesireforillnessisacommonthemeintheNonnenbcher,wherethe sistersexposethemselvestobittercoldorpraytobeafflictedwithleprosy.72Moreover,thecentralthemeinwomen'svisions,increasingfromthethirteenthtothe earlyfifteenthcentury,wasfusionwiththecrucifiedbodyofChrist.Thesevisionsstreamwithblood.Andinthefrenzyoftranceorecstasy,piouswomensometimes mutilatedthemselveswithknives,asMaryofOigniesdid,or,likeBeatriceofNazarethandElizabethofSpalbeek,drovethemselvestowhattheyandtheir companionssawas"insanity."73 Deliberateandsystematicphysicalpunishmentwaspartofthedailyroutineformanyreligiouswomen.74ThesixteenthcenturyaccountofthelifeofAldaofSiena,for example,saysthatthesaintsleptonabedofpavingstones,whippedherselfwithchains,woreacrownofthorns,


andcarvedforherself,asanobjectofdevotion,awoodennailliketheonethatpiercedChrist'sfeet.75DorothyofMontauputherselfthroughapantomimeofthe Crucifixionthatinvolvedprayingwithherarmsextendedintheformofacrossandlater,inimitationofChrist'sburial,lyingprostratewiththeentireweightofherbody supportedonlybytoes,nose,andforehead.76JaneMaryofMaillstuckathornintoherheadinremembranceofChrist'scrownofthorns.77Readingthelivesof fourteenthandfifteenthcenturywomensaintsgreatlyexpandsone'sknowledgeofLatinsynonymsforwhip,thong,flail,chain,etc.Asceticpracticescommonly reportedinthesevitaeincludewearinghairshirts,bindingthefleshtightlywithtwistedropes,rubbingliceintoselfinflictedwounds,denyingoneselfsleep,adulterating foodandwaterwithashesorsalt,performingthousandsofgenuflections,thrustingnettlesintoone'sbreasts,andprayingbarefootinwinter.Amongthemorebizarre femalebehaviorswererollinginbrokenglass,78jumpingintoovens,hangingfromagibbet,79andprayingupsidedown.(Inthelattercase,thenun'sskirtsclung, modestlyandmiraculously,aroundherankles.)80Theauthorofthenuns'bookofUnterlindenintheAlsacewrote:

InAdventandLent,allthesisters,comingintothechapterhouseafterMatins,orinsomeothersuitableplace,hackatthemselvescruelly,hostilelylaceratingtheirbodiesuntilthe bloodflows,withallkindsofwhips,sothatthesoundreverberatesalloverthemonasteryandrisestotheearsoftheLordofhostssweeterthanallmelody.

Andshecalledtheresultsofsuchdisciplinestigmata.81 Thusfastingwaspartofabroaderpatternofconductthatappearstomoderneyestobeasystematicattackontheflesh.Moreover,fastingwaspartofapatternof pietyinwhichwhatwewouldcallpsychologicalmanipulationofthebodyisaprominenttheme.Whereasextremepenitentialasceticismisfoundinmaleaswellas femalesaints(forexample,FrancisofAssisi,HenrySuso,JamesOldo,PeterofLuxembourg),psychosomaticmanipulationisalmostexclusivelyfemale.Wounds imitatingthoseonChrist'sfeet,hands,side,orheadorsometimeseventhescourgemarksonhisbackappearedonthebodiesofmanyfemalesaintsinthethirteenth, fourteenth,andfifteenthcenturies.82Redmarksknownasespousalringssometimesappearedonwomen'sfingers.Andwomen'swoundsoftenappeared,orbled,at thedayandhouroftheCrucifixion.Storiesareeventoldofmiraculouselongationofwomen'sbodiesandof


womenlevitatingmanyfeetintheairorflyingoverwalls.83Evenafterdeaththebodiesofsaintlywomenwerediscoveredtohavebeencontrolledandmarkedin strangeways.Intestinesandstomachswerefoundtobeempty,heartswerediscoveredtobeetchedwiththesignsofChrist.Althoughsomewomen,forexample GertrudeofHelfta,receivedthewoundoflove"inwardly,"otherswerethoughttobecomeChristmoreliterally.ClareofMontefalco'sspiritualsisterscametobelieve sointenselythatChristhadplantedhiscrossinherheartthatatherdeathin1308theythrewthemselvesuponherbody,toreoutherheart,andfoundinciseduponit theinsigniaofthePassion.84 Thebodiesofholywomenwerefrequentlyseenbymedievalpeopleasexudingmiraculousfluids,substances,orodors.Ofthethreemostfamousmyroblytesofthe MiddleAges,two(CatherineofAlexandriawhosupposedlybledmilkwhenbeheadedandElizabethofHungary)werewomen,andalthoughresearchremainsto bedoneonthedistributionofthisphenomenon,adisproportionatenumberofmedievalmyroblytesappeartohavebeenwomenforexample,Walburga,Hedwigof Silesia,AgnesofMontepulciano,andLutgard.85Womenalsoseemtoaccountforthemajorityofcasesofbodiesthatexudedsweetodors,eitherfromwoundsor soresthatappearedduringlifeorfrombodies(whichsometimesalsobecameyoungandbeautiful)afterdeath.86FlemishholywomensuchasChristinathe Astonishing,GertrudevanOosten,andLidwinafedotherswithmilkthatflowedfromtheirvirginbreasts,oftenduringmeditationsontheNativity,andtheirItalian counterpartssometimeseitherexudedorcalleddowncloudsofmanna.87Moreover,hagiographersfrequentlypointoutthatholywomendonotexcreteor menstruate.Sofardoesthisconcernwithexudingextraordinaryeffluviaandrepressingordinaryonesgothatbythesixteenthcentury,biographers(suchasColumba ofRieti'shagiographer)arguethatholywomendonotsweatorhavesourbreath.88And,introducinganewly"scientific"noteintothegrowingconcernwiththeclosing offoffemalebodies,anaccountpublishedin1603ofJaneBalamoftheareaaroundPoitiersstatesexplicitlythatthisfastinggirlexcretedneitherfecesnorurine,did notmenstruate,neversweatedexceptfromthearmpits,dischargednofilthordandrufffromherhair,andonlyoccasionallygaveforthspittlefromhermouthortears fromhereyes.89 Tomedievalpeoplethemselves,whatmoderneyesseeasselfpunishmentorpsychosomaticmanipulationwasimitatioChristiafusionwith


Christ'sagonyonthecross.Thusmedievalwriterswereoftenuninterestedincertaindistinctionsthatintheearlymodernandmodernperiodshavefascinatedcanon lawyers,theologians,andpsychiatristsdistinctions,forexample,betweenmiraculousandselfinducedorbetweenvisibleandinvisible.ToGertrudetheGreat, Lutgard,FrancisofAssisi,Lukardis,orCatherineofSiena,thepointwasthepainofstigmataorofthewoundintheheart,notthevisibilityofthescars.Thepointwas painbecausethepainwasChrist's.Visiblewoundscouldbeanembarrassment.ToRitaofCasciaandJaneMaryofMaillthethornwoundstheysufferedwere imitatioChristi.ThefactthatRita'sappearedbyautosuggestionandJaneMary'scamefromarealthornwasnotanimportantdifference.WhenBeatriceof Ornacieuxthrustanailthroughherhand,shewassaidtoreceivestigmata.LukardisofOberweimar'shagiographersaysthatshedrovethemiddlefingerofeachhand, hardasanail,throughthepalmoftheoppositehand,untiltheroomrangwiththesoundofhammering,andstigmata"miraculously"appeared.90Onlyafewdaysafter asisternunaskedinnocentlywhyLukardisdidnotalsobearthemarksofthethornsonherforehead,these,also"miraculously,"appeared.Bothbecausemedieval peopledidnotdividebodyandmindsosharplyaswedoorthesensesfromoneanother,andbecausethesignificanceof"stigmata''wastheexperienceofpain,notits source,accountsofsuchbodilychanges,particularlyinthethirteenthandfourteenthcenturies,telluslessaboutwhatcausedthemorhowtheylookedthanabouttheir meaning. Thusitisclearthatmedievalwomenintendedtoproducepainwhentheyperformedmanyoftheirreligiouspractices.Itisalsoclearthattheyweresomewhatmore likelythanmentoinflictinjuryonthemselvessystematicallywithflailsorthorns,stonesornettles,andthattheywereagreatdealmorelikelythanmentohavetheir desireforpainresultinsomaticchangesandtohavethesechangesscrutinizedandrecordedbyadmirersandbiographersofbothsexes,whofoundfemalebodies fascinating.91Doesthismeanthatwomenwishedtoeschewphysicalityandbecomespirit?Doesitmeanthatfemalefastingwasanefforttopunishtheflesh,to destroyordenyitsurges,torepressitssexuality?Thereiscertainlysomeevidencetosupportsuchaninterpretation. Malebiographers(frequently)andwomenthemselves(occasionally)suggestthatbodyshouldbedisciplined,defeated,orevendestroyed,inordertoreleaseor protectspirit.Somewomenactuallyreflectthevery


oldMediterraneannotionofthefemalebodyaspolluting.Inthefourteenthcentury,forexample,BridgetofSwedenprohibitedhernunsfromtouchingaltarclothswith theirbarehands.92Severallatemedievalsaintsforexample,DoucelineofMarseillesandLutgardofAywiresseemtohavedevelopedanobsessivefearofany bodilycontact.ClareofMontefalcosaidshewouldratherspenddaysinhellthanbetouchedbyaman.93Lutgardpanickedatanabbot'sinsistenceongivingherthe kissofpeaceJesushadtointerposehishandinavisionsothatshewasnotreachedbytheabbot'slips.Sheevenaskedtohaveherowngiftofhealingbytouchtaken away.94DoucelineofMarseilles,whoperformedmanymiraclesbytouch(sometimesinadvertently),95wasdeeplyantagonistictoanybodilycontactwithaman.96 Whenshewasachild,Christhadtoforcehertoovercomeherabhorrenceofthemalebodybyappearinginavisionwithadisgustingsicknessanddemandingthat shetouchhischest.97Althoughsheforcedherselfandhersisterstocarefortherepulsivelyill,shebeatasevenyearoldgirlbrutallyforlookingataworkman.98 ChristinaofStommein(d.1312),whofellintoalatrinewhileinatrance,awokeinfurybecausethelaybrotherwhorescuedhertouchedherinordertodoso.99In thelivesofmanywomen,particularlythose,likeLutgard,whohadexperiencedphysical(especiallysexual)brutality,thetouchofChrist'sbodycameasahealing experiencetoreplaceallothertouching,whichwasabhorrent.100 Manyholywomenwereprofoundlyafraidofthesensationsoftheirbodiesespeciallyhungerandthirst.MaryofOignies,forexample,wassoafraidoftaking pleasureinfoodthatChristhadtomakeherunabletotaste.InthesadlittlestoryofAlpassendingawaythefewmorselsofporkgivenhertosuck,weseeabizarre fearthatanyenjoymentoffoodmightmushroommadlyintogluttonyorlust.WomensuchasIdaofLouvain,ElsbetAchler,andColumbaofRieti,whosometimes snatchedupfoodandatewithoutknowingtheyweredoingso,clearlydirectedtheirhungertowardtheeucharistpartlybecauseitwasanacceptableobjectofcraving andpartlybecauseitwasaselflimitingfood.Suchwomenfeltdesperatelyvulnerablebeforebodilyneedsandusedasceticismtodestroythem. Itisalsopossiblethatsomefastinghadasagoalothersortsofbodilycontrol.Thereissomesuggestionintheaccountsofbiographersthatfastingwomenwere admired(asarefastingwomeninIndiatoday)forsuppressingexcretoryfunctions.101Severalhagiographerscommentwith


approvalthatholywomenwhodonoteatalsoceasetoexcrete,andRogerBaconusedthephenomenonaspartofhisnaturalisticexplanationofinedia.102 Moreover,atleastthreehagiographerspointoutexplicitlythatthemenstruationoftheirsaintlyheroinesceases.103Medievaltheologywasprofoundlyambivalent aboutmenstruationapointtowhichIshallreturnbutnaturalphilosophersandtheologianswereawarethatfastingdoesinfactsuppressmenstruation.104Albert theGreatnotedthatsomeholywomenceasedtomenstruatebecauseoftheirfastsandausteritiesandcommentedthattheirhealthdidnotappeartosufferasa consequence.105AlthoughmedievalwomensuchasBeatriceofNazareth,MargaretofYpres,Lutgard,IdaofLouvain,Lukardis,andRitaofCasciadelightedinthe abnormalbleedingfromnose,mouth,orstigmaticwoundsthataccompaniedtrancesandmysticalunion,itdoesnotseemunreasonabletosuggestthattheymayalso havedesiredcessationofthatmoreordinaryfemalebleedingthattheirreligioninterpretedambivalentlyatbest.FiguressuchasJulianaofCornillon,MaryofOignies, CatherineofSiena,andCatherineofGenoa,whethermarriedornot,escalatedtheirfoodasceticismmarkedlyatpuberty. Moreover,incontrollingeatingandhunger,medievalwomenweresometimesexplicitlycontrollingsexuality.EversinceJerome,malewritershadwarnedreligious womenthatfoodwasdangerousbecauseitexcitedlustandthemedievalauthorsoftheologicalsummaeandmanualsofreligiouspracticeforvirginsrepeatedthese warnings.106Somelatemedievalhagiographersremarkedthatwomen(forexample,AldaofSiena)fastedinordertoquellsexualdesire.107Thispointshouldnotbe exaggerated.AsWeinsteinandBellpointout,malebiographersgenerallyoveremphasizedwomen'ssexualtemptations,becauseculturalstereotypessuggestedthat womenwerefarmorevoracioussexuallythanmenwere.108Womenwritersactuallypaidlittleattentiontolust,andevenauthorsofMirrorsforVirginsinthehigh MiddleAgesdevotedlessattentiontofoodasanarouseroflustandtolustitselfthanonewouldexpectfromtheinterestofmodernhistoriansinthesubject.109But therewerewomen(forexample,MargaretofCortona,CatherineofSweden)whoassociatedfoodabstinencewithchastityandgreedwithsexualdesire.110In ColumbaofRieti'spainfulandgraphicvisions,foodandnakedbodieswereinterwoventemptations,astheyhadbeenforJeromesomanycenturiesearlier.Andina charmingstorythatassociatesfoodandsexualityonadeeperlevel,thebabyCatherineofSwedenrefusednot


onlythebreastofhersinfulwetnursebuteventhebreastofhersaintlymother,Bridget,wheneverBridgethadhadconjugalrelationsthenightbefore.111 Medievaltextsthussuggestthatwomensometimesabstainedfromfoodinordertosubvertlust.Italsoseemsthatsomewomenpunishedtheirfleshforenjoyingsexual pleasure,andsome,forwhomsexualactivitywasatorment,punishedthebodythatwasunwillinglysubjectedtoit.Somewomen(forexample,AldaofSiena,Umilt, AngelaofFoligno,MargeryKempe)feltguiltyinlaterlifebecausesexualactivitywithinmarriagehadbeenenjoyable,andsomesaints,suchasElizabethofHungary, lovedtheirhusbands.112Butevenwomeninhappymarriagesoftenfeltguiltyabouttheirsexuality.TheconfessorofEllenofUdine(d.1458)recordsherown explanationofherpenitentialasceticism:

IwearahairshirtbecauseofthesilkenundergarmentsandpreciousstuffswithwhichIusedtoclothemyself....ThirtythreestonesIputinthesolesofmyshoesbecauseI havesooftenoffendedGodwithmyleapinganddancing....IflagellatemybodyfortheimpiousandcarnalpleasureswithwhichIindulgeditduringmymarriageandoutof regardformyLordwhowaswhippedatthepostforme.113

Somewomen,suchasMaryofOignies,JaneMaryofMaill,RitaofCascia,DorothyofMontau,andCatherineofGenoa,hatedtheirmarriages.Althoughtheexact reasonsareoftenimpossibletoretrievenow,dislikeofsexwasclearlyone.FrancescaRomanade'Ponziani(d.1440),forexample,vomitedwhenevershewas forcedtohavesexualrelationswithherhusband.YvetteofHuy(d.1228)said,afterherhusband'sdeath,thatnothingcouldcompelhertothesexualactagain.114 Andmedievalmarriageswereoftenbrutal.Foreverywifewhopersuadedherhusbandtoacceptcontinenceontheweddingnightorafter,thereisastoryofawoman (forexample,ClareofAssisi'ssister)beatenalmosttodeathbyahusbandwhomsherefusedtoaccept.115Thusitseemsreasonabletosuggestthatsomemedieval womenrenouncedfoodbecauseofoverpoweringanddeeplyrootedfearsofsexuality.WhenwomensuchasMargeryKempeandAngelaofFolignofasted,they werediscipliningbodiesthathadpreviously,theyfelt,runoutofcontrolinhungerandthirstanderoticdesire.WhengirlssuchasRitaofCasciaandCatherineof Genoafasted,theywereexertingcontroloverfleshbecausefleshwas


infactwhateveritsemotionalresponseactedupon,bythedemandsofthemaritaldebt,inwaysabhorrenttoitsinhabitor. Thefoodpracticesofmedievalwomenthussometimesappeartobeeffortsnotjusttocontrolbuteventoattackorpunishthebody.And,aschapter2demonstrates, therewasclearlyanelementofdualisminthefastingpracticesoftheFathers,whichmedievalwomeninherited.Althoughthereweremanystrainsinantiquefasting,the notionofdiscipliningorevenpunishingthebodywasclearlyone.SomeoftheFathersexplicitlysawtheasceticallifeasasubstituteformartyrdomorasahurtingof thebodytoforceittovirtuousdeeds.Gluttonywasseenasthecauseofmoreserioussins.AsJohnClimacusputit:thesonsofgluttonyarefornication,hardeningof theheart,andsleepwithimpurethoughtsitsdaughtersincludelaziness,loquacity,scurrility,andboldness.116Thusfasting,aspseudoAthanasiussays,purifiesthe bodyandthemind,dryingupbodilyhumorsandputtingimpurethoughtstoflight.117TheSayingsoftheFathersreportsthewordsofacertainDaniel:"Asthebody waxesfat,thesoulgrowsthinandasthebodygrowsthin,thesoulbysomuchwaxesfat.118JohnChrysostomrelatedsuchargumentsparticularlytowomenwhenhe said:"Nothingisworsethanadissipatedwomannothingworsethanadrunkenwoman.119Thesenotionswererepeatedbylatermedievalpreachersandspiritual advisers.PeterDamian,forexample,writingofapenitentwhocarriedhisfastingbeyondLent,saidthatitwasdoneto"crucifythecarnalpassions,"to"breakthetaste andextinguishthefervorofconcupiscence."PetertheChanterwarnedthatwemustmakeourbodiespure,"forthestomachandthegenitalsareclosetogether''thus "wemustbearthestigmataofChristinourbodies(Gal.5:6)byabstinenceandpenitence."120 Onestraininmedievalmoralteachingthusassociatedfastingwithakindofpractical(notphilosophical)dualism.Accordingtothisstrain,abstinencewasrejectionof body.Moreover,thereissomereasontoarguethatwomenweremoredrawntosuchfastingthanmenbecausewomenwereespeciallyassociatedwiththeevilsof body,whichneededtobepunishedorexpiated.BorrowingfromJerome,Augustine,andGregorytheGreat,amongothers,medievalmoralteachingsawwomenas especiallyafflictedwiththeweaknessoftheflesh. Antiqueandmedievalmisogynyanditsrootsindualismarephenomenatoowellknowntoneedmuchexplanationhere.121Fromthescientificandphilosophical traditioncamethenotionofwomanasanincomplete


orinferiormaleandtheideathat,intheprocessofconception,womanprovidedthematterfromwhichthefoetuswasshapedwhereasmancontributedtheshapingor animatingformorprinciple.FromtheFathersofthethirdandfourthcentury,newlyconcernedwithsexualdesireastheparadigmforhumanevil,camethenotionof womanasfleshandmanasspirit.Itistrue,asseveralrecentscholarshavestressed,thatAugustinebelievedtherewasfriendshipwithinmarriageandspokeof marriageastheredemptionofthesexualact.122Buthealsotreatedsexualdesireasthemostbasicsymbolofwillfulnessandsawthefemaleasthesymbolofaflesh thatmustbesubjecttothemale(spiritorreason).Suchviewsledtotheassumptionoflatermedievaltheologiansthatvirtuewasharderfor"weak"womentoachieve. Themedievalchurchitselfelaboratedakindoffunctionalinferiorityofwomentocomplementthephysiologicalandontologicalinferiorityelaboratedbyearlier philosophicalandtheologicaltradition.Althoughsome(forexample,Aquinas)arguedthatwomenwereunfitforpriesthoodbecauseoftheirnaturalstateofsubjection andsome(forexample,Bonaventure)disqualifiedwomenbecauseofChrist'smalesex,woman'sincreasedexclusionfromclericalleadershipandfromcertainnew typesofevangelicalreligiouslife(forexample,mendicantpoverty)wasconnectedtothenotionofherinferiorityi.e.,herfleshlinessandweakness.123Eventhefolk tradition,initscarnivalritualsofreversedsexrolesanditslewdtalesofcuckoldedhusbands,expressedaclearsenseofthefemaleasdisorderlyandsexually voracious.124Itthusseemspossibletosuggest,asthevastmajorityofhistorianshavedone,thatwomenunderstoodthemselvestobesymbolsoftheflesh,sawfasting andotherformsofasceticismasweaponsforroutingthatflesh,andthereforeadoptedextremestarvationandotherformsofselfmutilationinanefforttorisetothe levelofspiritandtobecome,metaphoricallyspeaking,male.C Tomakesuchanargumentappears,however,toinvolveaprofoundmisunderstandingoflatemedievalreligiouslife.Idonotdenythatdualismwasoneelementin asceticismorthatmisogynywasoneelementinwomen'sselfperception.Andanegativesenseofthefemalebodyclearlyunderlaybehaviorsthatweredirected towardshuttingoffmenstruation,excretion,hunger,sexualresponse,andeventheordinarysensationsofwarmthandtouchandsleepiness.Butlatemedieval asceticismwasnot,atitsmostbasiclevel,dualistic,norwasinternalizedmisogynythedominantelementinwomen'sconceptionoftheirreligiousrole.Wemustgo


beyondtheinterpretationsthatseewomen'sfoodbehaviorasprimarilypunishmentorcontrolofbody.Andwemustdothisforthreereasons.First,women'sfood behaviorfastingandfeedingwasaneffectivewayofmanipulatingtheenvironmentinaworldinwhichfoodwaswoman'sprimaryresource.Second,women's radicalasceticismwaslessaninternalizingofthechurch'snegativeviewsoffleshandfemalethanarebellionagainstthemoderationofthehighmedievalchurch,which wasmovingtowardamorepositivesenseofthebody.Third,foodasceticism,fooddistribution,andeucharisticdevotiondidnot,tomedievalpeople,meanself torturerather,theywerewaysoffusingwithaChristwhosesufferingsavestheworld. Inthenextchapter,Iconsiderindetailthefirsttwoofthesethreearguments.Iconsider,thatis,howwomencontrolledandmanipulatedtheirenvironmentthroughtheir controloffood,andwhytheyneededtodoso.AndIarguethatwomen'sradicalasceticismwasnotonlyarejectionofaworldinwhichtheyhadlittlecontrolover theirbodiesandtheirdestiniesbutalsoarejectionofachurchwhich,asittouchedmoreandmoreoflifeandprovidedordinaryfolkwithappropriatewaystobe religious,seemedathreataswellasanopportunitytothosepiouswomenwhowanted,withoutcompromiseormoderation,toimitateChrist.


7 FoodAsControlofCircumstance
Astheycamebyacross,herhusbandsatdownunderthecross[andsaid]:"Margery,grantmemydesire,andIwillgrantyouyourdesire.Myfirstdesireisthatweshallstilllie togetherinbedaswehavedonebeforethesecond,thatyeshallpaymydebts,ereyegotoJerusalem[onpilgrimage]andthethird,thatyeshalleatanddrinkwithmeonthe Fridayasyewerewonttodo." "Nay,sir,"saidshe,"tobreaktheFriday,IwillnevergrantyouwhilstIlive." "Well,"saidhe,"thenIshallmeddlewithyouagain." Sheprayedhimthathewouldgiveherleavetosayherprayers,andhegranteditkindly.... ThenOurLordJesusChristwithgreatsweetnessspoketoher,commandinghertogotoherhusband,andprayhimtograntherwhatshedesired,"andheshallhavewhathe desireth.For,mydearworthydaughter,thiswasthecausethatIbadetheefast,sothatthoushouldstthesoonerobtainandgetthydesire,andnowitisgrantedtothee.Iwillno longerthatthoufast.ThereforeIbidtheeintheNameofJesus,eatanddrinkasthyhusbanddoth." ThenthiscreaturethankedOurLordJesusChristforhisgrace,andgoodness,androseupandwenttoherhusband,sayingtohim: "Sir,ifitpleaseyou,yeshallgrantmemydesireandyeshallhaveyourdesire.Grantmethatyewillnotcomeintomybed,andIgrantyoutorequiteyourdebtsereIgoto Jerusalem.MakemybodyfreetoGodsothatyenevermakechallengetome,byaskinganydebtofmatrimony.Afterthisday,whilstyelive,IwilleatanddrinkontheFridayatyour bidding." Thensaidherhusband:"AsfreemayyourbodybetoGod,asithathbeentome." THEBOOKOFMARGERYKEMPE(1436)1


Tostresswomen'sfoodpracticesandconcernsascontrolofbodyistofocustoonarrowlyonfastingonnoteating.Infact,aswehaveseen,women'sfastingwas partofabroaderpatternofbehaviorinwhichfeedingothersandeatingGodwerealsocentral.Women'sfastingwasexplicitlyseen,bywomenthemselvesandby theirconfessorsandadvisers,aspreparationbothforreceivingtheeucharistandforalmsgiving.Womengavetothepoorandsickthefoodtheydeniedthemselves womencleansedtheirbodiesofprosaicfoodinordertoreadythemforthecomingofthefoodthatwasChrist. Whenwelookatwomen'svariousfoodpracticestogether,wefindthatvoluntarystarvation,charitablefooddistribution,andeucharisticdevotionwereallmeansby whichwomencontrolledtheirsocialandreligiouscircumstancesquitedirectlyandeffectively.Farfromsubstitutingcontrolofselfforcontrolofcircumstanceor destroyingegoandbodywhileattemptingtodirecttheattentionofotherstowardthem,women'sfoodpracticesfrequentlyenabledthemtodeterminetheshapeof theirlivestorejectunwantedmarriages,tosubstitutereligiousactivitiesformoremenialdutieswithinthefamily,toredirecttheuseoffathers'orhusbands'resources, tochangeorconvertfamilymembers,tocriticizepowerfulsecularorreligiousauthorities,andtoclaimforthemselvesteaching,counseling,andreformingrolesfor whichthereligioustraditionprovided,atbest,ambivalentsupport. FoodandFamily InthestoriesItoldinchapters4and5,itisveryclearthatwomenoftencoercedtheirfamiliesboththroughfastingandthroughfeedingothers.2 Toanaristocraticor risingmerchantfamilyoflatemedievalEurope,thevoluntarystarvationofadaughteroraspousecouldbedeeplyperplexingandhumiliating.Thecharitableactivities offemalefamilymemberscouldappeartoberejectionofthefamily'ssuccessandofitsvalues.Awoman'sfastingandfooddistributioncouldthereforebeeffective meansofcriticizing,manipulating,educating,orconvertingfamilymembers. Letmebeginwithafewexamplesinwhichfoodpracticeshadveryspecificresults.Oneofthemostcharming,fromtheautobiographyof


thefourteenthcenturyEnglishwomanMargeryKempe,isquotedintheepigraphabove.Inthispassage,Margery,speakingofherselfinthethirdperson,describesa discussionwithChristaboutherasceticpractices.Theexchangehassomethingofthetoneoftwohousewivesgossipingabouthowtomanageadifficultandchildish husband.ChristandMargerydecidethatalthoughMargerywishestopracticebothfoodabstentionandsexualcontinence,sheshouldoffertotradeonebehaviorfor theother.Themostinterestingaspectofthepassage,forourpurposes,isthefactthattheploywassuccessful.Margery'shusband,whohadmarriedherinaneffortto risesociallyinthetownofLynnandwasobviouslyashamedofherqueerpenitentialclothesandfoodpractices(aswellasbeinginneedofhermoney),finallyagreed togranthersexualabstinenceinprivateifshewouldreturntonormalcookingandeatinginfrontoftheneighbors. Otherexamplesofsuccessfulmanagementoffamilymembersthroughfoodpracticesareeasytofind.RitaofCasciaandCatherineofSiena'ssisterBonaventura,who apparentlyreactedtoprofligateyounghusbandsbywastingaway,weretherebyabletotamedisorderlymalebehavior.MaryofOigniesandCatherineofGenoa eventuallywonovertheirhusbandstolivesofchastityandcharitybythemodeloftheirownbehavioramodelmademoreconvincingbytheheroicseverityoftheir selfdenial.ColumbaofRietiandCatherineofSienarebelledagainsthouseholdtasks(andagainstthemotherswhoimposedthem)byrefusingtoeat.Columba, CatherineofSiena,andIdaofLouvainalsousedtrancesatwhatwere,tothefamily,veryinconvenientmomentsinordertoavoiddomesticroles:bothCatherineand Columbasupposedlyletbabiesfallintothefirewhiletheywereraptinmysticalecstasy. Wivesaswellasdaughtersusedfasting,charity,andecstasyasmeanstoescapetheroleoffoodpreparerornurturer.DorothyofMontau,likeMargeryKempe, madeelementarymistakesincookery(suchasfailingtoscalethefishbeforefryingthem)orforgotentirelytocookandshopwhileshewasinmysticaltrances.The ItaliantertiaryMargaretofCortonarefusedtocookforherillegitimateson(aboutwhomsheobviouslyfeltagonizingambivalence)because,shesaid,itwoulddistract herfromprayer.3 Butsheenergeticallyfedthepoorandsickbothbymiracleandbycharity.WearetoldbyRaymondofCapuathatCatherineofSiena,afterher death,miraculouslycookedforawomandevoteewhohadgone


tochurchinsteadofpreparingdinnerforhersons.Catherinethus,frombeyondthegrave,blessedandapprovedbymiracleawoman'sescapefromtheordinary maternaldutyoffoodpreparation. Sincefoodpracticessosuccessfullymanipulatedandembarrassedfamilies,itisnotsurprisingthatvoluntarystarvationandcharitablefooddistributionoftenoriginated orescalatedatpubertythetimeatwhichfamiliesbegannegotiationsforhusbandsfortheirdaughters.FemalesaintssuchasCatherineofSiena,Columba,Lidwina, FrancescaRomana,andMargaretofHungarysometimescutofftheirhairtomakethemselvesugly,longedfordiseaseasanescapefrommarriage,orthreatenedself mutilationifthatwastheonlywaytoavoidahusband.MargaretofHungary,forexample,whenofferedasuitor,threatenedtocutoffhernose.4 Itthusseemslikely thatfastingwassometimesanefforttoavoidorpostponeanunwantedmarriagebybecomingphysicallyunattractive.Fromthemomentmarriagewassuggestedtoher, LidwinaofSchiedamwantedtobeugly,andshemayhavebeencultivatingphysicalproblemsbeforeherfallontheiceandhermiraculousabstinence. Butfastingandgivingawayfamilypropertywerenotmerelywaysofappearinguglyandintractable,andtherebypresentingoneselfasunpromisingmaritalmaterial. Theywerealsowaysofdefiningoneselfbychoosingaverydifferentlifefromthatofone'sfamily.Andtheywereeffectiveways.Somegirls,suchasChristinaof Markyate,Lutgard,MechtildofMagdeburg,andElsbetAchler,hadtofleetohermitages,beguinages,orconventsinordertoescapefamilyothers,suchasCatherine ofSienaandLidwina,createdpartlybytheirextravagantfasting,charity,andeucharisticdevotionanalternativetomarriagewithouteverleavinghome.5 Giventhe optionsopentomedievalgirls,whocouldhardlypicktheirhusbandsortheirfuturesdirectly,suchbehaviorswereoftenconstructivewaysofescapingfromunwanted suitorsandchoosingtoserveandinfluenceabroaderworldthanthatofthekitchenandthenursery. Wemustnotforgetthatavoidingmarriagewasnoteasy.Manygirlswereforcedtoaccepthusbands.FrancescaRomana,forexample,eventuallyacceptedmarriage andboreseveralchildren,althoughshehadfeltagreatabhorrenceofmensincechildhoodandhadsufferedfromparalysisatpubertywhenherfatherrefusedher permissiontoenteraconvent.6 Onceagirlwasmarried,sheoftenhadtowaitlongyearsuntildeathordisasterstruckherhusbandbeforeshecouldpursuethe


religiouspracticesshecraved.(Onesuspectsthat,withoutherhusband'sbankruptcy,CatherineofGenoa'sreligiousgeniusmightneverhaveacquiredvoice.)A comparisonofmaleandfemalesaints'vitaesuggeststhatmedievalparentswerelesswillingtoacceptthereligiousvocationsofdaughtersthanthoseofsons.7 Even thereligioustraditionpresentedgirlswithcontradictoryidealsthatofthedutifuldaughter,whopatientlyacceptedtheparents'choiceofhusband,andthatofthe heroicvirgin,whoboreanytortureratherthansurrenderhervirginity.Thefactthatthevitaeofwomensaints(incontrasttothoseofmen)showapatternofvocations tovirginityemerginginchildhoodperhapssuggeststhatgirlswhomanagedtodefinetheirownstatusesparticularlyastertiariesandbeguines,setapartbyvirginitybut livingintheworldhadtostartpreparingthewayearlyforfamilyacceptanceoftheirvocations.8 Severalscholarshaverecentlysuggestedthatconflictbetween parentsandchildrenoverreligiousvocationincreasedinthethirteenthandfourteenthcenturies.9 Fastingandcharitablefooddistributionseemtohavefunctionedas weaponsgirlsdeployedintheintrafamilywar. Indeed,women'sfoodpracticeswereinsomesensearejectionoffamily.AsDavidHerlihyhassaid,afamilyisagroupofpeoplewhoresideandespeciallyeat together.Torefusecommensalityisbothtorefusethemealassymboloffamilialbondandtorefusethemostbasicsupportthatafather'smoneyandamother's householdskillcanprovide:food.10Togiveawaythecontentsoffamilycupboardsandcellarsistorejectthecomfort,thesecurity,andthesocialstatusthatthelabors ofthefamilyprovideitisalsotorejectthevaluesofparentswhoclingtosuchstatusandcomforts.Manymedievalgirlsseemtohaveexpressedsuchrejection,both oftheirownfamiliesandofthestateofmarriage,throughfastingandfooddistribution.11ColumbaofRieti,forexample,oncegaveawaythefamily'sfooduntilthere wasnothinglefttoeat.Somefamilies,understandingthemessageofrejection,respondedwithrageorridiculeorpersecution.ChristinatheAstonishing,forexample, soangeredhersistersbyhercharityandasceticismthattheylockedherup.Somefamilies,however,gavegrudgingandpuzzledacceptance,evensupport,totheir daughters'desiresforreligiouslife,thusmanifestingtheirownambivalenceaboutmarriageandfamilies.LidwinaofSchiedam'smother,forexample,althoughshewas annoyedwithherdaughter'sneglectofdomesticduties,supportedherinherhesitationsaboutmarriage.InthelifeofCatherineofSienaweseefoodpracticesasa


quitesuccessfuldevicebywhichagirlavoidsbecominganobjectinthemarriagemarketasheroldersistershaddone.ButCatherine'sfoodpracticesweremorethey werealsothegirl'sselfdefinitionandherintenserejectionofparental,especiallymaternal,values. Catherine'svitashowshowconstrictedlifecouldbecomeforagirlonceshecametoherparents'attentionasmarriageable.Asachild,Catherinehadbeenpermitted towanderaroundthecityandplayinthestreetssofreelythat,ononeoccasion,noonenoticedherdaylongabsencefromhome.12Atpubertyshesuddenlyfound herselfpressuredtogroomherselftoattractmenandallowedoutofthehouseonlywithachaperone.SmallwonderthatCatherineandherparentsthenbegantofight overbothherphysicalappearanceandherrighttoprivacy.Catherinerejectedherparents'ambitionsforherbycuttingoffherhairandstarvingherselfherparents respondedbydenyingheraroomofherown,aspacewithinwhichshecouldpracticetheprayerandasceticismthatdefinedherasreligious.Whenforcedtosharea bedwithhermotherbecauseofherrefusaltosleepandherbusynessallnight,Catherineputaboardunderthemattressorcreptoutofbedtolieonthefloor.When takenagainstherwillonaholiday,Catherinescaldedherbodyinthehotbathsofthevacationspot.Thus,byaseriesofasceticbehaviors,Catherineslowlyforgedfor herself,withouteverleavinghome,alifewhosevalueswereutterlydifferentfromthoseofherwealthymerchantfatherandherdoting,efficientmotherwithabroodof twentychildren.Ittookamiracletobringherfathertoacceptanceofherlifeandhermotherwhounderstoodonlytoowellwhatitmeantseemsnevertohave beencompletelyreconciledtoit. ItishardnottoseeintenseconflictwithfamilyinCatherine'sbehavior,aconflictinwhichfastingwascrucial.Similarlyitishardnottosee,inElizabethofHungary's practiceofgivingawayfoodfromherhusband'stable,intenserebellionagainstherhusband'sfamily,bywhomshehadbeenraised.Herrefusaltoeat(orfeedher servants)anyfoodexceptthatpurchasedwithmoneyfromherdowryseemstoreflectadeepsensethatonlypropertyfromherownpaternalline(i.e.,fromthefamily thathadnotraisedher)couldbetrustedasmorallyuntainted.AlthoughthewellknownstorythatElizabeth'sbasketofbreadforthepoorturnedintoroseswhenher husbandaccostedherisapocryphalanduntruetoallweknowofLouis'sattitude,itissignificantthatthestory,withits


implicationsofintrafamilyconflict,wastoldandtoldnotjustofElizabethbutofatleastfivewomensaintsinthelaterMiddleAges.13 ForIdaofLouvain,whosevitaisinterwovenwithfoodmotifsofallkinds,rejectingdrinkwasarejectionoffamilyvaluesinamorespecificsense.Ida'sextreme fasting,herfascinationwiththeinebriatingdelightsofChrist'sblood,herrepeatedmiraclesthatchangedotherfluidsintowine,herrefusaltoacceptanyfoodor economicsupportfromherfamilyotherthantheroomshelivedin,andherobsessionwithgivingawayfoodanddrinksurelyowesomethingtothefactthather merchantfather,whosevaluesshewasrejecting,soldwine.Rejectionoffamilyauthorityandvaluescould,moreover,focusonsurrogatefamiliesaswellasbiological ones.JulianaofCornillon,whowasraisedbyanursecalledSapientiainasmallcelldependentonareligioushouseandwasdisciplinedasachildforwhather confessorsawaswillfulandexcessivefasting,returnedtoselfstarvationinadolescence.Onesuspectsthatthisbehavior,andthestubborn,enigmaticresponsesthat shemadetohersistersconcerningit,wereinpartexpressionsofhostilitytowardthereligious"family"thathadrearedher. HistoriansofthemodernandearlymodernworldsuchasLawrenceStone,PhilippeAris,andPeterLasletthavelongarguedthattheMiddleAgeshadlittle conceptionofchildhoodandnoneofadolescence,thatthecloseknitaffectivefamilywasaproductofthelateseventeenthandeighteenthcenturygentryand bourgeoisie,thatmedievalfamilieswereextendedratherthannuclear,andthatmedievalparentsoftenhadlittletodowithrearingtheirchildren.14Ifthiswereso,one couldhardlyexpectfamilydynamicstoplayaroleinthefoodpracticesofmedievalgirls.ButhistoriansoftheMiddleAgeshaverecentlyobjectedtothispicture.15 Theysuggest,partlyonthebasisofthesaints'livesIdescribeaboveinchapters4and5,thatthenuclearfamilywithtightaffectivebondsdidexistintheMiddleAges, particularlyinurbanareasinthethirteenthandfourteenthcenturies.16Theyalsosuggestthatagnaticorpatrilinealprincipleswerereplacingthebilinealfamilyinthelater MiddleAges,makingthesituationofdaughtersmoreproblematicbutnoteclipsingafamilysenseofresponsibilityforthem.17Ifdaughterswereincreasinglyaproblem forfamilies,itstandstoreasonthatfamilywasincreasinglyaproblemfordaughters. Recentresearchdemonstratestheproblemveryclearly.After1200,


women'slifeexpectanciesoutranmen's.Womenbecameasurplusinthepopulation.Thetypicalagediscrepancybetweenhusbandandwifeincreased.(Onaverage, menmarriedat30,womenat15to17.)Thedowrynowthedaughter'sonlyclaimonthefamilyproperty,aspatrilinealprinciplestriumphedinflatedwildly.Bythe fourteenthcentury,asDantetellsus,thebirthofadaughtercouldbringdespairtoafather'sheartifhecontemplatedwhatitwouldcosttoprovideforher.18But exactlybecausehedidfeelsomeobligationtohisfemalechildren,aprosperousfatherpushedtoarrangeearlymarriagesfordaughters.Itthusseemsreasonableto suspectthatdaughtersresentedthepressure,feelingguiltyaboutthestraintheirdowriesputonfamilyresourcesandyetangryaboutthefactthatthisonelarge paymentboughtofftheirparents'obligationtothem.Eveninthethirteenthcentury,ElizabethofHungary'srefusaltouseorconsumeanythingderivedfromtheproperty ofherhusband'sfamily,whoraisedher,canbeinterpretedasherwayofclingingtoherdowrytheonlythingsheretainedfromthefamilythathadsentherawayto beraisedinaforeignland.Suchsocialfactssuggestthatsomegirlsmayhaveseenbetrothalandmarriageasabandonmentbytheirownfamilies.Itisthusnot surprisingthatadolescentssuchasFrancescaRomana,LidwinaofSchiedam,andCatherineofGenoareactedwithawildanger,whichturnedinwardtoward themselvesasselfhatredordespair,whensuitorswereproposed. Marriageforawomanwasalifethreateningundertaking,andsomefemalehesitationneedsnomorecomplexexplanationthanthis.Daughtersgrewupexposedtothe drudgeryofhouseholdtasksandaware,throughtheexperiencesofoldersistersaswellasmothers,ofthepainanddangersofchildbirthapointpreachersdidnot failtorefertoinsermonsandtreatisesonvirginity.19Forexample,CatherineofSiena'smomentarysurrendertohersister'sinsistencethatshemakeherselfprettyto attractmenwasbroughttoastunningconclusionwhenthatsamesisterdemonstratedtowhatitallreallyledbydyinginchildbirth.Itisthushardlysurprisingthatsome girlsrejectedmarriageandsomebridesstruggledfiercelyanddesperatelyforcontinence.Norisitsurprisingthatparentsandhusbandsthemselvesambivalentabout familyandmarriageforthesameculturalreasonsthatconvincedtheirdaughtersandwivessometimesgavesupporttowomenwhoescapedtoreligioushousesor wholived,undertheirownroofs,alifesetapart.Moreover,asseveralscholarshaveunderlined,thebehaviorofmedieval


merchantsoftensuggestsambivalence,evenguilt,aboutthewealththeysoeagerlygarnered.20Permittingawifeoradaughtertogiveawaythiswealthmight exacerbatesuchambivalencebutitmightalsoassuageguilt.Somefamiliesandhusbandsclearlyexpressedtheirreligiousimpulsesthroughtheirdaughters'andwives' asceticism.Andsomehusbands,suchasCatherineofGenoa'sandMaryofOignies's,evenespousedchastity,charity,andfastinginimitationoftheirpiouswives. Thuswomen'sfoodpracticeswereeffectivewaysofshapingtheirlives,ofrejectingrolestheydidnotdesire,ofcriticizingandredirectingthevaluesofhusbandsand parents.21Butitwasnotmerelyfamilywhowereinfluencedbysuchpracticesfoodbehaviormanipulatedandcontrolledreligiousauthoritiesaswell.Bytheir eucharisticvisions,theircharity,theirfoodmiracles,andtheirfasting,medievalwomenbypassedcertainformsofclericalcontrolthatstoodbetweenthemandGod. Theyalsoforgedforthemselvesrolesashealers,teachers,andsaversoftheirfellowChristiansthatwereinexplicitcontrasttothecharacteristicformsofmale leadership. FoodPracticesandReligiousRoles Whenweturnfromthefunctionoffoodpracticeswithinthefamilytothefunctionoffoodpracticeswithinthechurch,itiscrucialtonotethatfasting,feasting,and feedingaremerelyaspectsofthesamephenomenon:thereligioussignificanceoffood.Theseaspectswerecloselyintertwinedinthedailylivesofholywomen. Whetherawomanwaswithdrawnfromtheworldorlivinginit,whethershesawherselfasacontemplativeorasaservantofthepoor,shetendedbothtorejectfood andtoseeitasapowerfulsymbolofunion.Girlsandwomenwhofastedhungeredfortheeucharistandreceived,alongwithit,visionsandsupernaturalsignsthat bestowedpoweruponthem.Fastingwomengave,totheneedy,food,alms,andotherlesstangiblebutevenmoresignificantbenefits,suchasremissionofpurgatory orinsightintothetruestateofthesoul. Takentogether,thefoodpracticesofholywomensometimesbypassedtheclergy,sometimesexposedtheirfailures,andsometimesfranklyusurpedtheirauthority notsomuchbyclaimingpriestlyofficeasbysimplyallowingChristorthespirittospeakthroughthe''weakerves


sel."22Itiseasiesttoseethewayfoodpracticesmanipulatedreligiousauthoritiesbylookingateucharisticmiracles,especiallythosemiracles,toldalmostexclusively ofwomen,inwhichunconsecratedhostsorunchastecelebrantswereidentified.Suchmiraclesgrewdirectlyoutoffemalefasting.Observersagreedthatfastinggirls generallyvomitedoutanyfoodtheyweremadetoreceive.Theabilityofsuchgirlstotolerateeucharisticbread(whichsometimesturnedtohoneyorfleshintheir mouths)wasindeedsometimesusedbytheologianssuchasThomasNettertoprovethedoctrineoftransubstantiation.23Ifordinarybreadcouldnotbetolerated,then thatwhichwasswallowedmustbethefleshofChristifnootherfoodwasevertaken,theweeklyordailymorselthatalonesustainedlifemustbethebodyofGod. Whetherapiouswomanswallowedorvomitedthusbecameatestofthepriestwhoprovidedthewafer.IfatrulyholywomansuchasMaryofOignies,Lidwinaof Schiedam,orJoantheMeatlessvomitedoutahost,suspicionimmediatelyturnedonthepriestwhohadofferedit.Thefaithfulassumedthathehadgiventhegirlan unconsecratedhost,eitherbymistakeorbydishonesty.Goingfurther,theymightseethepiouswoman'srejectionofthehostasareasonforquestioningthepriest's actofconsecration.Howevertheologicallyunsoundtheconclusionmightbe,theytendedtodeducethatinsomeunspecifiedwayhewasdisqualifiedbyimmorality (usuallysexualimmorality).IntheconflictofLidwinaofSchiedamwithherpriest(discussedabove,pp.12829),suchamiracleproveddecisive.Lidwina'sgaggingon thehostwastakenbysomeadherentsasproofofthepriest'sdeviousnesshehadnotinfactofferedherthehost,theythought,buthadattemptedtotrickherinstead. Lidwinaherselfthenpresentedherabilitytoswallowadifferenthostasproofofitsdivinesource.AndthelessonthatthissecondhostarriveddirectlyfromChristto replacethepriest'sfraudulentofferingwasnotlostonthosewhoflockedtoseethemiraculousdropsofbloodwhichgracedit.Lidwinanotonlyachieved,throughthis drama,thefrequentcommunionshecravedthroughthisandotherinsightssherepeatedlycriticizedthepriestandestablishedageneralimpressionofhis dissoluteness.24 Women'seucharisticvisions,liketheirsenseoftaste,wereakindoflitmustestforclericalimmoralityornegligence.Womenfrequentlysawthecorruptionoftheclergy atthemomentofconsecrationorelevation.


MargaretofCortona,forexample,sawthehandsofanunchastepriestturnblackwhenheheldthehost.Whenthepriestbroughtanunconsecratedwaferbymistake, Margaretvomiteditout.MaryofOigniesandIdaofLouvainalsoknewmiraculouslywhencelebrantswereunchasteorunauthorizedtoofficiate.ColetteofCorbie wasaware,asifbymiracle,whenthepriestforgottofillthechalicewithwineduringmass.25Womensometimesalsosaw,ineucharisticvisions,thefailingsoftheir fellowChristians.AnunofEngelthal,forexample,sawthehostturnintotheChristchild,whothencamedownfromthealtarandapproachedhersisterswithbehavior thatvariedaccordingtotheirrespectivedegreeofpurity.26 Clericswerenotmerelypassivelymanipulatedbysuchvisions.Theyactivelysought,inholywomen,bothastandardofpietyandawindowopentothedivine. Religiouswomenwereseenbymenasanalternativetoandacriticismofwealth,power,andoffice.Intheirvisionsanddevotions,womenmysticswerethepoint wherethepowerfulmalefoundareversalandacritiqueofexactlythosethingsaboutwhichhefeltgreatestambivalence.27Woman,inotherwords,was"liminal"to meninthetechnicalsensegiventhetermbytheanthropologistVictorTurner.28ThomasofCantimpr,JamesofVitry,andTauler,amongothers,deliberatelyused storiesoftheeucharisticdevotionofholywomentoshametheclergyforlukewarmpiety.JamesandThomasalsospokeofthewomenwhosestoriestheychronicled as"mothers"toclericsanddescribedtheirinspirationofmenasaformof''preaching."29ThebiographersoftheItaliantertiariesAngelaofFolignoandMargaretof Cortonasawthemasspiritualmotherswhohadonly"sons"(theFranciscanfriars).ThirteenthcenturyhereticalgroupssuchastheGuglielmitesinItalyandthe followersofBloemardineintheLowCountries,whotriedtosetupafemalechurchorpreachafemaleGod,hadmalefollowersandmay,asheresies,havebeenmale creations.30Inspiredcriticismofmaleespeciallyclericalcorruptionwasunderstood,bybothmenandwomen,tobeafemalerole.MechtildofMagdeburg,for example,whodidnotscrupletohurlabusiveepithetsatlocalcanonsandfriars,sawvisionsinwhichhellandthelowercirclesofpurgatorywerepopulatedentirelyby men(withtheimportantexceptionofprincessespresumably,toMechtild,theonlypowerfulandthereforedangerousfemalerole).31Thefunctionofpointingout uncomfortabletruthstosociety


wassometimesseenaspossessionbydemonsratherthaninspirationbyChrist,butwhetherdemonicordivine,itissuedprimarilyfromwomen,whoweremarginalto therolestheycriticized.32 Women'svisionscamemostfrequentlyinaeucharisticcontext.Andwomen'sspecialandintimaterelationshiptotheholyfoodwasitselfoftenawayofrejectingor bypassingecclesiasticalcontrol.Latemedievaltheologiansandconfessorsattemptedtoinculcateaweaswellascravingfortheeucharist,andwomennotonly receivedambiguousadviceaboutfrequentcommunion,theywerealsosometimesbarredfromreceivingitatexactlythepointatwhichtheirfastingandhungerreached feverpitch.33Insuchcircumstances,manywomensimplyreceivedinvisionwhatthecelebrantorconfessorwithheld.AliceofSchaerbeke,deniedthecupbecauseof leprosy,wasreassuredbyChristinimpeccablethirteenthcenturytheologythatshereceivedbothbodyandbloodinthehost,34butitwasfarmorecommonforChrist toprovidethedesiredcommunioninavisionthantoreassurethewomanaboutitsabsence.WhenLutgardofAywireswasrequiredbyherabbesstoomitfrequent communion,Godengineeredeventssothatthebenefitwasrestored.35WhenlittleImeldaLambertini(d.1333)wasdeniedcommunionbecauseshewastooyoung, thehostflewdownfromheavenandhoveredoverher,andthepriestwasforcedtogivehertheeucharist.36WhenIdaofLau'sCisterciansuperiors(inaneffortto curbwomen'sdevotion)passedlegislationdenyingaccesstothecuptoanynunwhowentoutofhersenses,ChristprovidedIdawithcommunion.37IdaofLouvain, deniedcommunionbecauseshewasanovice,hadtheimpressionthatsheslipped(whetherbodilyorinavisionsheneverknew)intotheranksofthenunstoreceive thehostonanotheroccasion,whentherewasnoservice,shewasmiraculouslytransportedintothetabernacletotasteGod.38StoriesofChristasapriestbringing thehostorthechalicetosickwomenareverycommon.Thenuns'bookofTss,forexample,describesavisionseenbyanuntoosicktoswallowtheeucharist:a tableclothdescendedtoherwithChrist'sbodyonaplatterinabeautifullight,ahandappearedfromheavenandgaveher"ourLord""justasifshereceivedhimfrom thealtar."39 Boththevisionarywomenandtheirconfessorswereacutelysensitivetotheproblematicimplicationsofsuchvisions.Bypassingclericalauthoritymightbetakento implythatpriestswereunnecessary.ThusJamesofVitry,inhisHistoriaoccidentalis,tellsofafastingwomanwho


receivedcommunionfromadoveandaddsthatshereceiveditthenextdayfromapriestatthedove'scommand,"lestitbebelievedthatshewasdeprivedofthe receptionofthetruesacramentbyaphantasm."40Storiesofwomenwhoreceivedeithercommunionorabsolutioninavisionarefrequentlyglossedwithassurances thattheyhadrecoursetoapriestassoonastheywereable.InthevisioncollectionsproducedbythenunsofHelfta,forexample,thevisionitselffrequentlyexhortsits recipienttohastentoactualcommunion.41Butsometimesthewomanwhoisstrickenwithfaintingfits,paralysis,ornosebleedsatmassandexperiencesa"filling"by Christ,accompaniedbysensationsofchewingandsweetnessonthetongue,prefersthemysticalcommunion.IdaofLouvainandLukardisofOberweimarclearly preferrednursingatMary'sbreastorrestingwithinthearmsofChristandhadnodesireafterwardstoreceivetheactualelements. Somewomenwentevenfurtherintheirvisions:notmerelybypassingclericalmediation(andtherebyimplyingittobeunnecessary),theyactuallyclaimedakindof priestlyrole.Weseesuchachallengetothepriesthoodachallengethatalwaystreadsthethinedgeoforthodoxyinsomeofthevisionsofthethirteenthcentury nunGertrudetheGreat.WhenGertrudeassuredhersistersthattheywereforgivenbyChristandbadethemgotocommunion,avisioninformedherthatthosewho followedheradvicewereclosertoChristthaneitherthosewhoabstainedbecausenoconfessorwasavailableorthosewhocommunicatedwithoutconsulting Gertrude.42WhenGertrudeworriedabouthersins,Christtoldherthatherenewedinhersoul"allsevensacramentsinoneoperationmoreefficaciouslythananyother priestorpontiffcandobysevenseparateacts."43WhenGertrudereceivedthepowertodiscriminatebetweenguiltyandinnocent,"discerningthroughChrist'sspirit," Christinavisioncalledit"thepowerofbindingandloosing"anddescribeditasanalogoustoordination.44WhenChristinavisiontoldGertrudethathewouldbring topasswhatevershepromisedinhisname,hetouchedhertongue,saying,''Behold,Igivemywordsintoyourmouth,"andexplained:
IsnotthefaithoftheuniversalchurchthatpromiseoncemadetoPeter:Whateveryoubindonearthwillbeboundinheaven[Matt.16:19]?Andfirmlyshebelievesthistobe carriedoutbyallecclesiasticalministers.ThereforewhydoyounotequallybelievebecauseofthisthatIcanand

Page232 willperfectthatwhich,movedbylove,Ipromisetoyoubymydivinemouth?45

Noelementinthesevisionscontradictsorthodoxteachingonconfessionorcommunion,forGertrudeherselforthenunswhowroteofherexperiencescarefullygloss eachincidentsothatGertrudemerelyannouncesforgiveness,guilt,orinnocence,whicharefreegiftsorjudgmentsofGod.Butthebypassingofsacramentsandpriest isclear,asisGertrude'sownextraordinarypowertogivecounselintheirstead,andtheanalogyoffemalemystictopriestisrepeatedlydrawn. Itwasparticularlyintheireucharisticvisionsthatmysticalwomensawthemselvesin"priestly"imagesandclaimedrolesandopportunitiesotherwiseprohibitedtothem. Somewomenreceived,invisions,thepowertodistributetheeucharistandtotouchaltarvesselsapowertheywereforbiddenbecauseoftheirgender.46Some receivedtheconsecratedchalice,whichtheyweredeniedbecauseoftheirlaystatus.Forexample,awomanwhohadlovedJulianaofCornillonverymuchinherlife sawherafterdeathatmassthefriendthenreceivedfromChristthehighpriestarichandbeautifulchalice,andJulianahishandmaidenassistedhimwithhervirgin hands.MechtildofHackebornthoughtshereceivedfromChristhisheartintheformofacupmarvelouslychiseled,andhesaid:"Bymyheartyouwillpraiseme alwaysgo,offertoallthesaintsthedrinkoflifefrommyheartthattheymaybehappilyinebriatedwithit."AngelaofFoligno,feelingthatthecelebrantwasunworthy, hadavisionofChristbleedingonthecross,andangelssaidtoher:"OhyouwhoarepleasinganddelicioustoGod,behold,hehasbeenadministeredtoyouandyou havehimpresent.Moreover,heisgiventoyouinorderthatyoumayadministerandpresenthimtoothers."LukardisofOberweimarbroughttheeucharisttoafellow nunbyblowingintohermouth.47IdaofLouvain,whohadbeencriticizedbythechaplaintoherconvent,was"clothedinsacerdotalclothesorpricelessornaments" andmiraculouslyreceivedthehostwhilehecelebrated,unawareofherpresence.Moreover,onthefollowingday,sheagainmiraculouslyreceivedthesacrament duringamassatwhich''noonewasusuallyadmittedtoreceivethehostwiththeexceptiononlyoftheministerwhocelebrated."BenevenutaofBojano(d.1292)and MechtildofHackebornbothsawvisionsoftheVirginMaryadministeringthechalice.48CatherineofSiena,likemanyofherholypredecessors,repeatedlyreceiveda


sensationofbloodinhermouthwhenshetookthewafer.49Therewasnothingtheologicallyincorrectinsuchmiracles,forthefaithfulweretaughtinthedoctrineof concomitancethatbodyandbloodwerereceivedtogether.Furthermore,visionsofchalicesorflyinghostscouldalwaysbeinterpretedasimagesofgraceorcharity. Buttheinsistenceonreceivingbloodandondistributingtheelementsthatwefindinwomen'svisionsappearstoreflectakeendesireforthatwhichthewoman becauseofhergenderandbecauseofherlaystatuswasnotpermittedtodo. Thus,intheireucharisticvisions,womennotonlyreceivedGodasholyfood,theyalsosometimesclaimedforthemselves,atleastmetaphorically,boththepriest's proximitytoGodandthesacerdotalroleofmediatorbetweenhumananddivine.Moreover,themostextremeimplicationsofsuchfemalevisionswereoccasionally extrapolated,probablymorebymalethanbyfemaleadherents,intoheterodoxclaimssuchasthoseofthefollowersofBloemardineorGuglielmaforafemale clergy,afemalechurch,orperhapsevenafemalemanifestationofGodonearth.50Suchoccurrenceswereveryrare,however.Forthemostpart,womenclaimedthe priesthoodonlybyanalogyorinveryprivateandcarefullyglossedvisions.Indeed,holywomensuchasthenunsofHelfta,CatherineofSiena,andColumbaofRieti oftenfeltextravagantregardfortheclergy.Catherinecalledthem"littlechrists."Some,suchasMargaretofCortona,trembledbeforethepriestlypowertoconsecrate anddistribute(and,therefore,withhold)thesacrament.Itisthusincorrecttoseewomen'secstaticreligiosityprimarilyasapingclericalpower.Rather,womenforged, throughcharity,miracle,andfasting,analternativeroleanessentiallylayandcharismaticroleauthorizednotbyordinationbutbyinspiration,notbyidentification withChristthehighpriestbutbyimitationofChristthesufferingman.Women'scharismatic,propheticrolewasanalternativeto,andthereforeacritiqueofanda substitutefor,thecharacteristicmaleformofreligiousauthority:theauthorityofoffice. Towomen'scharismaticrole,foodwascentral.ThecharitablefooddistributionofaristocraticandbourgeoiswomensuchasIdaofLouvain,ElizabethofHungary, Lidwina,andJaneMarywasalifesavinggifttothestarvingpooroftownandcountryside.Andsuchgenerositycapturedthepopularimaginationbyitscourage.To emptyfamilycupboardsindefianceofhusbandsandfathers,torenouncefamilysupport,towork


orbeginordertofeedthepoorthesewereheroicandsometimesdangerousacts.Moreover,womenfedtheneedywithmiraculousfoodaswell.Sometimes,like UmiltandMargaretofFaenza,theymultipliedfoodbothforthosewithintheconventandforthoseoutsideitswallssometimesGodrewardedtheirsanctity,ashedid AgnesofMontepulciano's,byrainsoffoodfromheavensometimes,likeLutgard,Lidwina,orChristinatheAstonishing,theyweremiraculouslychangedintofood itself,feeding,healing,andsavingwiththeliquidsfromtheirbreastsorfingertips.Theteaching,healing,andcounselingsopowerfullyandfrequentlyperformedbyholy womenwereoftenaccompaniedbyfoodsymbolism.ColetteofCorbie,forexample,curedthesickbyplacingintheirmouthscrumbsoffoodthatshehadchewed withherownteeth.IdaofLouvainandLidwinaofSchiedamconvertedthedoubtingbyfoodmiracles. Moreover,thefemalefastingthatmovedfathersandhusbands,confessorsandbishops,alsomovedGod.WomenmadedemandsonGodbytheirabstinence. CatherineofSienademandedthathereturnhermothertolife,becauseCatherinehadalreadydonetherequisitesuffering.MaryofOigniesfastedtomakeademon leaveapossessednun.Lutgard,atthecommandoftheVirginMary,undertookthreesevenyearfastsagainsthereticsandtheenemiesofGod.Manyholywomen weregrantedbyChristthepowertoremoveaspecificnumberofsoulsfrompurgatorythroughfastingandpain.AliceofSchaerbeke,dyingintormentfromleprosy, wasassuredbyChristthathersuffering,includinghersufferingatthelossofcommunion,releasedsoulsfrompurgatory.51Andwomenundertooktheholyeating,for whichfastingprepared,asaformofserviceaswell.Whenthedoctrineofvicariouscommunioni.e.,thenotionthatonepersoncanreceivecommunionfor anotherwasdevelopedinthethirteenthcentury,somemonasteriesofwomenwereespeciallyattractedtoit.Althoughmaletheologiansexpressedthedoctrinein clericalform,arguingthatthepriestreceivesforthechurch,womenassertedthepossibilityofofferinguptheircommunionsforothers.AbeguineinStrasbourgin 1317arguedthatthecommunionofalaypersonwouldprofitasmuchfortheredemptionofadepartedsoulasthemassofapriest.52Inaparticularlyliteralminded versionofsuchanotion,wefindGertrudeofHelftathinkingthatsheshouldchewthecommunionwaferintoasmanycrumbsaspossiblesothatChristwouldsave exactlythatmanysoulsfrompurgatory.53


Thusholywomenfedothersnotmerelythroughcharityandmiraclebutalsothroughtheirownfastingandeating.Whenwelistentothewordsofmysticssuchas Hadewijch,CatherineofSiena,andCatherineofGenoa,weseethatbothfastingandcommunion(whetherthewaferistakenonthetongueortheelevatedhostis adoredwiththeeyes)arepartofaneverfilledcravingforGod.Thiscravingispainaswellasglory.Itispainsovastthatitfuseswithallpain.Itisthereforethepain ofpurgatory. Purgatorywastothesewomennotprimarilyaplaceinthecosmosoracountinghousewheredeedsaremeasuredandexchanged.Imageryofthemarketplace howevermuchitmaydominatecontemporarymalewritingisalmostabsentfromtheirpoetryandvisions.Purgatorywas,rather,thefactofsuffering.54Formystics suchasMechtildofMagdeburg,JulianofNorwich,andCatherineofGenoa,purgatorywaslesspunishmentthanlossoralienation.Purgatorywasbeingwithout(or, rather,veryfarawayfrom)God.Inthissenselife,too,waspurgatory.Fastinganddiseaseandeucharisticfrenzywereallpurgatory.Andifthepainwastheretobe endured,eddyingaroundonewheneverthegloryfadedasitalwaysdidfadethenonemightdecreaseitforothersbyenduringmoreoneself.Mysticalwomen substitutednotonlytheircommunionsforthehungerofothersbuttheirpainforthepunishmentofothersaswell.Hadewijchevenwrotethatshehadbeentoo audaciousinherclaimsforhersufferingandherlove,forshehadwishedtosnatchfromhellitselffourwhomGodhadcondemned.SotolerantwasGodofher ignorance,shesaid,thatheactuallyallowedherto"deliverfromdespair"and"spiritualdeath"thefourforwhomshehadenduredallmannerofagonyandalienation.55 ThesavingandservingrolethatmysticalwomencreatedforthemselvesinthelaterMiddleAgeswasthereforeneitherapingoftheclergynoropenrebellionagainst clericalprerogative.Itwassimplyanothermodelacharismaticmodel,alaymodel.Womensawthemselvesasauthorizedtoteach,counsel,serve,andhealby mysticalexperienceratherthanbyoffice.Despiteoccasionalvisionsinwhichtheythemselvesreceivedsacerdotaltrappings,femalemysticsusuallysawthemselvesas laityratherthanpriests,recipientsratherthanconsecrators.BothJulianaofCornillonandMechtildofMagdeburg,forexample,inspiredbyGodtoleadandtocriticize hischurch,suggestedthatheshouldsendclericsinsteadtheyboth,however,cametoaccepttheirpropheticandvisionary


roleasanalternative.56GertrudeofHelfta,tougherandmoreandrogynousinherselfimage,enviedprieststheirabilitytohandleGodbutsaidthatitmightbemore dangerousthanusefultotheirownspiritualstate.57AlreadyinthetwelfthcenturythetheologianHildegardofBingenexplainedthedifferentandfullycomplementary rolesofmenandwomen,underliningboththeirequalandmutualcontributionstothebiologicalprocessofconceptionandtheirpairedreligiousrolesasmysticonthe onehandandpriestontheother.58GherardescaofPisa(d.1269),inoneofhervisions,expressedthissenseofmanaspriest,womanasrecipient:"OnSundays, BlessedJohn[theEvangelist]celebratesthemysteriesofthemass,withallholyclericsofeveryreligiousorderbeingpresentfortheoffice,andtheBlessedMary receivestheeucharistoftheLordseventimesforallsinners....NoneexceptSaintJohndarestosingmassthere[inheaven],nordoesanyonedaretotake communion,excepttheBlessedVirgin."59CatherineofSienainthefourteenthcenturywastoldbyChristinavisionthatsheneednotdressasaman,forChristhad chosentospeakthroughher,theweakervessel.60 Eventhedistributionofeucharisticmiraclesmakesitclearthatbothmenandwomenincreasinglyviewedtheroleofrecipient,ofpiouslayperson,asafemalerole.As Ipointedoutabove,almostallmedievalmiraclesthatspecificallyconcernreceptionoftheeucharistoccurredtowomen,61andalmostthreefourthsofthelaysaints fromthelaterMiddleAgeswerewomen.62(ItissignificantthattheoccasionalmalewhoreceivestheeucharistdirectlyfromChristorangelsoradovei.e.,whose actofreceivingisgivenspecialemphasisisinvariablynotapriestbutalayman,andalaymanoflowstatus.Receivingi.e.,eating,ratherthanpreparing,holy foodandlaystatusthustendtogotogether,andneitherisassociatedwithpowerfulandadmiredmales.)63Thepatternofmiracles,likethepatternofcanonizations, underlinesthedichotomy:menarepriests,whoseactofconsecratingGodshimmerswithunearthlypowerwomenarerecipients,whoseactofeatingisdignifiedwith thereassurancethatthefoodtheytakeisreallyGod. Inwomen'sreligiosity,however,theroleofvessel,ofrecipient,waselevatedtonewsignificance.Whereasmaletheologianssawthepriestasdivinizedintheactof consecrationandevenattemptedtoidentifypriestwithchurch,womensawtheiractofreceiving,ofeating,aspregnantwithsalvation.Womensubstitutedtheir communionsforthenegligenceofthosewhodidnotorcouldnoteatwomenofferedtheirsuffering


inhungerordiseaseforthesufferingofthesinfulinpurgatory.Indeed,somewomen'svisionselevatedthestatusofrecipientabovethatofpriest:JulianaofCornillon advisedapriesttobearecipientAgnesBlannbekinsawtheeucharistdepartfromacorruptpriestandflyintoherownmouth.64 Thuswomen'sfoodpracticescontrolledtheirreligiouscircumstancesaswellastheirdomesticones.Notonlydidwomensuccessfullyavoidmarriageorshapeitmore totheirlikingbyrefusingcommensalityandgivingawayfamilyfoodtheyalsotestedclergybytheirfoodmiracles,tookondirectserviceoftheirfellowChristians throughfooddistribution,andbypassedecclesiasticallimitationsontheirintimacywithGodinastonishingencounterswithChristhimselfasnursingmother,chalice bearer,orbleedingmeat.Moreover,elevatingtheirfastingandhungerforGodintocosmicsignificance,womenofferedtheirsufferingforthesalvationofsinnershere onearthandbeyond,inthefarreachesofpurgatory,aswell.Foodwasnotmerelyadevicebywhichwomenmanipulatedthosefathers,husbands,confessors, priestswhohadgreaterauthoritythantheyrather,foodobservances,foodmiracles,andfoodmetaphorswereameansbywhichwomenshapedforthemselves complex,spirituallyeffective,anddistinctiveroleswithinthemedievalchurch. FoodPracticesAsRejectionofModeration Whenweseeclearlythearrayoffunctionsthatwomen'sfoodpracticesperformedinlatemedievalsociety,weunderstandhowmyopicitistoviewfemalefastingas primarilyanattackonbody.Thecounselingandhealingmedievalwomenpracticedthroughtheireucharisticvisionsandmiracles,thecriticismsofthechurchthey announcedininspiredutterances,thesalvationtheyofferedtotheirfellowsthroughdiseaseandsufferingarefarmoreemphasizedinwomen'sownwordsandfarmore prominentinstoriesaboutthemthananythemeofdualismbetweenbodyandspiritoranynotionofthefemaleasweakorevil. Itisnotenough,however,toargueagainsttheconventionalinterpretationofwomen'sreligiosityasinternalizeddualismormisogynybypointingoutthatother,social functionscanbefoundforwomen'sasceticism.Thereisadeeperproblemwiththeinterpretationthatstates


thatwomen'sfastingandfeasting,theirselfpunishment,miraculousbodilymanipulation,andeucharisticfrenzywereinternalizationsofmedievalstereotypesoftheflesh andthefemaleasnegative.Theproblemisthis.Intheperiodinwhichthischaracteristicfemalespiritualityemerges,theologywasdevelopinginpreciselytheopposite direction.Thetheologiansofthetwelfthandthirteenthcenturychurchwerebusymakinganhonoredplaceintheschemeofthingsforthelaity,forwomen,forthe femalebody,andformarriage.Itwaspreciselythesetheologianswho,asIindicatedinchapter2,arguedformoderationinasceticismandineucharisticdevotion, warningwomenagainstextensivefastsandprohibitingthefamiliarityoftoofrequentcommunion.ThustheextremismofreligiouswomeninthelaterMiddleAgescan hardlybeaninternalizingoftheviewsmaletheologiansheldeitheroffoodpracticesorofthefemale.Yettwelfthandthirteenthcenturytheologyandreligiouslife suppliedthecontextwithinwhichwomen'sextravagantasceticismandeucharisticdevotionwereforged.Itseemslikely,therefore,thatwomen'sreligiositywasa reactionagainstthemoderationurgedbychurchleaders,againstneweffortstomakeaplacebutasecondaryplaceforwomenandforthelaitywithinaChristian universe.Inordertoexplainthis,alittlemoremustbesaidaboutthedirectionoftwelfthandthirteenthcenturytheology. MuchattentionhasrecentlybeengiventothewaysinwhichpreachersofthetwelfthtotheearlyfourteenthcenturyexpandedthenotionofChristianroleswithin society.Althoughcanonlawyersincreasinglydefinedtheclergyassetapartbylifestyleandprerogativesandtoalargeextentequatedthechurchwiththeclergy, preacherswroterepeatedlybothaboutandforthevarietyofwhattheycalled"orders"(statuses)insocietyanddevotedmuchcaretoexplaininghoweachwas religious.65TheanonymoustwelfthcenturyauthoroftheLibellusdediversisordinibus,forexample,arguedthatGodintendsadiversityofwaysofservinghimto existtogether,"asaharmonyisachievedfromdifferentchords."66JamesofVitrywrotethatclerics,priests,marriedpeople,widows,virgins,soldiers,merchants, peasants,craftsmen,and"othermultiformtypesofmen,''eachgrouphavingitsownrulesandinstitutions"accordingtothediversetypesoftalents,"makeup collectivelythebodyofthechurchunder"theabbotChrist."67Justasfeudallawyersbusiedthemselvesinclassifyingthemanydegreesof"freedom"thatis,of


privilegeandobligationthatcharacterizedthewidevarietyofrolesandstatusesinmedievalsociety,somoralistsandtheologians,fromthetwelfthcenturyon,busied themselvesinsayingwhythesediversestatuseswereallvaluable(althoughnot,ofcourse,allequal)beforeGod.Corporatemetaphors,classicalandPaulineinorigin ("therearemanymembersbutonebody"),andparaphrasesofJohn14:2("therearemanymansionsbutonehouseofGod")becameincreasinglypopular.68 ThegrowingsensethataworldlyrolesuchascraftsmanormarriedwomanmighthavearuleoflifedefiningitandmightwinforitspractitionersmeritbeforeGodwas reflectedinwhatsomescholarshavecalledthe"riseoflayspirituality."69Fromthelatertwelfthcenturyon,thechurch,increasinglyorganizedhierarchicallyunderthe papacy,feltagreaterandgreaterresponsibilityforordinarylayfolk,devotedmoreattentiontodefiningforthemtheircharacteristicformsofdevotion,andcanonized moreandmorelay(evenmarried)saints.Theologiansdefinedmarriageasasacramentanddidnotinthisprocess,asGeorgesDubyhaspointedout,totallyspiritualize itifitsbasicsignificancelayinthecommitmentofthepartners,itwasacouplingofbodiesaswell.PreachersromanticizedtheHolyFamilyandthemarriageofMary andJoseph.70TheologiansevendebatedwhethertheVirginMarymenstruatedandonegroupamongthemdecidedthatshedid,givingnewandpositivesignificance toaphysiologicalprocessonceconsideredacurseandapunishment.71 Thesesametheologiansandcanonlawyers,whopermittedandevengave(somewhatgrudging)spiritualsignificancetosexualityandchildbearing,modifiedearlier notionsoffastinginparttomakeitpossibleforthelaitytomeettheminimumrequirements.Inthethirteenthtothefifteenthcentury,thenumberofcategoriesof exemptionfromfastingincreased,andthestandardfastcametobebrokenearlierintheday.Fastingwasoftentreatedbypreachersandexegetesassymbolrather thanact.Itwasseldomspokenofasanattackonthebody.Aquinas,forexample,sawfastingasameanstocurbthedemandsofthebodynotarejectionofmatter butalimitedrenunciationofoneofthegoodsofGod'screation."Tostarvethebody"wouldbe,saidAquinas,tostealfromwhatitshouldbeandoffertoGodonly "stolengoods."Tofastintoillhealthwoulddestroyone's"dignity"asaperson.72Anearlyexampleofthekindofpressureformoderationthatcharacterizesthe


medievalchurchcanbefoundinalateeleventhcenturyletterfromGeoffrey,abbotofVendme,toacertainbrotherRobert,whohadtakenonhimselfwhatGeoffrey consideredinappropriateabstinence:
Ifyoulovetofast,Ipraisethis,thatyoumayeatbyfastingandabstainbyeating.Forheeatsbyfastingandabstainsbyeatingwhoeatsthusdailywhatinnowaysatisfiesthe stomach.Fortoabstainonedayandonanothereatfullydoesnotseemlaudable.Onthedaysonwhichpeopleeatnothingtheymurmurmuchandthenondayswhentheyeat muchtheyfeelinappropriatejoy.Thereforeitisbetterthatwerecognizeneedanddailysustainourselvesandrefrainfromvice....Forgainingeternallife,abstinenceofthebody isnotenoughunlessthefastofthesoulismarriedtoabstinence.73

Thetoneoflatemedievalpreachersandtheologiansoftenhasthisnoteofrationality,sobriety,anddecency,thissortofconcernforsteady,moderateobservance, especiallywhenaddressingwomen.Eventhose,likeAbelardandSuso,whohadreasontoknowthatsomewomenwerecapableofgreatdevotionandasceticism, advisedthatextravagantausteritieswere"unsuitabletoyour[i.e.,thefemale]sexandunnecessaryforyourdisposition."74 GeorgesDubyhasrecentlysuggestedthatthosemenandwomenwhoturnedtoheresyinthetwelfthandthirteenthcenturieswereinpartreactingagainstachurch whichtriedtocontrolanddomesticatemarriageachurchwhichmadeaplaceintheschemeofthingsforwomenandsexuality,butasecondaryplace.75Whetheror notthisisacorrectanalysisoftheimpulsetorejecttheinstitutionalchurch,itappearstopresentacluetotheextravaganceofwomen'sspirituality.Whilepreachers werebusyformulatingsermonsadordinesthatcarefullydefinedaplaceforeverysortandconditionofperson,whilelawyerspressedforcanonizationofeverytype ofsaintinpartsothatamodelmightbeavailableforeverytypeofChristian,whilemoralistsurgedmoderationinasceticpracticesothatthechurchmightbebroad enoughforallpiouswomenelaboratedareligiositythatwasinnowaymoderate,asenseofselfthatwasinnowaysecondary.Instead,immoderateandfrantic, womenmysticssoaredbeyondallcarefulgradationsanddistinctionsintotheimmediatepresenceofGod. Theextenttowhichwomen'sspiritualitywasitselfarejectionofasuccessfulandmoderatechurch,withitscozydomesticationofwomen


andofthelaity,canbeseeninthealarmwithwhichpreachersviewedit.TheologianssuchasGersonandDavidofAugsburg,whosawtheextravaganceofwomen's religiosityandsometimesthemselvesdescribeditinextravagantlanguage,wereupsetbyitsexuberanceanditssensuality.76AlberttheGreat,althoughhewouldnot allowittobeattackedasheresy,denigrateditasridiculous.TaulerwarnedthatalthoughGodsometimescametopiouswomeninvisions,thiswasnot,andshouldnot be,thenormalwayofmeetinghim.77Intheearlyfourteenthcentury,somewomenmysticswhorejectedthemoderate,decentspiritualityofcarefullygradedworks andprayersas"inferior"(andrejectedaswelltheaffectivereligiousresponsesofsomeoftheirsistermystics)werecondemnedorburned.78 Moreover,womenthemselvessometimessuggested,intheirstridentrefusaltoacceptcounselsofmoderation,thatmoderationwasexactlywhattheyobjectedto. ColumbaofRieti,whoonceattemptedtopacifycriticismbyeating,refusedtotakeanythingbutthesacramentonceDominicappearedinavisionandauthorizedher behavior.CatherineofSiena,whoobedientlytriedtoeatwhencommandedbyherconfessorandwhodefendedherselftoamaledetractorbysayingthatherinedia wasmerelyaninfirmityandwithoutspiritualsignificance,revealedwhatwasprobablyhertrueunderstandingofasceticismwhenshesaid,ofAgnesofMontepulciano, thatsurvivalwithouteatingischaracteristicof"theperfect."Hadewijch,whosometimesinherlettersandvisionsapologizedforheraudacity,alsoluxuriatedinthe powerthatheragonyachieved.ShereportedthatChristsaidtoher:"Beautifulrevelationsandmiracleshavehappenedtoyouduringyourdays...morethantoany personwhowasbornsinceIdied."79Healso,shetellsus,addressedher:
Ostrongestofallwarriors!Youhaveconqueredeverythingandopenedtheclosedtotality[i.e.,theunionofhumanityanddivinityinChrist],whichwasneveropenedby creatureswhodidnotknow,withpainfullywonanddistressedLove,howIamGodandMan!Oheroine,sinceyouaresoheroic,andsinceyouneveryield,youarecalledthe greatestheroine!Itisright,therefore,thatyoushouldknowmeperfectly.80

Amoreimmoderatevisioncouldhardlybeimagined.81 Theimmoderatenessofwomen'sspiritualityisfoundintheirnotionsofselfabasementaswellasintheirmysticalheights,theirsenseofbeingspecialtoGod.So tortureddidsomewomenbecomenotonlywiththeir


ownawarenessofunworthinessbutalsowiththeircompassionforotherswhowerealienatedfromGodthattheyofferedtogotohellitself.GertrudetheGreat claimedthatoneshouldbewillingtotaketheeucharisttoone'sowncondemnationifsuchanactcontributedtoGod'sglory.82MechtildofMagdeburgcriedoutin anguishtoaskChristhowhecouldallowsoulstolanguishinhell,andsherepeatedlyprayedfortheirrelease.83Hadewijch,whohadconfidencethathersuffering liftedhertolikeness("GodpromisedmesomuchsufferingforthesakeoflikenesstohimselfthatI,inpreferencetoallmenandmorethanallmen,shouldsufferthisin ordertocontenthimandliveasaperfecthumanbeing"),84alsousedhersufferingtobeatagainstGod'sjusticeanddemandthereleaseofcondemnedsouls.

InonethingIdidwronginthepast,tothelivingandthedead,whomIwithdesirewouldhavefreedfrompurgatoryandfromhellasmyright.Butforthisbeyou[God]blessed: Withoutangeragainstme,yougavemefouramongthelivingandthedeadwhothenbelongedtohell.Yourgoodnesswastolerantofmyignorance....ForIdidnotthenknow yourperfectjustice....ThroughloveIwishedtosnatchthelivingandthedeadfromalldebasementofdespairandofwrongdoing,andIcausedtheirpaintobelessened,and thosedeadinhelltobesentintopurgatory,andthoselivinginhelltobebroughttotheheavenlymodeoflife.85

ThestorythatTaulertoldasanexampleofhumilitytothenunsheadvised,ringstrueasevidenceofboththeradicalselfabnegationandthesoaringtriumphof contemporaryfemalespirituality:
Youwillnevergainwhatyouwantuntilyouwantnothingcreated,butonlytheCreator....Children,thereisnothingfurtherIwanttosaytoyou,excepttotellyoualittlestory whichillustrateswellwhatImean.IknowaCanaanitewoman[cf.Matt.15:2128]letuscallherthatbecausetheincidentIamgoingtotellyouabouthappenedlessthanfour yearsago,andsheisstillalive.Sheonceexperiencedrapture,andwastransportedsothatshecouldseeGodandourLadyandallthesaints.Atthesametimeshesawherself placedunutterablyfarawayfromGod.Thenthissoul,insuchunspeakabletorment,turnedtoourLadyandtoallthesaintsandbeggedthemalltohelpher.Butthenshesawthat theydidnotpaytheslightestattentiontoherentreatytheywereinsuchgreatjoyandblissthattheyneitherheardnorheededherprayers.Then,aswemortalsdo,sheinvoked thePassionanddeathandwoundsofourLordJesusChrist,butforanswershewasaskedhowshecouldinvokewhatshehadneverhonored.WhenshesawthatourLadyand thesaintsand

Page243 theblessedPassionofourLordwereofnohelptoher,sheturnedtotheLordHimself,andthishumansoulsaid:"OhLord,sincenoonewillhelpme,see,mylovingGod,thatIam YourpoorcreatureandYouaremyGod,andthenjudgemeaccordingtoYouradorablewill.IfitisYourwillthatIshouldbeforeverinthedeepesttormentsofhell,Isubmittoit all,dearLord,asYourblessedwill."Andsosheutterlyabandonedherselfforalleternitybutshehadhardlymadethisactofselfabandonmentwhenshewasatoncetakenup, faraboveallintermediaries,andwasdrawnutterlyintoGod'sabyss,trulysubmergedinHismarvelousdivinity.86

Suchexuberanceandextremismsometimescarriedwomenintopositionsthattheologianssawasheterodoxas"dualist"or"quietist"or"antinomian."And,despite theconvincingeffortsofbothmedievalandmoderntheologianstospellouttheopposingphilosophiesandtheologiesbehind"heterodox"and''orthodox"positions,the twopositionsfusetogethersocloselyinactualmysticalwritingthatthesamephrasecanoftenbeinterpretedbothways.InHadewijch,forexample,bothreligious affectivityandadeepcritiqueofaffectivitycryoutinthesamepoeticlinesothatquietismandevenantinomianismcanbesuspectedinhernotionthatGod,the infinitelylovableanddesirable,isbeyondallpossibleeffortordesire.InCatherineofSiena'sdescriptionofAgnesas"perfect"becauseofhervegetarianismandattack onthebody,wefindaterminologythatmightoccurinCatharliteratureaswell.Itseemsthatweashistoriansshouldavoidadoptingthemedievalcategoriesof "heterodox"and"orthodox"asourcategoriesofanalysisnotonlybecause,asscholarssuchasGrundmannhaveargued,87thesameparticularthemesfrequentlyoccur inbothtypesofreligiosity,butalsobecause,behindwomen'softenquitedivergentreligiouspracticesandideas,layacommonextremismofreactionthatsuggests dissatisfactionwithclericaladvisersandtheircounselsofsweetreasonableness. Inconclusion,then,wecansaythatwomen'sfoodpracticesfunctionedasawayofcriticizingandcontrollingthoseinauthority.Theyalsoprovidedadistinctiveway forwomentoservetheirfellowsandmeettheirGod.Buttheydidmore.Bytheirveryextravagance,audacity,andmajesty,theyrejectedthesuccessofthelate medievalchurch,rejectedforawider,moresoaringvisionaninstitutionthatmadeatidy,moderate,decent,secondrateplaceforwomenandforthelaity.88Like thedesertasceticsofthefourthcenturywhomtheysometimestookasmodels,womenmysticsfromthetwelfthtothefourteenthcentury


wereincertainwaysreactingagainstthe"triumph"ofthechurch.And,likethoseearlymonksandascetics,womenoftenexpressedtheirdissatisfactionwithwhatthey sawastheirreligion'sworldlinessandcompromisenotbyleavingtheinstitutionbutbyfulfillingitspreceptswithavehemencethatfrightenedandtitillateditsleaders. Foodpracticesfunctionedinalltheseways.Butfunctionisnotmeaning.Itistimetolookatwhatthewildsoaringvisionactuallymeant.


8 TheMeaningofFood: FoodAsPhysicality
Theimmaculatelamb[Christ]isfood,table,andservant.Andthistableoffersthefruitsoftrueandperfectvirtues....Andthetableispiercedwithveins,whichrunwith blood....Ohmyson,runtothistable[anddrink]....Andwhen[thesoul]hasdrunk,itspitsupthebloodontheheadsofitsbrothers[becauseitistoofullwithhotandinebriating wine]andisthuslikeChristwhocontinuallypoursouthisbloodnotforhisutilitybutforours.Andwewhoeatatthattablebecomelikethefood[i.e.,Christ],actingnotforour ownutilitybutforthehonorofGodandthesalvationofneighbor. CATHERINEOFSIENA(D.1380), WRITINGTOONEOFHERCONFESSORS1

AsthewritingsofCatherineofSienamakeclear,toeatChrististobecomeChrist.TheChristonebecomes,inthereceptionofcommunionandintheimitatioof asceticism,isthebleedingandsufferingChristofthecross.ThefleshofJesusbothfleshasbodyandfleshasfoodisattheverycenteroffemalepiety.Andthis fleshissimultaneouslypleasureandpain. Wecannotunderstandmedievalreligiosityuntilwerealizehowdifferentsuchprobingandembracingofbodyaspainpleasureisfrommostmodernnotionsofbody,in whichpleasureandpainareseenasoppositesandthecultivationofpainisrejectedaspathological.Inunderstandingthisdifferenceitishelpfultorememberhowlittle medievalpeoplecoulddotomitigatediscomfortofanykind.Thusmedievalmetaphorsandsymbolsexpresstheexperiencingofbodymorethanthecontrollingof it.2 Sensationsandsensesthatwedifferentiatefromoneanothertendtobefusedinmedievalpiety,wheresatiationisdescribedas"hungry"anddiscomfortiscalled "delicious."Todenybodilyresponsestowardtheworldisoften,toamedievalwriter,toreleasetorrents


ofbodilyenergytowardGod.Anapproachtothebodysoalientoourmodernoneneedsfurtherexplanationforthetwentiethcenturyreader. FoodandFleshAsPleasureandPain AsIexplainedinchapter6,thefastingandeucharisticfrenzy,charityandselfdenial,ofpiouswomenfrequentlybroughtexcruciatingpain.Yetwomendidnot ordinarilyspeakofthesepracticesaspunishmentorasescapefromthebody.AngelaofFolignofoundthetasteofpus"assweetascommunion"BeatriceofNazareth spokeofJesus'tormentas"healthywounds"theauthorofthenuns'bookofUnterlindendescribedthesoundofselfflagellationasmelody,risingsweettotheearsof theLordofHosts.Women'sownviewofphysicalitywasnot,mostbasically,dualistic.Whenwomenspokeofabstinence,ofeucharisticecstasy,ofcuringandhealing throughfood,theycalleditimitatioChristi."Imitation"meantunionfusionwiththatultimatebodywhichisthebodyofChrist.Thegoalofreligiouswomenwas thustorealizetheopportunityofphysicality.Theystrovenottoeradicatebodybuttomergetheirownhumiliatingandpainfulfleshwiththatfleshwhoseagony, espousedbychoice,wassalvation.LuxuriatinginChrist'sphysicality,theyfoundtheretheliftinguptheredemptionoftheirown. ThehumanityofChrist,understoodasincludinghisfullparticipationinbodiliness,wasacentralandcharacteristicthemeinthereligiosityoflatemedievalwomen.3 Oftenithaderoticorsensualovertones.Forexample,MargeryKempewassointenselyattractedtoChrist'smalenessthatsheweptwhenevershesawamalebaby inhervisionsshecuddledwithChristinbedandwasboldenoughtocaresshistoes.4 AngelaofFoligno,AdelheidLangmann,andCatherineofSiena,amongothers, marriedChristineucharisticvisions.UnderliningtheextenttowhichthemarriagewasafusionwithChrist'sphysicality,Adelheidreceivedthehostasapledgerather thanaweddingring,whileCatherinereceived,nottheringofgoldandjewelsthatherbiographerreportsinhisbowdlerizedversion,buttheringofChrist'sforeskin. ManylatemedievalwomenhadvisionsofbathingornursingtheChristchild.Tosome(forexample,IdaofLouvain,AgnesofMontepulciano,andMargaretof Faenza),thepleasurewassointensethattheyrefusedtosurrenderthebabyagaintohismotherMary.5 ThebeautifulyoungChristwho


appearedtoLutgard,MargaretofYpres,andMargaretofOingt,baringhisbreast,wasbothnursingmotherandsensualmalelover.6 Hadewijchdescribedencounter withthisChrist,mouthonmouth,bodyonbody,inlanguagethatseemstoreporttheexperienceoforgasm(seeabove,p.156).Thetwelfthcenturyauthorofthe storyofChristinaofMarkyatereportsasimilarlysensualencounter:

Dayandnightshekneltinprayer,weeping,andlamenting,andbeggingtobefreedfrom[sexual]temptation....ThentheSonoftheVirginlookedkindlydownuponthelow estateofHishandmaidandgrantedhertheconsolationofanunheardofgrace.ForintheguiseofasmallchildHecametothearmsofhissorelytriedspouseandremainedwith herawholeday,notonlybeingfeltbutalsoseen.SothemaidentookHiminherhands,gavethanksandpressedHimtoherbosom.AndwithimmeasurabledelightsheheldHim atonemomenttohervirginalbreast,atanothershefeltHispresencewithinhereventhroughthebarrierofherflesh.Whoshalldescribetheaboundingsweetness...?Fromthat momentthefireoflustwassocompletelyextinguishedthatneverafterwardscoulditberevived.7

"Daughter,thoudesirestgreatlytoseeMe,andthoumayestboldly,whenthouartinthybed,takeMetotheeasthyweddedhusband,asthydearworthydarling,andasthy sweetson,forIwillbelovedasasonshouldbelovedbythemother,andIwillthatthoulovestMe,daughter,asagoodwifeoughttoloveherhusband.Thereforethoumayest boldlytakeMeinthearmsofthysoulandkissMymouth,Myhead,andMyfeet,assweetlyasthouwill.AndasoftenasthouthinkestofMe,orwouldstdoanygooddeedto Me,thoushalthavethesamerewardinHeaven,asifthoudidstittoMineownPreciousBodywhichisinHeaven."8

Italianwomentooreporteroticvisions.AngelaofFolignoburnedsoinpenitencethatshestrippedbeforethecrucifixandofferedherselfnakedtoChrist,pledging perpetualchastity.9 ShedescribedherunionwithChristthus:

Once,duringLent,feelingherselfverydry,sheaskedGodtogivehersomethingofhimself....Andhereyeswereopened.Shesawlove,whichcamesweetlytowardher.Shesaw itsbeginningbutnotitsend[caputetnonfinem],butitwascontinuous.Andshedidnotknowhowto

Page248 compareittoanycolor.Butallatoncewhenitcametoher,itseemedtoherthatshesawitclearlywiththeeyesofthesoul,moreclearlythanshewasabletoseewithbodilyeyes, andintouchingofheritseemedtotaketheformofasickle[uniusfalcissimilitudo].Notthattherewasanymeasurablelikeness.Lovetooktheappearanceofasickle,because thenatoncelovewithdrewitself,notconferringitselfasmuchassheexpected....Thusitmadeherlanguishallthemore....andsheunderstooditastheoperationofgrace. Andthenatonceshewasfilledwithloveandinestimablesatiety,which,althoughitsatiated,generatedatthesametimeinestimablehunger[fameminextimabilem],sothatallher memberswereunstrungandhersoullanguishedanddesiredtoflyaway[omniamembratuncdisjungebanturetanimalanguebatetdesiderabatpervenire].Andshewished neithertoseenortofeelanycreature.Andshedidnotspeakanddidnotknowwhethershecouldspeak,butwithinshespoke,clamoringthatGodnotletherlanguishinsucha death,forshethoughtlifetobedeath.10

Inrenewinglove,youhavethrustthatknife[oflove]inmeanew.Youhaveboundmetoyousofirmlythatitisimpossibleformetobepulledawayorcarriedawayfromyourlove. OmostbelovedJohn,youhaveboundmewithchainsofgold,andyouhavemarriedmewitharing.11

Scholarshave,ofcourse,suggestedthatsuchreactionsweresublimatedsexualdesire,butitseemsinappropriatetospeakof"sublimation."12Intheeucharistandin ecstasy,amaleChristwashandledandlovedsexualfeelingswere,ascertaincontemporarycommentators(forexample,DavidofAugsburg)realized,notsomuch translatedintoanothermediumassimplysetfree.13 Inwomen'swritingandvisions,suchimagesofmarriageandsexualconsummationoftendescribeexactlythetormentandsufferingthatwomensawasimitatio Christi.Inoneofthemosttouchingofallthirteenthcenturyvitae,ananonymousbiographerdescribesAliceofSchaerbeke:

Andalittleafterthis,...asshesurpassedinvirtueswhatcouldbeexpectedfromthenumberofheryears,Godwishedtopurgeherwithin...fromallstrifeandiniquityofthis world,notbecauseofanycrimeordefectinherbutbecauseshewashisspouse....AndsothatshewouldbefreetorestwithGodaloneanddallyinthecubicleofhermindasin

Page249 abridalchamberandbeinebriatedwiththesweetnessofhisodor...,hegaveheranincurabledisease,leprosy.Andthefirstnightwhenshewassequesteredfromtheconvent becauseofthefearofcontagion,shewasafflictedwithsuchsadnessherheartwaswounded....[SoshecriedandprayedatGod'sfeet]...andthetenderLordseeingthehumility ofhishandmaidenwiththeeyeofhismercywantedtorestoreher....Andhefilledherwiththesweetodorofdivinity...andsosheremained,visitedonlybyGod....Andwhen shehadlearnedfromwhatsheexperiencedtotakerefugeinthemostsecureharborofGod,sherantoChrist'sbreastsandwounds,ineverytribulationoranguish,every depressionordryness,likealittlechilddrinkingfromitsmother'sbreasts,andbythatliquidshefelthermembersrestored.14

JulianaofCornillon'sbiographersays(quotingtheSongofSongs)thatsinceshecouldnotliterallydiewithChristasshewished,shesufferedinspiritwithhimonthe crossandheldthispainbetweenherbreasts"likeabundleofmyrrh."15MargaretofOingtwritesthat,meditatingonthecrucifix,shetookoutthenailsandcarried Christ'sbodybetweenthearmsofherheart,andkissedandswoonedoverthewounds.16Indeed,Margaretreceivedavisionthatgraphicallyexpressedawareness thatherpietyimpliedsensualencounterwithChrist:thebranchesofadryanddeadtree(presumablyMargaretherself)floweredwhentheywerefloodedbyagreat riverofwater,andonthebrancheswerewrittenthewordssight,hearing,taste,smell,andtouch.17ShealsoreportsavisionofJesusasadoorwaythroughwhich thesoulmustpassandsaysthe"person"whoreceivedthevisionthenvowedtosayfiftyPaterNostersinmemoryofChrist'swounds.Butwhenthe"person"prayed, sheofferedfivePaterNostersnotonlyforeachofthefivewoundsbutforotherpartsofhisbodyaswellhead,eyes,ears,nose,andmouthbathingandanointing "inspirit''hispreciousbody.18ThefranksensualityofMargaret'sdevotiontoJesus'sufferingfleshhasnotescapedmoderncommentators,whohavevehemently disapproved.19 SuchresponsetothebodyofJesuscontainedelementsofterroraswellasofjoy.Somewomenweredriventowhattheircontemporariescalledinsanityandothers mutilatedthemselveswhileinecstasy.Buthoweverextravagantsomeofthesereactionsmayhavebeen,noneisaccuratelydescribedasflightfrommatteroras "decadent"or"literalminded"symbolism.20Inareligiositywherewoundsarethesourceofamother'smilk,fataldiseaseisabridalchamber,painorinsanityclings


tothebreastlikeperfume,physicalityishardlyrejectedortranscended.Rather,itisexploredandembraced.Eventheabhorrenceoftouchorwarmthorfood,which womensuchasMaryofOignies,Lutgard,Douceline,CatherineofSiena,andCatherineofGenoadevelopedaftermeetingthefire,thekisses,andthefleshofChrist, werenotrejectionofthebody.Theywere,rather,anumbingoftheordinarysensesleftbythetransfixingencounterwithGod.Insuchreligiosity,bodilyimpulsesand emotionstheperson'sfullsensualitywerereleasedintonewexperience.Physicalitywasfreedandtransfigured.ButithadtobearousedbyGod.21 Women'sfoodimagesoftenevokedsuchtransfiguringofbodyandsuggestedanalmostphysicalunionwiththedivine.Inboththemetaphorsofpoetryandthe experiencesoftranceandvision(andthesefrequentlyflowedtogether),womenmetGodasfleshtakeninto,eatenby,flesh.ThusHadewijch,Mechtildof Magdeburg,andIdaofLouvainspokeofencounterwithGodas"eating"him,andAnnaVorchtlinsaidtotheinfantJesusinthesortofaffectionateteasingmothers haveusedwithbabiesforcenturies"Iwouldeatyouup,Iloveyousomuch."CatherineofSienarepeatedlyspokeofservingandsavingothersaseating.She describedthesoulascendingtoGodasababyreachingforthematernalbreast.Andsheemphasizedthebreastassymbolnotonlyofcharitybutalsoofthefleshthat isourhumanness.22 Foodwasamultifacetedsymbolinmedievalspirituality.Yet,asthesophisticatedrhythmsofHadewijchandthetheologyofCatherineofSienasuggest,foodmost basicallymeantfleshfleshmeantsuffering(sometimesecstatic,delicioussuffering)andsufferingmeantredemption.Fasting,feeding,andfeastingwerethusnotso muchoppositesassynonyms.Fastingwasflightnotfrombutintophysicality.Communionwasconsuming,i.e.,becoming,aGodwhosavesthroughphysical,human agony.Tofeedotherswastoofferone'sownsufferingasfood.Whetherecstaticallyanddefiantlyconfidentinthegloryofdivinity,towhichphysicalitywas inextricablylinked,ortorturedintheparadoxicaldarknessofhumanity,whichistruerthanglorybecausegloryisbeyondmedievalwomenwenttoGodthrough suffering.Theyfrequentlycalledthisjourney"eating"or"hungering,"becausetoeatistojoinwithfoodandGodisfood,whichisflesh,whichissuffering,whichis salvation. Latemedievaltheologyitself,ofcourse,providedthebasicequation:


foodequalsbody.Ittaughtthat,atthecentralmomentofChristianritual,themomentofconsecration,Godbecamefoodthatisbody.Thismomentthenrecapitulates boththeIncarnationandtheCrucifixion.Inbecomingflesh,Godtakesonhumanity,andthathumanitysaves,notbybeingbutbybeingbroken.Thefoodonthealtar wasthusforallChristiansasymbolbothofassimilationandofrending.Toeatwastoconsume,totakein,tobecomeGod.AndtoeatwasalsotorendandtearGod. Eatingwasahorriblyaudaciousact.Yetitwasonlybybleeding,bybeingtornandrent,bydying,thatGod'sbodyredeemedhumanity.Tobecomethatbodyby eatingwasthereforetobleedandtosavetoliftone'sownphysicalityintosufferingandintoglory. Theparticularimplicationsthatlatemedievaltheologygavetotheeucharistwerethemselves,however,historicallyconditioned.Aswesawinchapter2,thesacrament itselftookonmanymeaningsoverthelongcourseoftheMiddleAges.ItcouldunderlinethepowerofthesacrificingpriestandofthepropitiatedGod.Itcould symbolizethechurch,eitherasbelieversgatheredintoonebodythroughcommensalityorasaunitydefendedagainstthosewhowouldrenditassunderbyheresyor apostasy.ItcouldreflectamomentinthecosmicwarofgoodandevilthemomentatwhichGodtrickedthedevilbyofferinghimselfasbait.Itcouldstandforthe transformationofsufferingintosalvation.TheeucharistcouldthusrecapitulateeithertheIncarnation(Godbecomeshumanity),theCrucifixion(Goddiesforhumanity), ortheResurrection(humanityisglorified).Inordertounderstandwhythefoodpracticesandimagesoflatemedievalwomenweresuchaconsistentprobingofand exultinginhumanity(understoodasfullphysicality),wemustlookfurtheratthewayslatemedievalpeopleofbothsexesshowedincreasingconcernwithmatterand corporalityasreligiousissues.Forintheperiodbetween1200and1500,physicalitycametotheforefrontasareligiousconcern. TheLateMedievalConcernwithPhysicality NotionsoftheeucharistshiftedinfundamentalwaysfromthedaysoftheearlychurchtothelaterMiddleAges.Althoughtheologiansandvisionariesneverforgotthat thebreadonthealtarwasthememorialofacommunal,passovermealandofOldTestamentsacrifice,theyincreas


inglyemphasizedtheeucharistassufferingandbleedingflesh.Asthethirteenthandfourteenthcenturiesworeon,theologianscametoplacethesavingmomentof ChristianhistoryintheCrucifixionratherthanintheIncarnationorResurrectionvisionariessawChristintheelevatedhostorchalicenotasregallord,lavishlyrobed priest,orwarrioragainstSatan,butascrucifiedmanpoetsandsaintsusedhungerandabstinencelessasmetaphorsforselfcontrolorfordependenceonthebounty ofGodthanasimagesforneversatiated,sensual,andagonizedyearning.Behindtheseshiftsinmetaphorandintheologyliesaheightenedconcernwithmatter,with corporality,withsensuality.Although,aswehaveseen,someambivalenceaboutmatter,somesharpandagonizingdualism,remainsinlatemedievalreligiosity,no otherperiodinthehistoryofChristianityhasplacedsopositive(andthereforesocomplexandambiguous)avalueonthebodilinessofChrist'shumanity. ThelatemedievalconcernwithmatterandphysicalitywasinpartanexplicitmoveinChristendom'swaronheresy.Amorepositivesignificancewasgiventobodyin theologybecausevariousextremeChristianandquasiChristianpositionsseemedtodenouncefleshandmatter.Inthethirteenthcentury,theologiansthemselvessaw thefullphilosophicalandtheologicaldualismoftheCatharsasthemajorthreattoChristianorthodoxy.Startingfromthepremiseofacosmicdichotomybetweenspirit andmatter,theCatharsrejectedthedoctrineoftheIncarnation,arguedthattheholyor"perfect"mustfleethefleshinthislife,andchallengedthenotionsof resurrectionofthebodyandofpurgatory.Inthefourteenthcentury,variousformsofintensemysticismweredefinedasheresybecausetheyseemedtoignoreorreject thefleshinotherways.Incertainquietistforms,mysticismsometimesseemedtodenyallspiritualandmoralstrivingbytranscendingallsufferingandalienationall humanness.Initsmoreantinomianforms,mysticismsometimesthreatenedtopermitthebodyalllicensebecauseittookbodyasfundamentally"unreal."Thus,the variouslatemedievalheterodoxies,diversethoughtheywere,seemedtocontemporariestohaveincommonadenigrationofthebody,adenialthatitmightbeeithera sourceorarecipientofsalvation.Manytwelfth,thirteenth,andfourteenthcenturytheologiansandpreachers(includingthefirstgreatwomantheologian,Hildegardof Bingen)arguedexplicitlythatdenialoftheeucharist(i.e.,ofthenotionthatGodbecomesfleshandfood)wasoneofthechiefdangersofallkindsofheresy.23


Modernhistorianshavesuggestedthattheformulationofthedoctrineoftransubstantiation,thespreadofdevotiontothehostascorpusChristi,andthechurch's enthusiasticencouragingofmiraclesinwhichthehostturnedintofleshwerepartofageneralefforttocounterheresy.24Medievalauthorssometimessaidasmuch. JamesofVitryandThomasofCantimpr,writingaboutthefemalemysticalmovementoftheLowCountries,heldupwomensaints,withtheirreverenceforChrist's bodyandblood,asanalternativetotheCatharviewthatthephysicalisthecreationofanevilGod.25ThecardinallegatewhohelpedJulianaofCornillonpropagate thefeastofCorpusChristisupporteditexplicitlyasaweaponagainstdualism.26PreacherssuchasPeterDamian,EckbertofSchnau,andAlanofLillechosestories ofbleedinghoststoembellishtheirdiatribesagainstheretics.27And,asIexplainedinchapter2,eucharisticmiraclesthemselvessometimesdenouncedsuperstition, apostasy,orunbelief.ItisalsoquitepossibletoreadtheeucharisticdevotionofthehighMiddleAgesasamovetocounterheresybyincreasingclericalcontrol.Some confessors(forexample,MargaretofCortona'sandDorothyofMontau's)seemtohaveurgedwomentowardfrequentcommunionnotonlyasanefforttokeeptheir devotionallifeorthodoxbutalsoasawayoftyingthemmorefirmlyintotheecclesiasticalsupervisionwhichconfessionrepresented.28 Wemust,however,lookbeyondanyconsciouseffortsatpropagandaagainstCathardualismoraberrantmysticismifwearetounderstandtheattentionpaidtomatter andfleshinlatemedievalspirituality.Aconcerntogivethepropersignificancetofleshwasnotsomuchaconcernthatcharacterizedorthodoxasopposedto heterodox,asitwasaconcernthatboundallreligiousreactionsoftheperiodtogether(howevermuchtheymightdifferoverwhatthepropersignificancewas).Itis sometimesimpossibleforus,asitwasforcontemporaries,todrawalinebetweenCatharandorthodoxasceticisms(bothstressedfastingandcontinence,for example)orbetweenquietistandorthodoxmysticism(both,forexample,valueddesireforGodmorethan"works").Thisfactindicatesthatallthereligiosityofthe periodwasanimatedindeepwaysbytheneedtotakeaccountof(ratherthanmerelytodeny)matter,body,andsensualresponse. Indeed,whereverweturninthelaterMiddleAgesweseemtofindthethemeofbodyandofbodyinallitsaspects,pleasureaswellaspain.Forexample,the effortsoftheologiansandcanonlawyerstodefine


marriageasasacrament,toseeinfamilyasourceofgrace,toacceptandevensentimentalizefemalebodilyfunctionssuchaslactation,atleastintreatingJesus' mother,allindicateanewacceptanceofbody.Thepietyofthemendicants,especiallytheFranciscans,waspermeatedbyattentiontothefactofbody,bothinintense union(throughasceticism)withChrist'ssufferingandinaviewofallcreationasthetracesandfootprintsofGod.FrancisofAssisi,asiswellknown,rejoicedbothin punishingwhathecalled"theass"(hisbody)inimitatioChristiandinfindingGod'sgloryinbirds,flowers,sun,andmooninallthecreaturesoftheuniverse.Oneof themostimportantphilosophicalformulationsofthethirteenthcentury,ThomasAquinas'sstatementofthehylomorphiccompositionofthehumanperson,wasanew attempttocometotermswithmatter.Thedoctrinesaysthatwhatthepersonis,theexistingsubstanceman,isformandmatter,soulandbody.ToAquinas,the personishisbody,notjustasoulusingabodytheresurrectionofthebodythusbecame,forthefirsttime,notmerelytheologicallybutalsophilosophicallynecessary.


WomenwerenotusuallydirectlyintouchwithsuchabstracttheologicalorphilosophicalspeculationasThomas'sideaofhylomorphism,buttheynonethelessreflected intheirvisionsageneralsenseofbodyasnecessaryforsalvation.Thesameauthorswholiftedbodilyagonytowardthedivinethroughmetaphorsoflove,marriage, sweettasting,anddelightalsospokeofthegloriesofmatterandcreation.Theauthorofthenuns'bookofUnterlinden,whodescribedflagellationasmusic, commentedthathomo(ourhumanity)reallyincludesallcreatures.30MargaretofOingt,whoglorifiedtheselfinducedstigmataofBeatriceofOrnacieuxandoffered tobecomealeperifGodsowilled,sawChrist'shumanityasaclearmirrorinwhichisreflectedallthebeautyofcreation.31MechtildofHackeborn,whorolledin brokenglass,sawavisionofthecelebratingpriestinwhichhisvestmentswerecoveredwitheverybladeandtwig,everyhairandscale,ofthefloraandfaunaofthe universe.Asshelookedinsurprise,shesawthat"thesmallestdetailsofcreationarereflectedintheholyTrinitybymeansofthehumanityofChrist,becauseitisfrom thesameearththatproducedthemthatChristdrewhishumanity."32Suchvisionsmakeitquiteclearthat"humanity"includednotmerelysensesandagoniesbutbones andflesh,evensticksandstones,aswell.Forbetterorworse,forpainorpleasure,bodywasbecomingmoreandmoreofanissueintheologyandinpiety.


Behindsuchlatemedievalideas,wehearechoingfundamentalshiftsindevotionthatcameinthelongspanofyearsbetweenantiquityandthetwelfthcentury.More thananyotherfactor,itwasthecultofsaintsthatintroducedintoChristiantheologyandpracticeasenseofthepowerofbody.33BeginninginaRomanworldthat fearedthedeadaspollutingandlegislatedagainsttheirremovalordismemberment,aChristianenthusiasmforbodies,especiallymutilateddeadbodies,aslociof divinepowermadesteadyheadwaythroughouttheearlyMiddleAges.Indeed,those(suchasGuibertofNogentinthetwelfthcentury)whoopposedthecult understoodpreciselywhatwasatstake:thecultofrelicsnotonlyabolishedadistinctionbetweenspiritandmatteringivingterrifyingpowertoboneandsinew,it forcedanewlookatwhatitmeantforeveryhumantobeabody.34 Thissenseofbodyaslocusofthedivinehadbecomesopowerfulbythethirteenthcenturythattheconsecratedhostwasfrequentlycomparedtothebodiesofthe saintsandreveredasarelicofChrist.Notonlydidthepracticeofreservingthehostinpyxesortabernaclesspreadrapidlyafter1200,thehostwassometimes actuallyreservedinareliquaryordisplayed,inapyx,alongsidereliquaries.Mobiletabernacleswereoftenmodeledonreliquaries.Thepracticeofburningcandlesor lampsbeforethehostwasclearlyborrowedfromthemannerinwhichrelicsweretreated,andthepracticeofvisitingthehostasifitwerearelicspreadrapidly, probablyhavingbegunwithfemalerecluses.35AparticularlyvividexampleofthisparallelismofeucharistandrelicsisprovidedinthebehaviorofHugh,Bishopof Lincoln,whochewedoffapieceofMaryMagdalen'sarmwhilevisitingFcampanddefendedhimselftothehorrifiedonlookersbyreplyingthatifhecouldtouchthe bodyofChristinthemass,hecouldcertainlyapplyhisteethtotheMagdalen'sbones.36 ThisemphasisonthefactthatChrist'shumanityistrulyfleshandbloodledtoanincreasinglyliteralsenseofwhat"imitation"ofChristmeant.Bythelatetwelfth century,imitatioasaspiritualthemehadmovedfarbeyondtheCisterciannotionofaffectivemeditationontheeventsofthelifeofJesus.37Thegreatestspiritual writerofthetwelfthcentury,BernardofClairvaux,hadtaughtthatweidentifywithChristbyextendingourcompassiontohishumanitythroughpityingthesuffering humanityofourneighbors.38Butby1200FrancisofAssisiandMaryofOigniesactuallyreceivedintheirbodiesthewoundsofChrist


whileaseraphlookedon.About1275,PhilipofClairvauxdescribedarecluse,ElizabethofSpalbeek,whoactedoutthepersecutionofChristeverytwentyfour hours,draggingherselfabout,beatingherself,andbleedingfromstigmaticwoundsandfromunderherfingernails.39Inthefourteenthcenturyholywomensuchas DorothyofMontau,RitaofCascia,andJulianofNorwichandholymensuchasHenrySusoandRobertofSalentino(d.1341)actedoutthePassioninelaborate pantomimesorprayedforliteraldeathinimitationoftheCrucifixion.40 Somedescriptionsofholywomenstressedexplicitlythatimitatioisfact,notmemoryorimagination.Wearetold,forexample,thatMargaretofCortonaand LukardisofOberweimarbecameonewiththeCrucifixionratherthansimplyrememberingorpityingChrist'ssuffering.41MargaretofYpres'sextremeselfflagellation asameansofjoiningwithChristwascalledarecordatio(remembrance),butinsuchapassagethemeaningofthewordrememberhaschanged.42Beatriceof Nazareth,moretheologicallysophisticatedthanmanyofherfellowwomenmystics,spokeofthreegradesofmovingtowardChrist:turningtowardgracegrowingin thememoryofChrist'sPassionand,finally,inheringinJesus.43 By1350,preacherswereincreasinglyemphasizingimitatioasliterally"shapingoneselfto."44WhenLudolfofSaxony,inhisLifeofChrist,explainedhowChristians shouldconformthemselvestoChrist(actusconformationis),hesaidtheyshouldnot,forexample,merelymeditateonhowChristwasslappedbutshouldinstead slapthemselves.(Theslapshould,however,be"moderate.")45SusoexplainedhowliteralcopyingofChrist'sagoniessavedbothneighborandself:
AndI...desirefromthisdayforthtostandbeforeyourthroneasthetrustyrepresentativeofallsufferers....Ifsufferingbroughtwithitnoothergainthanthatbyourgriefsand painswegrowinlikenesstoChrist,ourprototype,itwouldstillbeapricelessbenefit....EvenifGodshouldchoosetogivethesameeternalrewardtothosewhosufferandto thosewhodonot,weshouldneverthelesspreferafflictionsasourearthlyportioninordertoresembleourleader.46

Thissenseofimitatioasbecomingorbeing(notmerelyfeelingorunderstanding)layinthebackgroundofeucharisticdevotion.Theeucharistwasanespecially appropriatevehiclefortheefforttobecomeChristbecausetheeucharistisChrist.Thedoctrineoftransubstantiation


wascrucial.OnebecameChrist'scrucifiedbodyineatingChrist'scrucifiedbody.Thusthereceptionoftheeucharistledsonaturallytostigmata,visibleorinward, thatcontemporarieshardlyworriedabouthowtoaccountfortheirappearance.Imitatiowasincorporationoffleshintoflesh.Bothpriestandrecipientwereliterally pregnantwithChrist.ThemetaphorofthegoodsoulasChrist'smother,whichhadanancestrygoingbacktoMark3:35,becameinthethirteenthcenturymorethan metaphor.CaesariusofHeisterbachdescribedapriestwhoswelledupattheconsecration,pregnantwithChrist.47ChristinaEbnerdreamedofbeingpregnantwith Jesus.BythefourteenthcenturyDorothyofMontauwasalmostrequiredbyherconfessortoexhibitmysticalpregnancyaspartofherpreparationforcommunion.48 Inotherinstancesofsuchliteralism,thedyingJulianaFalconieriwasobservedtoincorporatetheeucharistbyhavingitfadeintoherchest49andClareofMontefalco's sistersclaimedtoseetheinsigniaofChrist'sPassionetcheduponthemuscleofherheartafterdeath.50 NothinginlatemedievalnotionsofimitatioimpliedthatChrist'shumanitywasmerelybodyorthatChristwasmerelyhuman.Repeatedly,betweenthethirteenthand thefifteenthcentury,mysticsstressedthattheChristencounteredintheeucharistwasfullyhuman,soulaswellasflesh,andfullyGod.GuiardofLaoninhisDe eucharistia,composedintheearlythirteenthcentury,arguedthattherewerethreefruitsoftheeucharistbecauseofitsthreeelements:body,soul,anddivinityof Christ.51Inthelatefourteenthcentury,CatherineofSiena,inherDialogue,putthefollowingwordsintothemouthofGod:
IamthatSun,Godeternal,whenceproceedtheSonandtheHolySpirit....ThepersonoftheincarnateWordwaspenetratedandkneadedintoonedoughwiththelightofmy Godhead,thedivinenature.... Whattastesandseesandtouchesthissacrament?Thesoul'ssensitivity.Howdoessheseeit?Withhermind'seye....Thiseyeseesinthatwhiteness[ofthebread]thedivine naturejoinedwiththehumanwhollyGod,whollyhumanthebody,soulandbloodofChrist,hissoulunitedwithhisbodyandhisbodyandsoulunitedwithmydivinenature, neverstrayingfromme. ...AndatthewordsofconsecrationIrevealedmyselftoyou.Yousawarayoflightcomingfrommybreast,liketheraythatcomesforthfromthesun'scircleyetneverleavesit. Withinthislightcameadove,

Page258 anddoveandlightwereasoneandhoveredoverthehost....Yourbodilyeyescouldnotendurethelight,andonlyyourspiritualvisionremained,butthereyousawandtasted thedepthoftheTrinity,whollyGod,whollyhuman,hiddenandveiledunderthatwhiteness.52

ThejoymysticsfeltinphysicalunionwithChrist'shumanitywasneveradenialofChrist'sdivinity.BecomingChristphysicallywas,rather,awayofbeingsnatchedup intohisdivinity.Themoretheologicallysophisticatedofmysticalwriters(forexample,theHelftanuns,Hadewijch,andthetwoCatherines)insistedrepeatedlyonthe twonaturesofChrist.53ButasHadewijchputit(inherownsubtlelanguagewhichitissodangeroustoquoteoutofcontext),wecannotjust"beGodwithGod,"we mustalso"behumanwithChrist."54OrasAngelaofFolignoputit(inherbiographer'sparaphraseofherteaching):

[Thesoulinthispresentlifesees,feels,andknows]thelesserinthegreaterandthegreaterinthelesser,foritdiscoversuncreatedGodand"humanated"God[Deum humanatum],thatisdivinityandhumanity,inChrist,unitedandconjoinedinoneperson....Andsometimes,inthispresentlife,thesoulreceivesgreaterdelightinthelesserthan inthegreater.ForthesoulismoreconformedandadaptedtothelesserwhichitseesinChrist,theincarnateGod,thanitistothatwhichitseesinChrist,theuncreatedGod becausethesoulisacreaturewhoisthelifeofthefleshandofallthemembersofitsbody.ThusitdiscoversbothGod"humanated"andGoduncreated,Christthecreatorand Christthecreature,andinthatChristitdiscoverssoulwithfleshandbloodandwithallthemembersofhismostsacredbody.Andthisiswhy,whenthehumanintellectdiscovers, sees,andknowsinthismysteryChristthemanandChristGod,ordainerofthemystery,thisintellectfeelsdelightandexpandsinhim,becauseitseesGod"humanated"andGod uncreatedconformed,andmadelikeitselfbecause,thatis,thehumansoulseesthesoulofChrist,hiseyes,hisflesh,andhisbody.But,whileitlooks...,itshouldnotforget alsototurntothehigher...,thedivine.55

Thereisnothingspecificallyfemaleaboutthelatemedievalconcernwithmatterandbodyorabouttheextravaganceofcertainfourteenthandfifteenthcenturyefforts atimitatio.Physicalityasproblemandopportunitywasabasicthemethroughoutlatemedievalreligiosity.Butthisthemewastakenupespeciallyintenselyinwomen's livesandwomen'swritingandwasexpressedthereespeciallyineucharisticdevotionandinothersortsoffoodimagery.Forthistherearespecificculturalas


wellaspsychologicalandsocialreasons.Toputitsimply,theweightoftheWesterntraditionhadlongtoldwomenthatphysicalitywasparticularlytheirproblem, nurturingparticularlytheiropportunity. Inordertoplacewomen'sfoodpracticesintheirfullhistoricalcontext,itisthereforenecessarytocomeatlasttothevexedquestionofthe''imageofwoman."In chapters9and10,Iexplorehowthelongstandingassociationof"woman"with"body"andwith"food"contributedtothedistinctiveemphasesinwomen'spietythat arethesubjectofthisbook.Ialsoarguethatthenotionofwomanasfoodandfleshhaddifferentimplicationsformedievalwomenthemselvesandfortheirmale admirersanddetractors.


9 WomanAsBodyandAsFood
Andthusmanandwomanaredependentoneachothersothateachisnecessarytotheotherbecausemanisnotcalled"man"withoutwomannoriswomannamed"woman" withoutman.Forwomanisnecessarytoman,andmanistheconsolationofwomanandneitherofthemcanbewithouttheother.AndmantrulysignifiesthedivinityoftheSonof God,andwomanhishumanity. ForthesameGodcreatedmanstrongandwomanweak,andherweaknessgaverisetosin.AnddivinityisstrongbutthefleshoftheSonofGodisweak,andthroughittheworldis restoredtoitsfirstlife.Fortrulythatflesh,immaculateandinviolate,likeaspouse,proceedsfromthevirginwomb. HILDEGARDOFBINGEN(TWELFTHCENTURY)1

LatemedievaltheologyandpietyemphasizedChristassufferingandChrist'ssufferingbodyasfood.Recentscholarlyworkonspiritualityhasnotignoredthis emphasisindeed,itwouldbeimpossibletodoso.Yetscholarshavenotalwaysnoticedthatsuchconcernsweremoreprominentinwomen'sreligiositythaninmen's. Wheretheyhavenoticedthefact,onlyinternalizedmisogynyhascometomindasanexplanation.Butseriousmisunderstandingsofmedievalreligionareinvolvedin suchadescriptionofwomen'spiety.Ihavearguedaboveatlengththatthenatureofmedievalfamiliesandmarriagepatterns,thenatureofclericalauthority,andthe sexualdivisionoflaborallhelptoexplainwhythepietyofwomenhaddifferentemphasesandthemesfromthatofmenandwhyfoodpracticesaswellasfood metaphorswerecrucialtowomen.Butinordertounderstandwomen'sreligiositywemustalsoprobemoredeeplyintothenatureofsymbol.Foritseemslikelythat womenweredrawntoidentifywithChrist'ssufferingandfeedingfleshbecausebothmenandwomensawthefemalebodyasfoodandthefemalenatureasfleshly. BothmenandwomendescribedChrist'sbody


initssufferinganditsgenerativityasabirthingandlactatingmotherandmayatsomealmostunconsciouslevelhavefeltthatwoman'ssufferingwasherwayoffusing withChristbecauseChrist'ssufferingfleshwas"woman."Thequestionofwhatthefemalemeantassymbolinlatemedievalthoughtmust,however,beapproached withgreatcare. WomanAsSymbolofHumanity Thesocalledimageofwomanhasbeenmuchandheatedlydiscussedbyrecentstudentsofmedievaltheology.2 Someofthediscussionhasbeenmoreobfuscating thanhelpful.Somemoderncommentatorshave,forexample,deploredthefactthatcertainpatristicfigures(suchasTertullianandAugustine)arguedthatwomanqua womanwasnotcreatedinGod'simage,althoughwomanquahumanbeingwas.Themeaningofsuchstatementsinpatristicwritingis,however,quitecomplicated.3 Andbythethirteenthcenturysucharguments,usedintheologicalandlegalwriting,oftenreferredtowoman'ssocialrole(i.e.,hersubordinationtomaninthefamily)as wellastoheranatomicalorbiologicalrole.4 Thustoarguethatwomanaswife(acreatureruledbyman)couldnotbeanimageofthekingshipofGodmightbecome notsomuchaproofoffemaleinferiorityasanargumentforrebellionagainstfamilyandasourceofconfidenceforwomenwhoretainedvirginityoraspiredto continence.Inanycase,thenotionthatwomanwas"notinGod'simage"wasnotabsorbedbymedievalwomen,evenmarriedwomen,asaprohibitionoftheir approachtoGod.Onthecontrary,thewritingofwomenmysticsisfullofreferencestobeingcreatedinGod'simage.GertrudetheGreat,MargaretofOingt, DoucelineofMarseilles,andBeatriceofNazarethallrejoicedintheircreationintheimageandlikenessofGodandsawthisimageasthebasisonwhichimitatiois built.5 Inavision,MechtildofHackebornsawChristplacehishandsonhersandgiveher"theimprintofresemblancelikeasealinwax."6 AndCatherineofSiena wrote,addressingGod:"BythelightofunderstandingwithinyourlightIhavetastedandseenyourdepth,eternalTrinity,andthebeautyofyourcreation.ThenwhenI consideredmyselfinyou,IsawthatIamyourimage.''7 Anotheraspectofmedievaltheologicalviewsofwomanhasalsobeendeploredbymodernscholars,andthereisreasontothinkthatthisnotion


didinfluencemedievalwomen.Thisisthenotionthat,allegoricallyspeaking,"womanistomanasmatteristospirit."Thuswomanorthefemininesymbolizesthe physical,lustful,material,appetitivepartofhumannature,whereasmansymbolizesthespiritual,orrational,ormental.Aswesawaboveinchapter6,therootsofthis ideaweremultiple,scientificaswellastheological.Ancientscientistshadarguedfrequentlythatatconception,womancontributesthestuff(orphysicalnature)ofthe foetus,manthesoulorform.8 Patristicexegeteshadregularlyseenwoman(orEve)asrepresentingtheappetites,man(orAdam)asrepresentingsoulorintellect.9 WhencombinedwiththenegativeviewofmarriageandsexualitythatcharacterizedmuchearlyChristianthought,suchviewscouldanddidencouragemisogyny.They weresubtleviews,ofcourse.AndoftenwriterssuchasTertullianandAugustinewhovoicedthemhadinmindprimarilytheintegrationofvariousaspectsintoasingle personalitywhentheyspokeof"masculine"and"feminine."Thesepatristicthinkersoftenrejectedmarriagemoreasawayofrejectingfamilythanasawayofrejecting bodyorwoman.10ButbythelaterMiddleAges,aswesawinchapter1,suchrhetoricdidsometimesjustifythesuppressionofwomen'sreligiouslifesimplybecause women,evenchastewomen,wereseenasatemptationtotheclericswhosupervisedthem.Italsoprovidedabasisforthewitchhuntingtheologythatlabeledelderly womenasfleshlyandirrational,evendiabolical.Moreover,asWeinsteinandBellhavepointedout,itlednotonlytheologiansbutalsomalehagiographerstocomment onwomen'sweakness,tofocusonsexualtemptationintellingwomen'sstories,andtoattributethefailingsofmentowomenratherthantothementhemselves.11 Thenotionthatwomanistomanasmatteristospiritwassometimesusedbymaletheologiansandbiographersnotonlytodenigratewomenbuttocastigatemale failureaswell.Theargumentwentthus:ifwomen,whoweremorevulnerabletosinthanmen,lessrationalandstrong,couldrevereChristintheeucharistorflagellate theirbodiesintosubmissionandecstaticunion,howheinousbycomparisonwerethecrimesofmaleselfindulgenceandclericalcorruption!Moreover,menwent beyondtheuseof"thefemale"asawaytocastigatethemselves.Theywereaccustomedtoinverttheimageofwomanandseeherasnotonlybelowbutalsoabove reason.12TheysomewhatsentimentallysawasanapotheosisoffemaleweaknessandunreasonMary'sloveforsoulsandhermercytowardeventhewickedwho superstitiouslyreveredher.They


encouragedwomen'svisionsasspecial,suprarationalcontactwiththedivineandromanticizedwomen'smysticisminexoticrhetoric.Sometimestheyevenused womanasasymbolofthesoulcherishedbyGodandcalledthemselvesthe"brides"ofChrist.13 Womenwriterswereawareoftheideathatwomanistomanasfleshistospirit.Thefirstgreatfemaletheologian,HildegardofBingen,knewthetraditioninbothits exegeticalandscientificformsand,indeed,arguedagainstsomeofitsimplications.14Somelatemedievalwomen(forexample,MechtildofMagdeburgandCatherine ofSiena)didfallintoaregularpatternofusingmanormanlytomeanstrong,whiledescribingthemselvesas"weak"or"despised"women,"beggars,"''poormaids," "littlegirls,"etc.15Byandlarge,however,womendidnotdrawfromthetraditionalnotionofasymbolicdichotomybetweenmaleandfemaleanysenseofincapacity forvirtue,forspiritualgrowth,orforsalvation.Womenwriterstendedeithertoignoretheirowngender,usingandrogynousimageryfortheself(asdidGertrudethe GreatandHadewijch),ortoembracetheirfemaleness(asdidMargeryKempe)asasignofclosenesstoChrist.CatherineofSiena,forexample,althoughsheurged hermaleandfemalecorrespondentstobemenratherthanweakwomen,receivedavisionfromChristinwhichhetoldherthatsheneednottakeonmaledressasa signofherpowertospeakforGod.16Herusualimagesforherselfwereeitherfemaleorandrogynous:shewasthebridetoJesusthebridegroom,orachildtoJesus thenursingmother.Ifanything,womendrewfromthetraditionalnotionofthefemaleasphysicalanemphasisontheirownredemptionbyaChristwhowassupremely physicalbecausesupremelyhuman.InfluencedbythegrowingconcernwithChrist'shumanityasbodiliness,theysometimesevenextrapolatedfromthenotionthat maleistofemaleasspiritistofleshthenotionthat,inChrist,divinityistohumanityasmaleistofemale.Whereasmalewritersusedthetraditionaldichotomyofmale andfemaletocriticizeparticularwomenandtodifferentiatesharplybetweenmaleandfemaleroles,maleandfemalecharacteristics,womenusedthedichotomy differently.Towomen,thenotionofthefemaleasfleshbecameanargumentforwomen'simitatioChristithroughphysicality.Subsumingthemale/femaledichotomy intothemorecosmicdichotomydivine/human,womensawthemselvesasthesymbolforallhumanity. InmakingthissymbolicequationofhomoorhumanitaswithEve,Mary,ormulier,womenwere,ofcourse,aidedbytheveryslipperiness


ofthenotionofhumanity.ArecenttranslatorofCatherineofGenoahaspointedoutthat,inherwork,theallegoricalmeaningofumanittendstoslipbackandforth between"humanness"and"flesh"or"fleshlyurges."17Theauthorofthenuns'bookofUnterlindenevenusedhomotomeanallcreatures.18Intheeroticpassagefrom Hadewijchquotedaboveinchapter5,humanity(menscheit)clearlyimpliesbody:"andallmymembersfelthisinfullfelicity,inaccordancewiththedesireofmy heartandmyhumanity."Suchusagetendedbothtoobscureanysharpsenseofabody/souldichotomy(forbothbodyandsoulwerehuman)andtoimplythat humannessintimatelyinvolvedphysicality.Itwasthissenseofhumanityasentailingbodiliness(althoughnotreducibletoit)thatwomenexpressedinexpandingthe male/femaledichotomyfromspirit/fleshtodivine/human. FromHildegardofBingenandElizabethofSchnautoCatherineofSienaandJulianofNorwich,womentheologiansinthelaterMiddleAgesusedwomanto symbolizehumanity.ToElizabethofSchnauthehumanityofChristappearedinavisionasafemalevirgin.19ToHildegardofBingen,Christ'shumanitywasto Christ'sdivinityaswomanistoman,andmulierrepresentedhumankind,falleninEve,restoredinecclesiaandMaria.Inthepassagequotedasepigraphtothis chapter,Hildegardnotonlywritesexplicitlythat"mansignifiesthedivinityoftheSonofGod,andwomanhishumanity,"shealsoarguesthatthetwoare complementaryinoursalvationasmaleandfemalearenecessarytoeachotherinreligiouslifeandinthebiologicalprocessofprocreation.Repeatedlyinherwork, HildegarddescribesthatwhichisredeemedbyChristthehumanity(includingphysicality)thatcomesfromMaryasfeminineandsheunderlinestheassociationof womanhumanitywithfleshlinessbyarguingthatAdamiscreatedfromclaybutEvefromflesh.ThusEve'screationnotfromseedbutfromflesh(nonexseminebut carodecarne)isaparalleltotheIncarnationofChrist.20Moreover,theparallelwomanhumanityChristisenhancedbyHildegard'ssensethatChrist'sbodyisalso ecclesia("church"afemininenouninvariablysymbolizediconographicallybyafemalefigure).Inafamouseucharisticvision,Hildegardsawwhatshecalledthe "figureofwoman"(muliebrisimago)receivingfromChrist,hangingonthecross,adowryofhisblood,whilebelowthecrossstoodanaltarwiththechaliceand aroundthechalicewererevealedasinamirrortheeventsofChrist'searthlylife(seeplate12).AndHildegardheardthewords:"Eatanddrinkthebodyandbloodof mySontoabolishtheprevaricationofEveandreceiveyour


trueinheritance."Althoughthepriesthoodwas,toHildegard,reveredandessential(andlimitedtomen),thepriestentersthiseucharisticvisiononlyafterholychurch. Theimageofbothsinfulandsavedhumanityistheimageofwoman.21 Moreover,towomenwriterssuchasHildegard,MechtildofMagdeburg,andCatherineofSiena,MarywasthesourceandcontainerofChrist'sphysicality:theflesh Christputonwasinsomesensefemale,becauseitwashismother's.Therootsofsuchtheologicalinterpretationliepartlyinscientifictheory.Aristotelianphysiological doctrineheldthatthemotherprovidesthestuffofthefoetus,thefathertheformoranimatingprinciple,whereasamoreGalenicinterpretation(whichHildegard,for example,reflected)heldthatthemaleandfemaleseedstogetherproducetheinfant.22Butwhichevertheoryofconceptionamedievaltheologianheld,Christ(whohad nohumanfather)hadtobeseenastakinghisfleshfromMary.ThissensethatChristasbodyisformedfromMary'sbodyledHildegardtoarguethatitisexactly femalefleshtheveryweaknessofwomanthatrestorestheworld.Thusfleshistoher,inhervisionsandinthetheologicalexegesistheystimulate,symbolizedby woman.Christ'sflesh(hismother'sflesh)ishisspouse:"trulythatflesh,immaculateandinviolate,likeaspouse,proceedsfromthevirginwomb."Acenturyafter Hildegard,MechtildofMagdeburgwentfurtherandimpliedthatMarywasakindofpreexistenthumanityofChristastheLogoswashispreexistentdivinity. MechtildarguedthattheIncarnationjoinedtheLogos(thepreexistentSonofGod)withapurehumanity,createdalongwithAdambutpreservedaspureinMary aftertheFall.23Otherwomenwritersimplythesamething.CatherineofSiena,whousuallyreferredtohumanityas"Adam,"24sometimesassociateditwiththeflesh ofMary.Shewrote,speakingofMary'ssorrowattheCrucifixion:
Ohsweetestlove,whichwastheswordthatpiercedtheheartandsoulofthemother!TheSonwasbrokeninbody,andthemothersimilarly,forhisfleshwasfromher.Indeeditis justthatshesufferedinwhatbefellhimforhetookhisimmaculatefleshfromher....Hehadtheformoffleshandshe,likehotwax,receivedtheimprintofdesireandloveforour salvationfromthesealingoftheHolySpirit,andbymeansofthissealthedivineWordwasincarnate.25



InaveryunsettlingreflectionofthisemphasisonChristasassumingMary'sflesh,afourteenthcenturywomanfromMontaillousaidshecouldnotbelieveinthereal presence:
OnedayasIwasgoingtothechurchoftheHolyCrosstohearmass,Iheardsomewomen...sayingthatawomanhadgivenbirthontheroadside....Hearingthis,Ithoughtof thedisgustingafterbirththatwomenexpelinchildbearingandwheneverIsawthebodyoftheLordraisedonthealtarIkeptthinking,becauseofthatafterbirth,thatthehostwas somethingpolluted.That'swhyIcouldnolongerbelieveitwasthebodyofChrist.27

TheagonizedskepticismofthiswomanAudeaboutthesacramentsandevenaboutGodsprangfromrootssodeepwecannomorediagnosethemthancouldthe inquisitorwhoexaminedherforsymptomsofCatharheresy.Butitisclearthatherobsessionwiththehostasawoman'splacentaaroseinthecontextofaspirituality thatlaidgraphicemphasisontheconsecratedwaferasaproductof,afragmentandexudingof,thefemalewomb. Suchideaslieinthebackgroundofthetheologyof"God'smotherhood,"developedbyJulianofNorwichinthelatefourteenthcenturyandmuchcommenteduponby recentscholars.28Theuseofmotheringasadescriptionforthenurturingandloving(eventhedisciplining)thatthesoulreceivesfromGodisnotnewwithJulian,nor areJulian'sextendedimagesofJesusaslactatingandbirthingmother.Jesus'birthpangshadbeenextensivelydescribedbyMargaretofOingtinthethirteenthcentury, andhisnursingofthesoulwaselaboratedby,amongothers,GuerricofIgnyinthetwelfthcenturyandCatherineofSienaandtheanonymousmonkofFarneinthe fourteenth.29WhatisnewinJulianistheideathatGod'smotherhood,expressedinChrist,isnotmerelyloveandmercy,notmerelyredemptionthroughthesacrifice ofthecross,butalsoatakingonofourphysicalhumanityintheIncarnation,akindofcreationofus,asamothergivesherselftothefoetusshebears.Inavery difficultpassage,JulianexplainsthatthesecondpersonoftheTrinityisourmotherbecauseinhim/herwearedouble,substantialandsensual(thatis,whatweareis human,andthiskindofasoulahumansoulisonethatknowsandfeelsinabody)."Oursubstanceisthehigherpart,whichwehaveinourFather,GodAlmighty andthesecondpersonoftheTrinityisourMotherinnatureinoursubstantialcreation,inwhomwearefoundedandrooted,andheisourMotherof


mercyintakingoursensuality."30Inotherwords,thefullcreaturethatweare,bodyaswellassoul,isredeemedinChristbecauseChristisfullyhuman.This fundamentalfactofsalvationisappropriatelysymbolizednotby"father,"whorelatestoandisresponsibleforthesoulorreasonorspiritofthechild,butby"mother," fromwhomthechild'sphysicalitycomesandwhoseexistencethereforemakespossibleitswholeness.So,asJulianputsit,inourmother"ourpartsarekept undivided."ToJulian,therefore,MaryisourmotherbecauseherfleshisChrist'sbutsheisashadowofthetruermother,Christhimself,whogivestousourhumanity bytakingiton:

ForinthesametimethatGodjoinedhimselftoourbodyinthemaiden'swomb,hetookoursoul,whichissensual,andintakingit,havingenclosedusallinhimself,heuniteditto oursubstance.Inthisunionhewasperfectman,forChrist,havingjoinedinhimselfeverymanwhowillbesaved,isperfectman. SoourLadyisourmother,inwhomweareallenclosedandbornofherinChrist,forshewhoismotherofourSaviorismotherofallwhoaresavedinourSaviorandourSavioris ourtrueMother,inwhomweareendlesslybornandoutofwhomweshallnevercome.31

Malewritersweremostapttouse"male"and"female"asdichotomousimages,representing,forexample,nurtureversusdiscipline,orweakversusstrong,or inspirationversustheauthorityofofficeandmalewriterssawGod'smotherhoodinhisnursingandlovingratherthan(asJuliandid)inthefactofcreation.32Butmale writerstooassociatedthefleshofChristwithMaryandthereforewithwomen.RobertGrosseteste(d.1253)wrotetothemonksofPeterborough:"Inyourmonastery continuallydwellstheKingofheaven,notonlybyhisdivinitybutalso,inthesacramentoftheeucharist,bythetruesubstanceoftheflesh,whichhetookfromthe Virgin."33AndmalewritersoccasionallysawthefemaleassymbolofChrist'shumanity.InacomplexpassagethatequatesAdamwithallhumanitybutseesthat humanityasthebrideofChrist,Ruysbroeckwrote:

ThisbridegroomisChristandman'snatureisthebride....[Andthedevildeceivedtheman]inwhomhumanityfirstexisted.Andbyfalsecounselheseducedher,Nature,the brideofGod.Andshewasdrivenoutintoastrangeland....ButwhenGodthoughtittime...thenhesenthisonlybegottenSononearth,intoasplendidcourtandintoa glorioustemple,whichwasthebodyofthegloriousmaidenMary.There

Page268 heespousedthisbride,ournature,andunitedherwithHisPersonbythenoblevirgin'smostpureblood.34

Thushumannature,falleninAdam,istakenon,married,andredeemedbyChristthebridegroominMary'sbody.Itisthebrideitissymbolizedbythefemale.Andif ournatureisnotMaryherself(thesecondEve)asitappearstobetoMechtilditsmarriagetoChristisnonethelessmadepossibleonlybythebodyandbloodof woman.35 TheassociationofChrist'sfleshwithwomanwasreinforcediniconography,whereMaryhadaplaceofhonoroneucharistictabernacles.Themodernhistorian DumoutethasdescribedanumberoflatemedievalinstancesinwhichafigureofMaryactuallyisthetabernacleinwhichtheconsecratedhostisreservedand,asI explainedabove,retablestendedtoassociatetheconsecrationwiththeIncarnationbydepictingtogethertheofficiatingpriestandscenesoftheAnnunciationorof Marywithherbaby.36InthesocalledViergesouvrantes(plate13),statuesofMaryopenedtorevealtheTrinityinside,thusunderliningthenotionthatMaryisthe container(i.e.,thewomb,thetabernacle,thereliquary)withinwhichreststhebodyofGod.37WilliamDurandustheElderinhisRationaledivinorumofficiorumof 12851291saidthatthereliquary(capsa)intowhichthepriestputtheconsecratedhostwas,symbolicallyspeaking,thebodyofMary.38FrancisofAssisi,inhis "SalutationoftheBlessedVirgin,"addressedMarythus:
Hail,his[i.e.,Christ's]Palace. Hail,histabernacle. Hail,hisrobe. Hail,hisHandmaiden.39

AndSusocalledhertheshrineinwhichWisdomreposes.40InoneofBernardofClairvaux'ssermonsonthePurification,theparallelbetweenthechildinMary's wombandthehostofferedonthealtarisexplicitlydrawn.BernardsuggeststhatMary,motherandcelebrant,providesandpresentstothefaithfulthebodythatistheir salvation:"Offeryourson,sacredVirgin,andpresenttheblessedfruitofyourwombtoGod.Offertheblessedhost,pleasingtoGod,forthereconciliationofusall."41 Indeed,sincewoman'sbodywasseenastheplacewheretheIncarnationhappens,theconsecratingpriestwassometimesdescribedasapregnantwoman:Caesarius ofHeisterbachdescribedapriestwhoswelledinmysticalpregnancyanoftenquotedtwelfthcenturytextpraisedthedignity


ofpriestsbecauseintheirhandsChristisincarnated"asintheVirgin'swomb."42 Thesymbolicassociationofhumanitywiththefemalethusderivedstrengthbothfromtheassociationofhumanitywithphysicality(andwomanwasthesymbolofflesh) andfromtheassociationofChrist'shumanitywithhismother.Itisinthiscontextthatwemustunderstandwomen'sdevotiontoMary,forwomen'sdevotionwasless toMary'ssocialorreligiousroleaswomanthantoherphysicalroleasbearerofhumanity.Thisexplainsarathercuriousfact,notedbyrecenthistorians.43Maryisnot reallyasimportantasonemightexpectinwomen'sspirituality. AstheworkofSimoneRoisinhassuggested,Marywasprobablymoreimportantinmen'svisionsthaninwomen'sinthelaterMiddleAges.44Moreover,Weinstein andBellhavedemonstratedthatthehumanityofChristwasamoreprominentemphasisinwomen'spietythanwasdevotiontotheVirgin.45Thisisnottosaythat Marywasunimportanttowomen.ParticularlyinsouthernEuropeansaints'vitae,thethemeofimitatioMariaeisstrong.ThebiographerofDoucelineofMarseilles, forexample,seesherasimitatingthepovertyofMary,whereasherbelovedFrancisimitatedthepovertyofChristdirectly.46AndMargeryKempeclearlyidentified withMaryandwished,likeher,totakeChristinherarms.Butwefrequentlyfindthatitismalebiographersofwomenwhostressthethemeofwomen'simitationof Mary(andofotherwomen).47Somewomensaintsdo,itistrue,seethemselvesinvisionsswooningwithMarybeforethecross.Butallwomensaintsswoononthe crosswithChristhimself.48ThereverenceforMarythatwefindinwomenmysticsislessareverencefora"representativewoman"thanareverenceforbody,forthe bearerandconduitoftheIncarnation.ThusdevotiontoMarytendedtobeapreludetodevotiontoherchild.IfMarywasimportantinHadewijch'smysticism,for example,orinJulianofNorwich'stheology,itwasbecauseChrist'sbodywastheoccasionforhumanredemptionandMary'sbody,thesourceofChrist'sbody,was thesymbolofthebodilinessofusall.49 Woman'sBodyAsFood Medievalpeopledidnotsimplyassociatebodywithwoman.Theyalsoassociatedwoman'sbodywithfood.Womanwasfoodbecause


breastmilkwasthehumanbeing'sfirstnourishmenttheonefoodessentialforsurvival.Medievalwritersandartistswerefondofthetheme,borrowedfromantiquity, oflactationofferedtoafatherorotheradultmaleasanactoffilialpiety.50ThecultoftheVirgin'smilkwasoneofthemostextensiveinlatemedievalEurope.51A favoritemotifinartwasthelactatingVirgin(see,forexample,plates14,21,22,23,24).TheallegoricalfigureCharitywasfrequentlydepictedasanursingmother, andsometimestheothervirtuesalsowererepresentedaswomenwithflowingbreasts(seeplates15and16).52TheallegoricalfigureEcclesiawasalsofrequently shownasanursingmother(seeplate17).53Eventhebodiesofevilwomenwereseenasfood.Witchesweresupposedtohavequeermarksontheirbodies (supernumerarybreasts)atwhichtheynursedincubi.54 Maleandfemalewritersusednursingimageryindifferingways.Menweremorelikelytouseimagesofbeingnursedwomen,metaphorsofnursing.Whenmale writersspokeofGod'smotherhood,theyfocusedmorenarrowlyonthesoulbeingsuckledatChrist'sbreast,whereaswomenwereapttoassociatemotheringwith punishing,educating,orgivingbirthaswell.55MostvisionsofdrinkingfromthebreastofMarywerereceivedbymen(themostfamousarethevisionsofBernardof Clairvauxseeplates18and19andHenrySuso),althoughthereareatleasttwocasesofGermannunsreceivingthesamevisioninthelatethirteenthcentury.56In contrast,women(forexample,IdaofLouvainandMargeryKempe)sometimesidentifiedwithMaryasshesuckledJesusorreceivedvisionsoftakingtheChristchild totheirbreasts. Bothmenandwomen,however,drankfromthebreastofChrist,invisionandinimage.BothmenandwomenwovefromPaulinereferencestomeatandmilkand fromtherichbreastandfoodimagesoftheSongofSongsacomplexsenseofChrist'sbloodasthenourishmentandintoxicationofthesoul.57Bothmenand womenthereforesawthebodyonthecross,whichindyingfedtheworld,asinsomesensefemale.Again,physiologicaltheoryreinforcedimage.Tomedievalnatural philosophers,breastmilkwastransmutedblood,andahumanmotherlikethepelicanthatalsosymbolizedChristfedherchildrenfromthefluidoflifethatcoursed throughherveins.58Asearlyasthesecondcentury,ClementofAlexandriahadspokenofChristasmother,drawingouttheanalogybetweenaGodwhofeeds humankindwithhisownbloodintheeucharistandahumanmotherwhosebloodbecomesfood


forherchild.59Inthetwelfthcentury,nursingimageryoftenreferredtomilkandhoney,butbythethirteenthandfourteenthcenturiestheimageofthenursingJesus regularlystressedbloodmorethanmilkasthefoodofthesoul.60MechtildofMagdeburg,forexample,notonlydrewaparallelbetweenbloodandmilk,shealso spokeofbloodassuperiorfoodandsawherownprayerandsufferingforothersoulsasnursingthemwithblood.61WhenCatherineofSienaspokeofdrinkingblood fromthebreastofmotherJesus,sheexplicitlyglossedbloodassufferingbothJesus'sufferingandherown.62 SuchanassociationofChrist'swoundswithwoman'sbodyandofwomanwiththefoodoftheeucharistisalsofoundinlatemedievalart.Medievalartistsexplicitly associatedthelactatingVirginwiththeeucharist.ThebreastoftheVirginwasassociatedvisuallywiththegrapeandtherebywithpassagesfromtheSongofSongs thatwereinterpretedaseucharisticreferences(seeplates20,21,22),andthenursingVirginwasalsodepictedasatableoranovenonwhichthechild(i.e.,thebody orthefood)wasofferedorbaked(seeplates14,24).63Inthosepictureswherethechilddoesnothimselfnursebut,rather,seemstoinvitetheviewertowardthe breast(seeplates14and23),someassimilationofMary'smilkandthebloodoftheeucharistmaybeintended.BarbaraLanehaspointedout,forexample,thatina miniatureofabout13801385fromtheTurinMilanBookofHours(seeplate23),thechildmakesnoattempttonurse,andMary'sgestureofpressingmilkfromher breastisdirectedtowardakneelingsupplicantwhoseemsfarmoreanxiousforthefoodthandoesthechild.64 Artists,however,wentfurtherthanmerelyassociatingthebreastsofMarywitheucharisticfeedingofthesoul.Thereareafewlatemedievalpaintingsthatsuggest (eveniftheydonotdirectlydepict)thelactatingJesusfamiliarfromdevotionaltexts.Wefindthissuggestionmoststrikinglyinanobscurepaintingoverwhichthegreat historianGougaudpuzzledagenerationago(seeplate25).65Thepainting(nowintheAccademiainVenice)wasmadeinthefifteenthcenturybyacertainQuiriziofor themonasteryofSt.ClareontheislandofMurano.Quirizio(oneofwhoseotherextantpaintingsalsodepictsaeucharistictheme)showsayoung,tooureyes somewhatfeminine,andverybeautifulChristdisplayingthewoundinhisrightside,locatedhighup,whereanipplewouldbe.66Heliftsupandoffersthewoundwith twofingersofhislefthand,justastheVirginoffersherbreasttotheinfantChristinhundreds


ofmedievalpaintings.Withhisrighthandhegivesthehosttoakneelingnun.AndaroundhimiswritteninphrasesborrowedfromtheSongofSongs:"Cometome, dearlybelovedfriends,andeatmyflesh"and"Cometome,mostbeloved,inthecellarofwineandinebriateyourselfwithmyblood."Quirizio'spaintingisrelated iconographicallytothosedepictionsthatarthistorianscallthe"eucharisticManofSorrows"(seeplates26,27,30),andinatleastoneofthesegraphicimagesof Christ'sflowingbloodasfoodthefemalefigureCharity(herselfoftendepictedwithflowingbreasts)receivesthesavingliquidinachaliceasthenuninQuirizio's picturereceivesthewafer.67Thesepaintingsremindusofthepicture(notextant)whichasixteenthcenturyhagiographerreportsAldaofSienatohave commissionedapictureofastunningreversal,inwhichMarydrinksfromthebreastofChristwhileholdinghiminherarms.68 TheparallelismofChrist'swoundandMary'sbreastsuggestedinQuirizio'spaintingissometimesmadeexplicitinmedievalart.AnimageoftheVirginpresentingher breastoftenaccompaniesthefigureofChristexposinghiswound,toformthesocalledDoubleIntercession.Forexample,inamidfifteenthcenturyminiaturefrom theTurinMilanBookofHours,Marytouchesherbreast,whichshedoesnotdointhestandardportrayaloftheMadonnaofHumility(seeplate28).69InaLast JudgmentbyJanProvost(earlysixteenthcentury),theVirginandChristbareandliftuptheirbreastsinexactlyparallelgestures(seeplate29).70Insomesuch depictions,itisnotmerelythebreastassymbolofcompassionorcharity(andthereforeofintercession)thatisoffereditisthebreastasfood,paralleltothebleeding (i.e.,nurturing)wound.InanearlysixteenthcenturydepictionofChristastheManofSorrows,forexample,Christinthecentralpanelliftsupableedingwoundwhile ontherighthandpaneltheVirgin,standingbesideBernardwhomshenursed,liftsupherbreastinanidenticalgesture(seeplate30).Thepictureremindsusthat literaryaccountsofthemiracleofthelactationofBernarddescribeBernardaschoosingbetweenthebleedingwoundofChristandtheflowingbreastofhismother.71 SinceChrist'sbodywasabodythatnursedthehungry,bothmenandwomennaturallyassimilatedtheordinaryfemalebodytoit.WomenmysticssuchasMechtildof MagdeburgandCatherineofSienausedthemetaphorofthenursingmothertodescribetheirownsufferingfor


others,sometimesclearlyimplyingthattheirspillingofbloodmilkwasimitatioofChrist'snurturingandinebriatingwoundsbreasts.Moreover,miraculouslactating, exuding,andfeedingwerecharacteristicfemalemiraclesinthelaterMiddleAges.MalehagiographerssuchasThomasofCantimprsawwomensaintsdrippingholy fluidfrombreastsorfingertips.SeveralpiousvirginsfromtheLowCountriesChristinatheAstonishing,GertrudevanOosten,andLidwinaofSchiedam supposedlynursedtheiradherentsorcuredotherswiththeirbreastmilk.Womenmysticsthemselveshadvisionsoffeedingothers,includingtheChristchild.Theunion ofmouthtomouth,whichmanywomen(forexample,Lutgard,BeatriceofNazareth,Lukardis,MargaretofFaenza)gainedwithChrist,becamealsoawayoffeeding. 72Lutgard'ssalivacuredthesickLukardisblewtheeucharistintoasister'smouthColetteofCorbiecuredwithcrumbsshechewedandplacedinthemouthsof others.Inagesturethatseemseroticaswellascomfortingandnurturing,MargaretofFaenzakissedherfriendBenevenuta,whowasrecoveringfromatranceinduced bythemass,andreceivedconsolation.

SisterMargaretplacedherfaceonher[friend's]faceandkissedher:andthenshefeltsuchsweetnessandconsolationgooutfromher[friend]andenterintoher,thatitseemedto herthatalltheconsolationsoftheworldcouldnotbeequaltothis.AndthisconsolationremainedinSisterMargaretformanydays,withagreatabundanceoftears.73

Asnotedabove,legendsofmiraculousexudingafterdeathseemtohavebeenattachedmorefrequentlytowomen'sbodiesthantomen'saftertheeleventhcentury.74 Andwheremarvelouseffluviawerepartofasaint'spower(asinthecases,forexample,ofNicholasofMyra,Walburga,AgnesofMontepulciano,Elizabethof Hungary,MargaretofCittdiCastello,RoseofViterbo,andMaryMagdalende'Pazzi),foodandnursingmotifstendedtobeofstrikingimportanceinthesaint's story.ThelegendaryCatherineofAlexandria,forexample,fromwhosetombonMountSinaiholyoilwascarriedallovertheWesternworld,wassupposedtohave bledmilkratherthanbloodfromherseveredveinswhenbeheaded.75Indeed,onesuspectsthatstigmataappearedmostfrequentlyonwomen'sbodiesbecause stigmata(likethemarksonthebodiesofwitchesandthewoundsinthebodyofChrist)werenotmerelywoundsbutalsobreasts.Inthisliteralbecomingofthe crucifiedbody,


whichafemalemysticmightachievebyecstasyorbyeatingthebleedinghostwhichfeedshumankind,woman'swoundsbreastsrecapitulatedthewoundsbreastsof Christ. Thusthefemalebodywasseenaspowerfulinitsholyormiraculousexuding,whetherofbreastmilkorofbloodorofoil.Suchextraordinaryflowingoutwas predicatedonextraordinaryclosure.Holywomenwereoftensaidneithertoeatnortoexcrete.Stigmaticsormyroblyteswereoftenmiraculousfastersforexample, MaryofOignies,LutgardofAywires,ChristinatheAstonishing,ElizabethofHungary,AgnesofMontepulciano,ElsbetAchler,CatherineofSiena,Lidwinaof Schiedamandtheologiansunderlinedthefactthatthosewhobledorexudedunusualfluidsdidnotexcreteinordinaryways.Theemphasisofhagiographers,who pointedoutthatsaintsneitherexcretednormenstruated,andofearlymodernpamphleteers,whopraisedthesocalledfastinggirlsfornotexudingsomuchassweat ordandruff,seemsbasedonsomenotionofbalance.InthethirteenthcenturyRogerBacontriedtoexplainsuchphenomenanaturalisticallybyarguingthatthemattera fastingwomandidnotexcretemightenablehertosurvivewithouteatingbut,takentogether,thestoriesofpiouswomensuggestadeeper,symbolicbalance:a balanceofeatingwithnoteating,exudingwithnotexuding.ClosingherselfofftoordinaryfoodyetconsumingGodintheeucharist,theholywomanbecameGod's body.Andthatbodyflowedout,notintheinvoluntaryeffluviaofurineormenstrualbloodordandruff,butinachosensuffering,achosenexcreting,thatwashed,fed, andsavedtheworld. Theextremeinterestinphysicalityandthecloseassociationofwomanwithbodyandfoodthatcharacterizedlatemedievalcultureseemtoliebehindnotonlywomen's eucharisticpietyandfoodasceticismbutalsothestartlingnumberofwomen'smiraclesthatinvolvebodilychange.Women'sbodiesgaveoffsweetsmellsaswellas healingeffluvia,indulgedinecstaticnosebleedsandtrances,displayedabruptchangesinsizeandappearance,andbrokeoutinmiraculousphysicalmarksrangingfrom espousalringstostigmata.OncewetakeasseriouslyasmedievalpeopledidtheideathatonthealtarGodbecomesfood(tornandbleedingmeat),wecanseeas neverbeforehowmuchofsuchpietywasliterallyimitatioChristi.Thesomaticchangeswomenunderwentparalleltoastrikingextentthesavors,aromas,marks,and alterationsthatoccur


intheconsecratedhost.Nowonderwomenmanipulatedtheirbodiesindoingso,theybecameGodaGodwhofeedsandsaves.76 ManyassumptionsinthetheologyandcultureofEuropeidentifiedwomanwithfleshandwithfood.Thissametheologytaughtthattheredemptionofallhumanitylayin thefactthatChristwasfleshandfood.Moreover,bothChristandwomenwerefoodinsofarastheywerebodies.God,likewoman,fedhischildrenfromhisown body,andifGoddidnotmakehischildrenfromhisownflesh,hesavedthembytakingforhimselfabodyfromtheirhumanity.Thuswomenfounditveryeasyto identifywithadeitywhoseflesh,liketheirs,wasfood.Inmysticalecstasy,incommunion,inasceticimitatio,womenateandbecameaGodwhowasfoodandflesh. AndineatingaGodwhosebodywasmeatanddrink,womenbothtransfiguredandbecamemorefullythefleshandthefoodthattheirownbodieswere.77 Anexplorationofwhatwomanmeanttolatemedievalmenandwomen,ofwhatsymbolsandassumptionsclusteredaroundthefemale,thushelpsustounderstand whycertainmetaphorsweresoprominentinwomen'sspiritualwritingandwhywomennotonlypracticedcertainreligiousbehaviorsbutalsooccasionallycarried thosebehaviorstoextraordinarylengths.Ishould,however,closethisefforttoexplainwhywomenchosecertainimagesandpracticeswithanobviousbutnecessary warning.Symboldoesnotdeterminebehavior.TheimagesIhavediscussedherewerefartoocomplex,toomultivalent,todictateanyspecificresponse.Justas women'sfoodpracticesmanipulatedtheirenvironmentwithdivergentandunpredictableresults,sowomen'sattemptstoimitateChrist,tobecomethesufferingand feedingbodyonthecross,issuedinawidevarietyoflifestories.Althoughmostreligiouswomenseemtohaveunderstoodtheirdevotionalpracticesasinsomesense servingaswellassuffering,theyactedinverydifferentways.Some,suchasCatherineofGenoa,ElizabethofHungary,andMaryofOignies,expressedtheirpietyin feedingandcaringforthepoor.Some,suchasAlpas,AliceofSchaerbeke,andElsbetAchler,layraptinmysticalcontemplationastheirbodiesdecayedindiseaseor inselfinducedstarvationthatwasofferedforthesalvationofothers.Some,suchasBeatriceofNazareth,grewfromaperiodofwithdrawal,insanity,anddiseaseinto alaterphaseofconfidentleadershipsome,suchasMargaretofHungaryandDorothyofMontau,spenttheirlivesinabusycombinationof


charitableactivitiesandacute,selfpunishingasceticism.Itismisleadingtotrytosketchacompositelifestoryforreligiouswomen.78Anditimpliesamisunderstanding ofthefundamentalnatureofsymbolstosuggestthattheycompelledspecificbehaviors.79Instead,symbolsenabledwomentoexpressandgivemeaningtocertain basicrealitiesthatallsocietiesface:therealitiesofsufferingandtherealitiesofserviceandgenerativity. Yet,womenchosecertainsymbolsespeciallyeatingandpainmorefrequentlythandidmen.Andthemedievalnotionofthefemaleasbodyandfoodseemsto havesuggestedthattherealitiesofsufferingandservice,althoughuniversalaspectsofthehumancondition,somehowpressedmoreheavilyonwomenorthatwomen foundinthemaspecialsignificance.Indeed,theassociationofwomanwithbodyandfoodwascharacteristicoftextswrittenbybothwomenandmen.This associationthusnotonlyhelpsustounderstandthemultifacetedbehaviorofmedievalwomen,italsoraisesprofoundquestionsaboutwhethermenandwomenused symbolsinthesameway.For,ifmenandwomenlivedtogetherinasocietyinwhichmaleandfemalenotonlysymbolizeddifferentthingsbutalsohadasymmetrical (thatis,unequalandnonparallel)values,itisreasonabletoaskwhetherthetwosexesmadethesameuseofgenderrelatedimages,orindeedofanyimages.Didthe notionoffemaleasfoodorbody,weaknessorunreason,meantoapersonwhowasfemalewhatitmeanttoapersonwhowasnot?Inconclusion,therefore,letme turntothequestionofhowwomen'simagesoffoodandbodysymbolizedself,makingtheanswermoreprecisebydelineating,ascomparison,howmen'sreligious behaviorandimagesreflectedmen'sselves.


10 Women'sSymbols
Godhasnowheretoputhisgoodness,ifnotinme...noplacetoputhimselfentire,ifnotinme.AndbythismeansIamtheexemplarofsalvation,andwhatismore,Iamthe salvationitselfofeverycreature,andthegloryofGod....ForIamthesumofallevils.ForifofmyownnatureIcontainwhatisevil,thenIamallevil....NowifIamallevil,andhe isallgoodness,andonemustgivealmstothepoorestbeing,orelseonetakesawaywhatishersbyright,andGodcandonowrong,forotherwisehewouldundohimselfthenIam hisgoodnessbecauseofmyneediness....Ineedtohavethewholeofhisgoodness,thatmyevilmaybestaunched:mypovertycannotmakedowithless.Andhisgoodness,being powerfulandprevailing,couldnotenduremybegging,andIwouldperforcehavetobegifhedidnotgivemeallhisgoodness....SoitisclearlyevidentthatIamthepraiseofGod forever,andthesalvationofhumancreaturesforthesalvationofanycreatureisnothingbutknowingthegoodnessofGod....NorcanIeverlosehisgoodness,sinceIcannever losemyevil. MARGARETPORETE(D.1310)1 MyMeisGod. CATHERINEOFGENOA(D.1510)2

InwesternEuropeintheMiddleAges,asinmanyculturestoday,womencookedandmenate.Oneofthestrongestsociallinksbetweenmaleandfemalelayinthe factthatwifeorservantcookedwhathusbandandlordprovidedandintheevenmoreconsequentialfactthatmother'swombandmother'smilkguaranteedsurvival forthenextgeneration.AsEliasCanettisays:''Amotherisonewhogivesherownbodytobeeaten."Thisisnot,ofcourse,tosaythatwomenneverateorthatonly malechildrenwerenourishedfromthefemalebody.Itis,rather,tosaythatsocialarrangementsandculturalsymbolsstereotypedreceptionofnurtureasamale activity,provisionofnurtureasafemaleone. Itisagainstthisbackgroundthatwemustlocatethefoodsymbolism


ofmedievalChristianity.AndwhenweunderstandChristianity'sfundamentalsymbolsinsuchacontext,theyburstuponuswithstunningandunexpectedimport.Forin themassthepriestpreparesfood,andthefooditselfisabodythatfeedswithitsownfluidsandsaveswiththefleshlycoveringitprovides.Ifmedievalpeopleturned totheMadonnaandchildasasymbolthattheawfulnessandmercyofGodhavealreadyreachedacrosstheabysscreatedbythesinofhumankind,howmuchmore confidentlydidtheyturntoGodhimself,lactatingonthecross,bearingthesoulinhiswomb,feedingthefaithfulfromthehandsofhisspecialcooksandservants,the clergy?WhenCatherineofSienaspokeofGodastable,Christasroastedflesh,andtheHolySpiritaswaiterandservant,shewasnotindulginginanoddfeminine needtousedomesticimagesshewasexpressingastartlingreversalattheheartofChristianimagery.Whenmedievaltextsandmedievalvisionsspokeofclericsas pregnantwithJesus,theyexpressednotgenderconfusiononthepartofmaleauthorsandworshipersbutthepolysemous,fertile,paradoxicalqualitythatChristian symbolssharewithallsymbols.Inthemass,priestandGodaresymbolicallywoman(althoughtheyareotherthingsaswell)womanasfoodpreparer,womanas food. MedievalworshipersknewthatwomenwerebarredfromclericalordersandfromplacesnearthealtarwhereGodwashandledtheyknewthatonejustificationfor suchprohibitionwasthegenderofthehumanbodybornofMary.3 Increasinglyfromthetwelfthtothefifteenthcentury,theysawwomanasquintessentialrecipient, manasquintessentialcelebrant,makerandcontrollerofthebodyofGod.YettheyoccasionallysawtheNewTestamentaccountofthePresentationintheTempleas amomentatwhichMarythevesselthatboreGod'sbodywaspriest.4 Morethanoccasionallytheysawthecelebrantaspregnantwiththehost.Andinthecultof theSacredHeart,theyfrequentlysawGod'sbodyitselflactating,givingbirth,clothingourhumannesswiththespotlesshumannessofGod.Inexactlythatperiodof medievalspiritualitythatscholarshavedismissedas"literal"and"degenerate,"symbolsfloweredintoacomplexitythatliftedthefullpanoramaofhumanexperience towardthedivine.Priestwaskingandcook.Godwasfatherandmother,powerandnurture,swordandbreast.Ifthemalemonopolyofreligiousleadershipand descriptionsofGodasmalemirroredsocialhierarchy,descriptionsofGodasfemaleandthestartlingreversalattheheartof


themassprovidedanalternativetoandacritiqueoftheasymmetrybetweenthesexesintheordinaryworkadayworld. Havingsaidallthis,havewe,however,saidenough?Werethefoodsymbolsofmedievalreligionsimplyreversals?Andwerethey,asreversals,perceivedandusedin similarwaysbywomenandmen?Inparticular,didthemedievalwomenwhoselivesIchronicleherefindtheirmostprofoundselfexpressionandtheirmostsuccessful accesstoGodthroughelevationbyreversedimagesintomaleroles,freedoms,andcapacities?Theanswerisclearlyno.Howeverunexpectedandprofoundthe reversalattheheartofthemass,thatreversaldoesnotexpressthedeepestselfperceptionofthewomenwhosevisionsandwordsformtheheartofthisbook.If HildegardofBingen,Hadewijch,MechtildofMagdeburg,andthetwoItalianCatherinessoaredfarabovethehumilitysuggestedbytheirconventionalreferencesto themselvesas"poorlittlewomen,""unlettered"and"soft,"itwasnotbecausetheyclaimedmalepowerandauthorityorfoundtheirdeepestreleaseinasenseof receivingselfwaitedonbypriestascook,HolySpiritaswaiter,orGodasmother.ItwasbecausetheyknewGodactedthroughthelowly.Women'ssymbolsdidnot reversesocialfact,theyenhancedit.ThusHadewijchcouldconceiveofherignorantselfaswrenchingsoulsoutofhellCatherineofGenoacouldclaimpowerthrough sufferingwhenshespokeofher''Me"as"God"MargaretPorete(burnedatthestakeforherconfidenceintheannihilationofsoulsindivinity)couldclaim"I becauseIamlowlyamtheexemplarofsalvation."Women'ssymbolsexpressedthefactthatwomanaswhatsheissoft,unwise,poor,andhumanislovedand savedbyGod. Inordertounderstandtheimportofthisobservation,somemethodologicalandtheoreticalbackgroundisnecessary. TheMeaningofSymbolicReversal Anthropologists,whohaveprovidedtwentiethcenturyhistorianswithimportanttoolsforunderstandinghowsymbols"mean,"havesuggestedthatinritualandin narrative,reversalofsymbolsoftenmarkscrucialmomentsorturningpoints.Theseanthropologistshavetended


toseesuchsymbolicreversalsasprovidinga"liminality"amomentofescapefromroleandstatus,acrossingofboundariesormarginsintoanoppositeroleor perhapsintorolelessnessthatultimatelyreinforcesnormalsocialstructures.5 Ontheotherhand,historianssuchasNatalieDavishavefrequentlyseenarevolutionary potentialoratleastapowerfulsocialcritiqueinsuchsymbolicreversals.6 TheanalysisofmedievalsymbolsIhavegivenabovesupports,tosomeextent,bothsuchinterpretations.Medievalwomenwhosawthemselvesinvisionsas distributorsofthechalice,aspreachers,orashearersofconfessionwereclearlycarryingoutsymbolicinversions,asweremedievallaypeoplewhosevisionsclaimed thecup,thebloodofChrist,astheirown.7 Andsuchinversionswere,asthestoryofLidwinaofSchiedamandthemiraculoushostsuggests,botheffectiverebellions againstclericalcontrolandescapevalves,sotospeak,thatbyprovidingameansofbypassingauthorityatmomentsofcrisisactuallyreinforcedthenormaldistribution ofauthorityatnoncrisismoments.Thuswomen'suseofsymbolicreversalscanbeseenasadefianceofmaleauthority.Buttheprevalenceofsuchreversalsin medievalreligioncanalsobeseenasformingacontextwithinwhichconventionalasymmetriesbetweenmenandwomen,clergyandlaity,wereundergirdedand reinforced. Suchinterpretationsofsymbolarehelpfulinreadingmedievalexperience.ButIwishtoquestionthemonadeeperlevel,formystudyoffoodandfleshassymbolin latermedievalspiritualwritingandpracticesuggeststhatsymbolsasdichotomies,andthereforesymbolicreversals,arelessimportantinwomen'sspiritualitythanin men's. Letmebeginwithaclarification.Thenotionofrenunciationoftheworldi.e.,followingthenakedandsufferingChristbyrenouncingstatus,power,personalcomfort, andfamilywasattheheartoflatemedievalChristianity.Increasingly,asmanyhistorianshavenoticed,suchrenunciationwaspracticedwithintheworld.Friars, tertiaries,andevenlaypeoplerejectedthewealthandstatustheirfamiliesmighthaveprovidedtheypracticed,sometimesevenwithinmarriages,notonlysexual continencebutalsoastudiedignoringofthespecialdemandsoffamilyloveandloyalty.Latemedievalwomen,likemen,sawacertainrupturewithordinaryworldly lifeasamarkofreligiouscommitment.ThemiraculousabundanceoftearsgiventoMargeryKempe,herwhiteclothes,andherhardwoncontinencewerealay equivalentofthevows,veils,andconventwallsthatsetnunsapartfromsociety.Inarguingthatmen


andwomenthoughtdifferentlyaboutalifeofreligiouscommitment,andespeciallythatwomenrepresentedthereligiouslyinspiredsoulinmetaphorsthatsuggesta profoundcontinuitybetweenwomen'sbiologicalandculturalroleintheworldandwomen'sspiritualvocations,Iamnotignoringthefactthatforwomen,asformen, somedeparturefromordinarysocialroleswasnecessarytomakeareligiouslifepossible.ChristinaofMarkyateandIdaofLouvain,likeFrancisofAssisi,hadto escapefromtheordinaryexpectationstheworldheldforrichmerchants'children.ThenunswhomHildegardofBingendressedasbrides,8 thevirginsoulsJohn GersondescribedaspregnantwithChrist,9 wereofcourseabletodevotetheirattentiontovenerationoftheeucharistandprayersforthoseinpurgatorybecausethey eitherneverborechildrenandcookedforhusbandsorwereatlastabletoescapefromdoingso.Thequestionthatconcernsmehereisnotthepracticalwaysreligious rolesfreedpeopleofbothgendersfromcertainworldlyburdensandpleasuresbuttheparticularsymbolsthatmenandwomenchosetodescribethisfreedom. Ourquestionisthereforetwofold.First,domenandwomenmakethesame,orsimilar,useofsymbolicreversal?Toaskthisistoaskwhethermenandwomenmean thesamethingbymaleandfemale,whethereachsexusesreversedgenderimagery,andwhethereachsexachievesbysuchuseareleasefromordinarycultural expectationswomenacquiringanimageofselfaspublicleader,menacquiringtheselfimageofnurturerandsufferer.Thequestionalsoinvolvesasecondelement: domenandwomenmakeequaluseofdichotomoussymbols?Forreversalispredicatedupondichotomytoreverseorinvertone'simageofselfistomovefromone poletoitsopposite.Yetnotallsymbolsaredichotomous.Symbolsmaymakeuseofandrefertocontradictionsandmutualexclusions,buttheymayalsobe paradoxes(inwhichcontradictionsoccursimultaneously)orsyntheses(inwhichcontradictionsarethemselvesnegatedinfusion).10Ifmenmakegreaterusethan womenofsymbolicinversion,thisfactmayberelatedtoatendencytoconstruemanyaspectsofrealityintermsofeither/or.Itisthusnownecessarytolookatmen's useofimagesaswellaswomen'sinordertoquestiontheprominenceinbothusagesofreversalanddichotomy.Theanalysisofmalewritersinchapter3willbeuseful here,especiallysincethemenconsideredtherearethosewho,intheirsensibilitiesandintheirlives,cameclosesttoafemalespirituality.


Men'sUseofFemaleSymbols WhenwelookatmalewritinginthelaterMiddleAgeswefindthatsymbolicdichotomiesandreversalswereatitsveryheart.Mentendedtousethemale/female dichotomytounderlinemale/femaledifferences(fatherversusmother,teacheranddisciplinarianversusnurturer,toughversussoft,etc.)andtocastigateorromanticize femaleweakness.AsIhavedemonstratedelsewhere,mentendedtoassociateaclearlydelineatedsetofsocialandbiologicalcharacteristicswitheachgender,even whentheywereusinggenderasasymbol,andtheytendedtoseethesesetsofcharacteristicsasopposites.Forexample,GuerricofIgny("The Bridegroom[Christ]...hasbreasts,lestheshouldbelackinganyoneofalldutiesandtitlesoflovingkindness.Heisafatherinvirtueofnaturalcreation...andalsoin virtueoftheauthoritywithwhichheinstructs.Heisamother,too,inthemildnessofhisaffection,andanurse."11AnanonymousFranciscan,describingFrancisand ElizabethofHungaryasparentsofthefriarsminor,wrote:"Hewasthefather...andshewastheirmother.Andheguardedthemlikeafather,shefedthemlikea mother."12Intheirsymbolicuniverse,mentendedtousethemale/femaledichotomynotonlyassymbolofauthority/nurture,spirit/flesh,law/mercy,strong/weak,butin abroadersenseasawayofexpressingthecontrastbetweenGodandsoul,divinityandhumanity,clergyandlaity.13Tomedievalmen,Godwas(ashehasbeento mostofthepiousthroughoutthelongChristiantradition)metaphoricallymalefatherorjudge,bridegroomorfriendandthesoul(partlybecauseofthelinguistic genderofanima)wasfrequentlysymbolizedordescribedasfemale.Moreover,thegenderdichotomieswefindinmen'swritingswerereinforcedbyothergender dichotomiesthatwereimplicitinthewayspeoplelived.Menwerefoodreceivers,womenfoodpreparersandgenerators.Menwerepriestsandwomenlaity.Men wereauthoritativebyofficeorordinationwomen'sreligiouspowerderivedfrominspiration,fromecstaticvisitation. Whateverotherpatternsliebehindthesedichotomies,oneisclear.Ifmaleistofemaleasspiritistoflesh,foodreceivertofoodgenerator,clergytolaity,officeto inspiration,lawtomercy,anddivinetohuman,thenthatwhichissymbolizedbymaleisinsomesenseaproductofculture,cutofffromnatureorbiology.Thus, althoughitmayatfirstappearincoherentorevencontradictorythatthefemaleshouldsymbolize


bothinspirationversusofficeandfleshversusspirit,thereisaconsistentdichotomybehindthesepairs.Thefundamentalcontrastseemstobebetween(a)constructs oflaws,patterns,forms,erectedatsomedistancefrom,ifnotinoppositionto,nature,and(b)amoreinstinctual,internal,biological"humannature."Inthissense,flesh isnaturalandspiritculturaljustaspropheticinspirationisinterior,subjective,natural,whereasclericalauthorityisanexternal,culturalstructureindependentofpersonal moral,experientialqualifications. Structuralistanthropologistshaverecentlytaughtustoseesuchadichotomyasabasiccontrastinhumansymbolsystems.Ihavebeeninfluencedbytheirformulations, aboveallbySherryOrtner's,14butIdonotmeanherewhattheymean.IagreewithOrtner'scriticsthathertheoryisuniversalistinundesirableways,ignoringthe possibilitythatsubgroupsinasociety,especiallywomen,mayholddifferingandevendisagreeingperspectivesonthesymbolicdichotomiesusedbydominantcultural groups.15ThusIamnotheresayingthattheculture/naturedichotomywasanobjectivelytruedichotomybetweenmaleandfemale.NoramIsayingthatmedieval womenespousedsuchadichotomy.Iammerelypointingoutthatthisisthepatternsymbolsfellintoinmalewritingandreligiouspracticebetween1200and1500. Suchasymbolicpatternwas,tomen,profoundlydisturbing.Forthesamemalewriterswhocametoseethechurchastheclergy,toseetheirgenderasthesymbolfor God'sdivinity,toarguethatmale,clericalmediationwasthenecessarybridgebetweenheavenandearth,knewtheypartookoffallenhumanity.TheyknewChristhad preached:"Blessedarethemeek."Theirpietyreflectedtheirambivalence.IncreasinglytheystressednotGod'sauthoritybutJesus'accessibility,notJudgmentDayor Resurrectionbutamanlayingdownhislifeforhisfriends.Theyhadrecoursetovisionarywomenforcomfortandcounselandforthedirectinspirationtheywere afraidtheynolongerreceived.16Andtheyspoke(asadefinitelysubordinatebutnonethelesshighlychargedtheme)ofJesusasmotherandofthemselvesaswomen. Sometimes,incallingthemselveswomen,malewritersusedwomanasatermofopprobrium.HelinandofFroidmontcastigatedhisbrothers:"BeholdGodcompares mentowomen...andnotmerelytowomen,buttomenstruatingwomen!"17ButmorefrequentlytheyusedwomanasasymbolofdependenceonGodbothasa wayofdescribingthemselvesascaredforbyGodandasawayofunderliningtheirownrenun


Itistheywhoarethebrides,thebrothersandthemothersofourLordJesusChrist.ApersonishisbridewhenhisfaithfulsoulisunitedwithJesusChristbytheHolySpiritwe arehisbrotherswhenwedothewillofhisFatherwhoisinheaven[Matt.12:50],andwearemotherstohimwhenwecarryhiminourheartsandbodiesbylovewithapureand sincereconscience,andgivehimbirthbydoinggooddeedswhichenlightenothersbyexample.18

Twooftheseshouldactasmothers,withtheothertwo,ortheotherone,astheirchildren.ThemothersaretoleadthelifeofMarthatheothertwo,thelifeofMaryMagdalen.... Thefriarswhoaremothersmustbecarefultostayawayfromoutsiders....Thefriarswhoaresonsarenottospeaktoanyoneexcepttheirmotherortheircustos[superior].19

Susosawhimselfasamaidenpickingroses,ababynuzzlingitsmother'sbreast.Ruysbroeckwrote:"Man'snatureisthebride[ofChrist]."20 Whenamalewriterdescribedanothermanasawoman(forexample,BonaventurespeakingofFrancisofAssisi)orwhenaman(forexample,RichardRolleorSuso) describedhimselfthatway,hewasusingsymbolicreversal.Manbecamewomanmetaphoricallyorsymbolicallytoexpresshisrenunciationorlossof"male"power, authority,andstatus.Hebecamewoman,asEckhartsaid,inordertoexpresshisfecundity,hisabilitytoconceiveGodwithin.21Suchreversalseemednecessaryina religionatwhoseheartlaycontradictionandIncarnation:Godbecomeman.WhenTaulersoughtasymbolofthesoul'sutterselfabasementbeforeGod,itsutter denudingandemptying,henotonlychosethepoorCanaanitewomanofMatthew15:2128,whoreferredtoherselfaslowerthanadog,healsociteda contemporarywomanwhoreceivedavisioninwhichshewasabandonedbyallintermediariesbetweencreationandCreatorandwhothereforecriedaloudtoGod thatshewouldacceptcondemnationtohellitselfifitwashiswill.22Insuchasermon,"woman"isasymbolandanexamplenotonlyoftheutterlycontemptibleandof theredeemedbutalsoofthegreatreversalattheheartofthegospel:thefactthatitisthecontemptiblewhoareredeemed. ThefoodandfleshimageryIexamineinthisbookis,asIhave


explainedabove,aparticularcaseofsuchsymbolicinversion.Muchaboutthepriest'sroleandaboutthetheologyofimitatioChristiinthelaterMiddleAgesinvolves areversalofculturalassumptionsaboutgender.Ontheonehand,ofcourse,giventhesymbolicpatterns,thepriestwas"male"andthecommunicant"female"the priestwasGodandtherecipienthuman.Asiswellknown,Bonaventurearguedthatwomencouldnotbepriestsbecausethepriesthood,theauthorityofGod,hadto besymbolizedbyamale.23But,inanothersense,asIhavedemonstrated,God'sdyingbodywasfemaleabirthingandlactatingmotherandthepriestwasfemale too.HewasMary,forinhishands,asinherwomb,Christwasincarnate24hewasfoodprepareranddistributortorecipientswhoate.Inthecentralmomentofthe massthemalecelebrantwaited,readytocareforanddistributeaheavenlyfood,avulnerablebody,providedbyafathermotherGodforthebenefitofhuman children. Iconographicevidencetoosuggeststhatthemassimpliedgenderreversal.PicturesofChristdistributingfoodandwashingthefeetofguestsattheLastSupper outnumbervisualrepresentationsofChristaskingorpriestinthelaterMiddleAges.InsuchpaintingsChristisdepictedinoneofsociety'smostadmiredfemaleroles: theroleoffoodpreparerandservant.AfifteenthcenturyretablefromUlm(plates1and2)showsjustsuchareversal.Ontheouterwings(whenclosed),wefind Christasservantandfooddistributor,testingJudaswiththewafer(asmanymysticalwomentestedfalsepriests).Whenopened,theretabledisplaystheeucharist representedbothasababyinthechaliceandasflourgroundthroughamill.Maryandthefourevangelistspourthegrainintothefunnel(i.e.,celebrate).Apostlesturn thecrank.Itistheprelatesofthechurch,garbedinalltheirsplendor,whowaitquietlybelowasrecipients. Thusmalewriters,artists,worshipers,andpriestsinthelaterMiddleAgesmadeuseofsharpsymbolicdichotomies,andmanyoftheirmostprofoundandmoving imagesweresymbolicreversals.Moreover,men'sownlifestoriestendedtobestoriesofcrisisandconversion.Theyenactedthereversalstheyusedassymbols, strippingthemselvesnaked(asdidFrancisofAssisibeforehisfather),puttingontheclothingofachild,abeggar,orawoman(asRichardRolledidinbecominga hermit),suddenlyanddramaticallyrenouncingwealth,influence,andwifetotakeuppovertyandchastity(asdidJohnColombini).25AsIpointedoutinchapter1, manymoremedievalmenthanwomenunderwentabrupt


changesoflifestyleduringadolescence.Havinggreateraccesstopowerandfamilywealth,menwereabletoabandonthemmoreabruptlyandflamboyantly,and medievalboysseemtohavebeenolderonaveragethangirlswhenstrickenbytheimpulsetoabandontheworld. Manyexplanationscanbesuggestedforthefactthatmentendtouseimages,andlivelives,ofcontrast,opposition,andreversal.Structuralistanthropologistshave sometimesarguedthatdichotomousimagesofhard/soft,male/female,law/mercy,reason/unreasontendtoappearincultureswithstronglypatrilinealinheritance patterns,becausethefemale(althoughnecessaryforprocreation)tendsinfacttobeadisruptiveforceinsuchsocieties,aforceoutsidelawandstructure.26Such explanation,thoughplausible,appearstoreflectnoneofthesubtletyoflatemedievalimagery,anditdoesnotexplainreversal,althoughitmayexplaindichotomy. Anotherwayofrelatingimagerytosocialstructureseemsmoreconvincing.ThisissimplytonotethatmostgradationsofstatusinthelaterMiddleAgeswere gradationsofmalestatus.Thegrowingconsciousnessofthemultiplicityofstatusesandrolesthatcharacterizestwelfthandthirteenthcenturywritingispredominantly agrowingawarenessofavarietyofmaleroles.AsGeorgesDubyhaspointedout,womenwereoutsidethe"threeorders"ofmedievalsociety:thosewhopray,those whofight,andthosewhotillthesoil.27Eveninthechurch,althoughnunswere"clergy"inonesense(thatis,theywere"regular''theytookvows),inanothersenseall womenwerelaitythatis,outsideorders.Women,asIsaidinchapter1,oftenshiedawaythemselvesfromhighlystructuredinstitutionalforms,avoidingrulesand vowsandmalecharacterizationofwomenwasusuallyaccordingtotheirmaritalorsexualstatuswidow,virgin,marriedwomanratherthantheirinstitutional affiliation.Thuswomenwerenot"on"aladderofrolesandstatusesinthesamesensethatmenwere.28Itishardlysurprisingthereforethatcompleximageryofrole reversal,ofinversionofpowerandstatusoffoolbecomeking,boybecomepope,manbecomewomanorwomanbecomemanappealedmoretomen,forwhom theprecisegradationsofsocietywereselfdefinitionsthatmightbeardownwithapsychologicalweightthatdemandedperiodicrelease. Theremayalsobepsychologicalandtheologicalreasonsformen'spreferencefordichotomyandreversal.Asseveraltheoristshaverecentlypointedout,the maturationofaboy(inWesternculture,medievalandmodern)requiresafundamentalbreakinselfimage:aboymustlearn


thathecannotbethemotherwhoishisfirstprojectionofself,hisfirstlove,hisfirstmodel.29Aboy'sgrowingupisthereforealearningtobeotherthanfemalea learningbothtoreversehisowndesiresandselfdefinitionandtoseethefemaleas"other."Smallwonderthereforethatreversalsandconversionsbecomecentralin malewaysofthinkingaboutandsymbolizingspiritualgrowth. Moreover,thenatureofthesymbolicdichotomiesmengeneratedcontainedwithinitselfpressureforreversal.NotonlydidChristiantheologystatethatthehumble,the lowly,"thelast,"wereeventuallytocomefirst,thusdictatingthatmenmustfindreversedsymbolstospeakofprogresstowardGod(forexample,thesoulaswoman, child,fool).30Themalesymbolsthemselves,inreferringtothatwhichiscutofffromnature,thatwhichisculturalconstruct,forcedrecognitionoftheiropposites,for menknewthemselvestobenotmerely"divine,""clerical,''"spirit,"and"authority."Becausethesymbolsassociated"themale"withculture,with"morethan"and"other than"humannature,thesesymbolsimpliedthatinordertobehumannaturethemalemusttakeoppositestohimselfinsymbol.Theparticulargroupofcultural activities,responsibilities,andsymbolsassociatedwiththemalebymenitselfimpliedcontrastandreversal.Thesetofactivities,responsibilities,andsymbols associatedwiththefemaledidnot,inthesameway,implyitsobverse.Thatwhichthefemalesymbolizednurture,body,laity,humanity,innerinspirationdidnot requireanythingelseforexample,power,spirit,office,divinityinordertoconjureupperson.Nordiditimplythatreversalwasnecessaryinorderforperson,for thatwhichis,tobegivenreligiousmeaning.Womanalreadywasthatwhichis,inChristianity,givenreligiousmeaning.Forwomanwas,infactaswellassymbolically, human. Thustheverysetofdichotomoussymbolsthatclusteredaroundmale/femaleintheWesterntraditionsuggestedthatmenpowerful,clerical,authoritative,rational, "divine"menneededtobecomeweakandhuman,yetspiritual,"women"inordertoproceedtowardGod.AndmalewritersinthelaterMiddleAgesusedmuch suchreversedimageryforself.Moreover,theyoftenassumedthatreversedimageryanddichotomoussymbolswereappropriatewaysofreflectingonfemale experience.Malewritersurgedwomento"becomemale"or"virile"intheirrisetoGod.31Malehagiographersandchroniclerswerefascinatedbystoriesofwomen's crossdressinginordertoenterreligioushousesprobablyto


thepointoffabricatingsuchincidents.32Malewritersdevotedmuchattentiontofemaleweakness,bothbyunderliningwomen'ssexualtemptationsandbyexpatiating upontheinappropriatenessofasceticismtowomen'ssoft,tender,andinconstantbodies.Susowrotetoaspiritualdaughter:"YouareweakerthanEveinparadise." ThecompileroftheLifeofIdaofLouvainpraisedherbysayingshewas"notawomanorlazy,butlikeamaninconstancy."33 Thereismuchevidencethatreligiousmeninthethirteenth,fourteenth,andfifteenthcenturieswerefascinatedbywomenbothbythefemalevisionarieswhobecame, throughtheirverylowliness,themouthpiecesofGodonhighandbytheordinarymothers,housewives,laundresses,andmaidservantswhoweresignsofthedepthsto whichJesusstoopedinredeeminghumankind.AsIsuggestedinchapter3above,malemysticssuchasBernard,Francis,Rolle,Suso,Tauler,Eckhart,andGerson advisedwomen,admiredwomen,andabhorredwomen.Theyadoptedtheimageofwomanwomanwhowasmorehumbleandmorefleshlythantheytospeakof theirownapproachtoGod.Indescribingthemselvesasnursingmothersorsucklingbabes,thesemenweredescribingtheselftheybecameinconversionasthe oppositeofadultandmale.Inspeakingoftheirconversionsastheespousingofnakedness,poverty,suffering,andweakness,theywere,evenmoregenerally, renouncingandreversingtheprerogativesofwealth,strength,andpublicpowerthattheirworldconnectedtoadultmalestatus.Ifmalewriterswerefondofseeing themselvesasbrides,mothers,andchildren,suchreversedimageswereonlyonesetofmetaphorsinasymbolicworldinwhichthemanhadtoseehisbasicreligious commitmentasflightfrompowerandgloryforJesushimselfhadfledpower,nomatterhowmuchkingsandprelatesmightwielditinhisname. Women'sSymbolsAsContinuity Femalewriters,expressingtheirreligiousdesiresandfearsinthesamesymbolictraditionasmenandworshipinginthesamerituals,alsoinsomewaysusedand reflectedtheclustersofdichotomiesIhavejustdescribed.Someofwomen'simagesoffoodandfleshwerenotonlyexpressionsofsuchdichotomiesbutprofound reversalsaswell.Inbotheucharistandmysticalunion,womeninvertedwhatthecultureassumed


themtobe.JustasChrist'sdeathonthecrosswasasymbolicreversalforhebecame,notmale(kingorpriestorrecipientofnurture),butfemale(alactatingand birthingmother,nurturerofothers)sothefemalecommunicantexperiencedgenderreversal.Shebecamenotnurturerandfeederofothersbutreceiver.Inthemass, therolesofclergyandlaityreversedordinarysocialroles.Thecelebrantbecamefoodpreparer,thegeneratoroffood,thepregnantmotheroftheincarnateGodthe womanrecipientfeasted,witheyesandpalate,onafoodshedidnotprepareorexude.Woman'sjubilant,visioninducing,intoxicatedeatingofGodwastheopposite oftheordinaryfemaleactsoffoodpreparationandofbearingandnursingchildren.34 Yet,onadeeperlevel,women'seatingofGodwasnotareversalatall.Forinthemassandinmysticalecstasywomenbecameafullerversionofthefoodandflesh theywereassumedbytheirculturetobe.InunionwiththedyingChrist,womanbecameafullyfleshlyandfeedingselfatonewiththegenerativesufferingofGod. Woman'seating,fasting,andfeedingothersweresynonymousacts,becauseinallthreethewoman,bysuffering,fusedwithacosmicsufferingthatreallyredeemedthe world.Andthesethreesynonymousactsandsymbolswerenotfinallysymbolicreversalsbut,rather,atransfiguringandbecomingofwhatthefemalesymbolized:the fleshly,thenurturing,thesuffering,thehuman. Women'sfoodimagesandfoodpracticesthusreflectalargerpattern.Forwomen'swayofusingsymbolsandofbeingreligiouswasdifferentfrommen's.Itappears asakindofsubtextwithinalargertext,dominatedbydichotomoussymbolsandsymbolicinversions,anditisalwaysawareofmale/femaleoppositionsandofimages ofreversal.Butwomen'ssenseofreligiousselfseemsmorecontinuouswiththeirsenseofsocialandbiologicalselfwomen'simagesaremostprofoundlydeepenings, notinversions,ofwhat"woman"iswomen'ssymbolsexpresscontradictionandoppositionlessthansynthesisandparadox.35 Thisqualityofwomen'sreligiouswritingshasbeenconsistentlynotedbythegreatestscholarswhohavestudiedthem,althoughithasnotbeenplacedinatheoretical framework.BaronvonHgel,commentingonCatherineofGenoa'suseofsimultaneityofoppositesorparadoxes,says,"Foritwastheelementofsimultaneity,of organicinterpenetrationoftheGodlikeTotumSimul,whichchieflyimpressedherinthesedeepestmoments."36BrantPelphrey,inhisexpositionofthetheologyof Julian


ofNorwich,suggeststhatJuliansawsinasanecessary(ifpainful)partofbeinghumanandthathertheoryofunionwithGoddidnotinvolve"stages"thesoul"passed beyond"but,rather,acontinuityofself,abecomingfullyhumanwithJesus.37PeterDronke,writingonMargaretPoreteandthefemalehereticsofMontaillou, commentsbothontheoriginalityofwomen'sapproachtoevilandonthelackof"apriorism"inwomen'swritings,pointingouttheiravoidanceofrulesofeither/orand theirsubstitutionofsingular,existentiallyappropriatesolutions.38 Allthisisnottosaythatmalemysticsneveruseparadox(onethinksofNicholasofCusa)orthatmaletheologiansneverpushsuchparadoxicalsynthesistothepoint ofreconcilingheavenandhell(onethinksofOrigen)orthatmalepenitentsneversubstitutecontinuityofselfinJesusforpassageupthehierarchyofthecosmostoGod (onethinksofFrancis).39ButtheexplosionofparadoxinaHadewijch,aMargaretPorete,oraCatherineofGenoa,theagonizedrejectionoftheexistenceofhellina MechtildofMagdeburgoraJulianofNorwich,thedeliciousgrovelinginthehumiliationsofbeinghumanthatcharacterizesvirtuallyeveryreligiouswomanofthelater MiddleAgestheseformaconsistentpatternthatisfoundonlyinfrequentlyinreligiousmen.Andbehindthepatternliesaconfidencethatallisoneallis,asJulian said,ahazelnutheldinthepalmofGod'shandbecauseitisfinallythehumanitythatwemostdespicablyarethatisredeemed.40Itisour"Me"thatbecomesGod.41 Toarguethisistoarguethatreligiouswomensawthemselvesashumanbecausetheywerewomen,asredeemablebecausetheywerewomen.Itmayappearavery oddargumentinlightofcertainrecentfeministclaims.JoAnnMcNamara,RosemaryRuether,MarieDelcourt,andMarinaWarnerhave,forexample,arguedthat becausemalewasinWesternculturesuperiortofemale,womanhadtotakeonsymbolicmaleness(or,attheveryleast,abandonmentoffemaleness)inorderto signifyspiritualadvance.42Theycitenotonlyafewscatteredreferencesinthepatristicperiodtowomenseeingtheircourageas"male"butalsothemany (predominantlypatristic)storiesoftransvestitesaintsofwomenmasqueradingasmen,andsometimesevengrowingbeards,inordertoescapemarriage(orrape)or toentermonasteries.TheyalsociteJoanofArc.Suchworktendstosuggestthatgenderreversalwasapowerfulsymboltowomen.Moreover,recentresearch demonstratesthatcrossdressingbymaleswasextremelyrareintheMiddleAges(and


sometimespersecutedassexualperversion).43AlthoughhistorianswhofocusonJoanofArchavenottendedtofindparallelstohercrossdressinginthelater MiddleAges(thusweakeningtheircase),itisinfacttruethatlatemedievalwomendidadoptmaledress,especiallyinordertorunawayfromtheirfamiliesortogoon pilgrimages.44Why,then,doIsuggestthatreversals,especiallygenderreversals,werenotcrucialinwomen'sreligiosity? Myargumentisbasicallythatcrossdressingwasforwomenprimarilyapracticaldevice,whereastomenitwasprimarilyareligioussymbol.Womensometimesput onmaleclothesinordertoescapetheirfamilies,toavoidthedangersofrapeandpillage,ortotakeonmalerolessuchassoldier,pilgrim,orhermit.But,oncefreed fromtheworldbyconventwallsorhermitage,bytertiarystatus,bythepracticeofcontinence,bymysticalinspiration,orevenbymiraculousinedia,womenspokeof theirlivesinfemaleimages.Theysawthemselves,metaphoricallyspeaking,notaswarriorsforChristbutasbrides,aspregnantvirgins,ashousewives,asmothersof God.Perhapsexactlybecausecrossdressingwasaradicalyetpracticalsocialstepforwomen,itwasnotfinallytheirmostpowerfulsymbolofself.Formen,onthe contrary,whodidnotcrossdressasapracticalstepandcouldhavegainednothingsociallybyitexceptopprobrium,genderreversalwasahighlycharged,even frighteningsymbol.45 Inanycase,whateverthereasonforthefascinationfeltbymedievalmenwithfemalecrossdressingafascinationapparentlysharedbymodernhistoriansofboth genderstheevidenceconcerningimageryisclear.Women'sbasicimagesofreligiousselfwerenotinvertedimages,notmaleimages.Wherewomenusedgenderas imagetheyusuallyspokeofthemselvesasfemaletoamaleGodorasandrogynous.MechtildofMagdeburg,HildegardofBingen,CatherineofSiena,andMargery Kempereferredtothemselvesaspoorwomen,unletteredandweak.Hildegardactuallydressedhernunsasbrideswhentheywenttoreceivecommunion.Margery gloriedinrelatingtoGodaswifeandmother.46Catherinereportedthatshehadwanted,asachild,toimitateoneoftheearlytransvestitesaints,butasanadultshe hearddirectlyfromChristinavisionthatsuchreversalwasnotnecessary:Godpreferredhertoteachandinspireothersasalowlywoman.47 AsIexplainedinchapter9,women'suseoffemaleimagesdidnotexpressanyincapacityforgodlinessorforapproachtoGod.Indeed,


PeterDronkehaspointedoutthatthetoposofthe"poorlittlewoman"wassometimesanironicclaimtodivineinspiration,tobeingthevesselormouthpiecechosenby God.48Andsomewomenwriterspassedbeyondevensuchirony.JulianofNorwich,forexample,deletedherreferencetofemaleincapacitywhensheexpandedher Showingsintotheirlonger,moretheologicallyaudaciousandsophisticatedversion.49Moreover,women'simagesforselfwerefrequentlyandrogynous,forthey frequentlyincludedqualitiesthelargerculturestereotypedasmale(suchasdisciplineorjudgment)intheirunderstandingof"motherly"or"womanly."Gertrudeof Helfta,Hadewijch,CatherineofSiena,andJulianofNorwichallmixgenderimagesandpersonalitycharacteristics(suchastenderness,severity,love,discipline)so thoroughlyindescribingboththesoulandGodthatonecanonlyintermittentlyseeintheirwritingsthecommonassociationofsoulwithfemaleandGodwithmale. Finally,wherewomen'sownsymbolsdidassociatewithselfactivitiesorcharacteristicsthatthebroaderculturesawasfemale(forexample,lactationandfood preparation,weaknessandfleshliness),womentendedtobroadenthesesymbolstorefertoallpeopleratherthantounderlinetheoppositionofmale/female.Aswe sawabove,women'ssenseofthemselvesassymbolizingthe"humanityofChrist"carriedtheconcepthumanbeyondanymale/femaledichotomy.50 HildegardofBingen,forexample,didwritethatmaleandfemalearedifferentinsocial,biological,andreligiousroles(althoughevenhereshestressedcomplementarity morethandidthemaletheologiansofherday).Buthermostprofounduseofwomanassymboldrewnocontrasttomenatall."Woman"waswhatmodernwriters sometimescall"mankind."InHildegard'svisionofsalvation,the"imageofwoman"thatis,humanitystandsbelowthecrossandreceivesChrist'sblood(seeplate 12).Twocenturieslater,CatherineofSienadidcriticizewomenasweak.Butshesaid,ofherselfandotherwomen,thattheywereallchildren,drawingthemilkof sufferingfromthebreastofChrist'shumanity.AndbysufferingshemeantChrist'ssufferingandtheirown.Thusthesoulwasasucklingchildwhobecameonewitha motherwhosefeedingwassuffering,andthatsufferingsavedtheworld.Thechildwasthemothertheeatingwasfeedingothersthesufferingwasfertility.Such imagesgobeyonddichotomies,yettheyarisefromandexpressordinaryfemaleexperiences.Women'simages,althoughinformedandmadepos


siblebythesymbolicoppositionsofthedominanttheologicaltradition,arethemselvesneitherdichotomiesnorinversions. Justasmen'slivesshowmuchactualconversionandreversal,parallelingthestronglydichotomousnatureoftheirsymbols,sowomen'sactuallifestoriesshowless reversal,parallelingtheiruseofsymbolsofcontinuity.AsInotedinchapter1,WeinsteinandBellhavedemonstratedthatthepatternofwomen'slivesshowsfewer rupturesinstead,thereisgraduallydawningvocation,voicedearlierandconsolidatedfarmoreslowly.51Thisdifferencedoesnotappeartobeentirelyamatterof women'sgreaterpowerlessness,oftheextremedifficultytheysometimesfacedinrejectingsuitors,husbands,children,orparentaldictatesifavocationtochastityor deprivationcametotheminadolescenceoradulthood.Surveyofalargenumberofmedievalsaints'livessuggeststhatgirls(unlikeboys)oftenknewbeforetheageof eightthattheywishedtoavoidmarriage.Tosuchwomen,virginityandhumbleserviceoffamilymembersorofsisternunswasasmuchacontinuationofchildhoodas itwasanescapefromtheadultstatus"marriedwoman." ThesamesortofexplanationIsuggestedformaleuseofsymbolsmayexplainfemaleusagesaswell.Girls'morecontinuousselfdevelopment,involvingno fundamentalneedtodevelopaconceptof"other,"mayhelpexplainwomen'savoidanceofdichotomousimageryandtheirtendencytoelaborateassymbolsaspectsof lifeclosertoordinaryexperience(eating,suffering,lactating).Recentfeministpsychologicaltheoryhassuggestedthattheprofoundlyasymmetricalpatternsofchild rearinginWesternculturemayinfluencefemalechildrentowardalessacutesenseofbinaryoppositionsandof"otherness."52Moreover,women'splaceinsomesense outsidetheordines(statuses)oflatemedievalEuropemaysuggestwhyimagesofstatusreversalseemedtothemlesspertinentandinteresting.Structuralist anthropologistshaverecentlyshownthewaysdichotomoussymbolsespeciallythefundamentaldichotomyculture/naturetendtoexpressandsupportthepower ofthoseidentifiedwith"culture."53 Whateverexplanationoneproposes,itisclearthatwomen'swayofusingandlivingsymbolswasdifferentfrommen's.Thedifferencelaynotmerelyinwhatsymbols werechosenbutalsoinhowsymbolsrelatedtoself.Wheremenstressedmale/femalecontrastsandusedimageryofreversaltoexpresstheirdependenceonGod, womenexpressedtheir


dependenceonGodinimageryatleastpartlydrawnfromtheirowngenderandavoidedsymbolicreversals.Althoughmenwroteaboutthenatureofwoman,women tendedtowrite,notaboutgender(maleversusfemale),butaboutthesoulorabouthumanity.Thereisthusasenseinwhichwomen'suseofmetaphorsandimages tookashapeofitsown,obliquetoamaletraditionofspiritualwritinginwhichthemale/femaledichotomywasasymbolformanyotheroppositions.Andyetitisclear thatwomen'ssenseofselfwasformedwithinandinfluencedbythesymbolicdichotomiesofthedominanttheologicaltradition.ItwasfromageoldnotionsthatGod, mind,andpoweraremalewhereassoul,flesh,andweaknessarefemalethatwomendrewinspirationforaspiritualityinwhichtheirownsufferinghumanityhadcosmic significance. Conclusion Inexploringthereligioussignificanceoffoodtomedievalwomen,Ihavetouchedupontwolargerissues:thenatureofmedievalasceticism,andthesignificanceof genderinmedievalreligion.Althoughthisbookdoesnomorethanraisetheseissuesandsuggestthedirectionnewinterpretationofthemmighttake,itiswellto underlinetheminclosing.For,ifIamrightonthesetwoissues,wemustrevisesomeofthereceivedwisdomabouttheMiddleAges. Ihavesuggestedthroughoutthediscussioninchapters6,7,8,and9thatmedievalasceticismshouldnotbeunderstoodasrootedindualism,inaradicalsenseofspirit opposedtoorentrappedbybody.Theextravagantpenitentialpracticesofthethirteenthtothefifteenthcentury,thecultivationofpainandpatience,theliteralismof imitatiocrucisare,Ihaveargued,notprimarilyanattempttoescapefrombody.Theyarenottheproductsofanepistemologyorpsychologyortheologythatsees soulstrugglingagainstitsopposite,matter.Thereforetheyarenotashistorianshaveoftensuggestedaworlddenying,selfhating,decadentresponseofasociety wrackedbyplague,famine,heresy,war,andecclesiasticalcorruption.Rather,latemedievalasceticismwasanefforttoplumbandtorealizeallthepossibilitiesofthe flesh.ItwasaprofoundexpressionofthedoctrineoftheIncarnation:thedoctrinethatChrist,bybecominghuman,savesallthatthehumanbeingis.Itaroseina religiousworldwhosecentralritualwasthecomingofGodintofoodas


maceratedflesh,anditwascompatiblewith,notcontradictoryto,newphilosophicalnotionsthatlocatedthenatureofthingsnotintheirabstractdefinitionsbutintheir individuatingmatterorparticularity.ThusFrancisofAssisitellinghisdisciplesthatbearingsare"perfecthappiness,"BeatriceofOrnacieuxdrivingnailsthroughher palms,DorothyofMontauandLukardisofOberweimarwrenchingtheirbodiesintobizarrepantomimesofthemomentofCrucifixion,andSerafinaofSanGimignano, reveredbecauseshewasparalyzed,weretotheirowncontemporariesnotdepressingorhorrifyingbutglorious.Theywerenotrebellingagainstortorturingtheirflesh outofguiltoveritscapabilitiessomuchasusingthepossibilitiesofitsfullsensualandaffectiverangetosoareverclosertoGod.54 JustasIhavesuggestedinthelastfivechaptersthatmedievalasceticismwasnotprimarilydualism,soIhavearguedthatmedievalwomenarenotbestunderstoodas creaturesconstrainedandimpelledbysociety'snotionsofthefemaleasinferior.Women'spietywasnot,fundamentally,internalizeddualismormisogyny.Although misogynistwritingdidcertainlysometimesequatewomanwithsexualtemptationandunderlinethemale/femalecontrastasadichotomyofsuperior/inferior, strong/weak,spirit/flesh,Iconsideritmistakentotaketheideasofmaletheologiansandbiographersaboutwomenasthenotionsofwomenaboutthemselves.Women andmenexisted,ofcourse,inthesameuniverseofsymbolsanddoctrineandweretaughtbythesamescriptures,thesamepreaching.Womenwereclearlyawareof theirsupposedinferioritysomecommenteduponitorevenappropriateditasawaytoGod.Ihaveshownabovehowsomewomencastigatedthemselvesfortheir sexualimpulses.Butfromamongthesymbolsanddoctrinesavailabletothem,womenandmenchosedifferentsymbolsmenrenouncingwealthandpower,women renouncingfood.Theyusedsymbolsindifferentways.Men,whoweredominant,usedsymbols(amongthemthemale/femaledichotomy)torenouncetheir dominance.Reversalsandoppositionswereattheheartofhowsymbolsworkedformen.Theimageofwomanascontrastedtothatofmanwas,inthelaterMiddle Ages,atopicofprimaryinteresttomen.Towomen,however,male/femalecontrastswereapparentlyoflittleinterestsymbolsofselfwereingeneraltakenfrom biologicalorsocialexperienceandexpressednotsomuchreversalorrenunciationofworldlyadvantageasthedeepeningofordinaryhumanexperiencethatcame whenGodimpingeduponit.


Intheirsymbolswomenexpandedthesuffering,givingselftheywereascribedbytheirculture,becomingevermorewonderfullyandhorriblythebodyonthecross. Theybecamethatbodynotasflightfrombutascontinuationofself.AndbecausethatbodywasalsoGod,theycouldsumuptheirloveofGodinparadox:"Hellisthe highestnameofLove,"asHadewijchsaid,orasMargaretPoreteputit,"Iamthesalvationitselfofeverycreature....ForIamthesumofallevils." Inthefinalanalysis,itiswrongtoseemedievalwomenasinternalizingtheideaoftheirgenderasinferior,becausecontrastsofmale/female,superior/inferior,spirit/flesh seem,ascontrasts,tohavebeenlessimportanttowomenthantomen.Ifitisinaccuratetoseelatemedievalasceticismasselfhatingbecauseitiswrongtothinkthat medievalpeoplesawfleshprimarilyasopposedtospirit,itisdoublyinaccuratetoseefemaleasceticismasbasedindualism,becausealldualitieswerelessimportant towomen.Womensawthemselvesnotasfleshopposedtospirit,femaleopposedtomale,nurtureopposedtoauthoritytheysawthemselvesashumanbeingsfully spiritandfullyflesh.AndtheysawallhumanityascreatedinGod'simage,ascapableofimitatioChristithroughbodyaswellassoul.Thustheygloriedinthepain, theexudings,thesomaticdistortionsthatmadetheirbodiesparalleltotheconsecratedwaferonthealtarandthemanonthecross.Intheblindinglightoftheultimate dichotomybetweenGodandhumanity,allotherdichotomiesfaded.Menandwomenmightagreethatfemalefleshwasmorefleshlythanmaleflesh,butsuch agreementledbothsexestoseethemselvesasinsomesensefemalehuman.Foritwashumanbeingsashuman(notassymbolofthedivine)whomChristsavedin theIncarnationitwasbodyasflesh(notasspirit)thatGodbecamemostgraphicallyonthealtaritwashumansuffering(nothumanpower)thatChristtookonto redeemtheworld.ReligiouswomeninthelaterMiddleAgessawintheirownfemalebodiesnotonlyasymbolofthehumannessofbothgendersbutalsoasymbol ofandameansofapproachtothehumanityofGod.


Itmaybethatvice,depravityandcrimearenearlyalways...attemptstoeatbeauty,toeatwhatweshouldonlylookat.Evebeganit.Ifshecausedhumanitytobelostbyeatingthe fruit,theoppositeattitude,lookingatthefruitwithouteatingit,shouldbewhatisrequiredtosaveit. IfIgrowthinfromlabourinthefields,myfleshreallybecomeswheat.IfthatwheatisusedforthehostitbecomesChrist'sflesh.Anyonewholabourswiththisintentionshould becomeasaint. SIMONEWEIL(D.1943)1 Ifculturalemphasisfollowedthephysiologicalemphasis,girls'[puberty]ceremonieswouldbemoremarkedthanboys'butitisnotso.Theceremoniesemphasizeasocialfact:the adultprerogativesofmenaremorefarreachingineveryculturethanwomen's,andconsequently...itismorecommonforsocietiestotakenoteofthisperiodinboysthaningirls. RUTHBENEDICT(1934), QUOTEDBYACONTEMPORARYANORECTIC, SHEILAMcLEOD(1981)2

TheresaNeumannofKonnersreuth,aBavarianpeasantwomanwhodiedin1962,supposedlydisplayedbothstigmataandmiraculousabstinence.LikeLidwinaof Schiedam,shewasobservedbyacommissionwhichsolemnlyauthenticatedherinediaastotalandextended.3 SimoneWeil,aphilosopherandmysticwhodiedin 1943,undertookfatalselfstarvationinanefforttoidentifywiththepoorandoppressedoftheworld.LikeCatherineofGenoa,Weilspokeofgluttonyasametaphor forsinandusedthenotionofselfbecomingfoodasanimageforpersonalsufferingthatfuseswiththeredemptivesufferingofChrist.Westillfind,inthetwentieth century,examplesofthefemalepietythatemergedinthirteenthandfourteenthcenturyEurope. Yetforthemostpart,women'sconcernwithfoodinourowncentury


occursinadifferentcontext.WomencultivatenotclosenesstoGodbutphysicalattractivenessbyfoodabstinence,whichtheycalldieting.Therecentincreaseofself starvationamongwhite,privileged,adolescentfemalesisnotcalledfastingorasceticismbythemedicalprofessionintowhosepurviewitcomes,butanorexia nervosa.Thenotionthatfoodandeatingareproblemstowomenhasbecomeaclich.4 WhenthepopularfeministmagazineMs.devoteditsOctober,1983,issueto food,ittreatedarangeofissuesfromdeformitiessupposedlyproducedbycontaminatedmeattobulimiaamongcollegestudentsthejoyofcookingoreatingwas noticeablyabsent.5 Latetwentiethcenturystudiesofwomenandfoodthatgobeyonddescribingthenexususuallyassociaterefusaltoeatwiththequestionofcontrol. Culturalinterpretationsofanorexianervosafocusonwaysthemediaurgewomentocontrolbodysizepsychodynamicinterpretationsconcentrateonthegirl'sefforts torebelagainstanovercontrollingmotherevenbiologicalexplanationsrelateanorexiatofemaledepression,whichmanifestsitself(whateveritscause)infeelingsof powerlessnessandworthlessness.6 Modernattentiontothetopic''womenandfood"appearstobeverymuchmoreonesidedthanmedievalpracticeandsymbolism.Itisthereforenotsurprisingthat recenthistorianshavetakenlittlenoticeofthereligioussignificanceoffoodnorthatthesmallattentionthatthetopichasbeguntoreceivehasfocusedonmedieval parallelstothemoderndiseaseentitiesanorexianervosaandbulimia.Buttostudyfastingwithoutstudyingritualsofeating,toconsiderthepainofasceticismwhile ignoringtheexplicitwordsofitspractitionersisnotthemostfruitfulwaytoapproachthehistoryofourEuropeanpast.Formedievalfoodbehaviorwasserviceof othersaswellasrendingandsacrifice.Religiousritualcenteredoneatingaswellasonabstaining. AsIhaveshownabove,medievalwomensometimesrejectedbothbodyandfamilythroughfoodpractices.Foodbehaviorshelpedgirlstogaincontroloverselfas wellasovercircumstance.Throughfasting,womeninternalizedaswellasmanipulatedandescapedpatriarchalfamilialandreligiousstructures.Buttheselfstarvation ofsomethirteenth,fourteenth,andfifteenthcenturywomenhadaresonanceandacomplexitythatarenotcapturedbytheanalogytomoderndiseaseentities.My purposeinthisbookhasbeentoputthebehavior,thesymbols,andtheconvictionsofwomenandmeninthedistantpastintotheirfullcontext.Onlybyconsideringall themeaningsandfunctionsofme


dievalpracticeandbeliefcanweexplainmedievalexperiencewithoutremovingitscreativityanddignity. Myapproachclearlyassumesthatthepracticesandsymbolsofanyculturearesoembeddedinthatcultureastobeinseparablefromit.Thus,justasIhaveargued thatthenotionofanorexianervosa,whichemergedinthelatenineteenthcenturytodescribeonetypeofinedia,shouldnotbewrenchedfromitsmoderncontextand appliedtothefourteenthandfifteenthcenturies,soIwouldarguethatmedievalsymbols,behaviors,anddoctrineshavenodirectlessonsforthe1980s.7 Theywere producedbyaworldthathasvanished.NorwouldIwantustoreturntotheMiddleAges.HoweverbeautifultheproseofCatherineofSienaorthepoetryof Hadewijch,theactuallivesofsomelatemedievalwomenmustgiveuspause.Althoughwemaywishforanenrichingofoursymbolicuniverse,itishardtowant,for ourselvesorourdaughters,alifelikeLidwina'sorAlpas's,orevenlikeTheresaNeumann'sorSimoneWeil's.Noonecouldwishtoreturntoasocietyinwhichthe horrorsofleprosy,gangrene,orstarvationcanbemitigatedonlybysymbolsthatglorifypainandsacrifice.Thoserecentscholarswhohaveattemptedtourgemedieval devotionsonthemodernchurchruntheriskofignoringthesavageryofsomemedievalasceticism,thesentimentalityofmuchmedievalpreaching,thesexismof medieval(andmodern)society,andtheinappropriatenessofeventhemostgenerousfourteenthcenturynotionsofmothertoaworldwithmoderntechnology.8 On theotherhand,thosescholarswhohaveattackedthepietyoflatemedievalwomenfornotmeetingmodernneedshavemerelypointedouttheobvious,while sometimesmakingitharderforustounderstandthewellspringsofideasthat,intheirowncontext,hadgreatpowerandbeauty. Arethere,then,anyimplicationsofmystudyfortwentiethcenturyculture,inwhichtheassociationofwomanandfoodisstillsostriking,yetthemeaningofthe associationissodifferent?Themostbasicimplication,Ithink,isthis.Althoughmedievallifestylesanddevotionsseeminapplicable(withoutgreatrevision)tomodern problems,therangeandrichnessofmedievalsymbolshavesomethingtoteachusabouttheimpoverishmentofourown.Comparedtotherangeofmeaningsin medievalpoetryandpiety,ouruseofbodyandfoodassymbolsisnarrowandnegative.Andbecauseourunderstandingoffoodandfleshisfearfulandawkward,our therapiesforthosewhosufferfrom"eatingdisorders"


arenarrowandawkwardtoo.Ouranswertothosewhoseenobeautyorhopeinthefactofembodimentisaconcentrationontheissueofcontrol.9 Andsucha concentrationappearstometoreflectexactlytheculturalemphasisthatproducestheproblem. Medievalpeoplesawfoodandbodyassourcesoflife,repositoriesofsensation.Thusfoodandbodysignifiedgenerativityandsuffering.Food,whichmustbe destroyedinordertogivelife,andbody,whichmustbetorninordertogivebirth,becamesynonymousinidentifyingthemselveswithboth,womenmanagedtogive meaningtoaphysical,humanexistenceinwhichsufferingwasunavoidable.Religiouswomeninthethirteenthandfourteenthcenturies,whowithdrewfromthetasksof childbearingandnurturingwhichthecultureassignedtofemales,nonethelessexpressedthroughtheirimageryawiderangeofpositiveresonancesforbothphysicality andfood. Incontrast,modernpeopleseefoodandbodyasresourcestobecontrolled.Thusfoodandbodysignifythatwhichthreatenshumanmastery.Theysignifythe untamed,therebellious,theexcessive,theproliferating.Messagesmodernwomenabsorbfromthepopularcultureofmagazineadvertisementsandtelevisionurge themtocontroltheirbodieswithdeodorants,tranquilizers,headacheremedies,diets,etc.Breastsarenot,tomodernpeople,symbolsoffood.Theonsetofpubertyis notanoccasionforrejoicingbyanadolescentgirlorherparents.Menstruationislessapreludetocreativityandaffectivitythanafrighteningsignofvulnerability.Body andfoodarethussymbolsofthefailureofoureffortstocontrolourselves. Bodyandfoodhavebecomesuchsymbols,ofcourse,becauseweareinmanywaysabletocontrolbasicaspectsofbodilyexperienceespeciallyfertilityandpain.I wouldnotwanttosuggestthatwerelinquishthatcontrol.Ithasbroughtanestheticsandantisepticstostillbodilysuffering,reproductivefreedomtoopenwomen's livesandthoseofmenandchildrentonewformsofcreativityandfulfillment,advancesinnutritionandfertilizerstomakehungerlessacuteinatleastaportionof theglobe.Butourmodernimagesoffoodandbody,particularlyfemalebody,asallthatthreatensmasteryseemtomeunattractiveandevendangerousintwovery differentways. First,ourmodernassumptionsobscurethefactthatfoodisfoodandbodyisbody.Twentiethcenturydiscussionsofanorexianervosa,forexample,seemtohave assumed,whenFreudian,thatbodymeans


sexuality10and,whennonFreudian,thateatingmeanscontrol.Theseassumptionsarenotcompletelyunhelpful.Yettherefusaloffemaleteenagerstoeatseemsmost obviouslyrelatedbothtothephysiologicalchangesofpuberty,whichsignalthepossibilityofmotherhood,andtothebasicassumptioninourculturethatwomenare foodpreparers,notfoodconsumers.ThemethodIhavefollowedinthisbook,ofrelatingvariousfoodpracticesandsymbolswithinasocietytoeachother,suggests thatmodernanalystsmightgainimportantinsightsintomodernbehaviorpatternsbyseeingfoodasfoodandplacingitinitsculturalcontext. Second,ourmodernuseoffoodandbodyassymbolsofallthatweseektocontrolseemstomeavainefforttohidefromourselvesthefactthatourcontrolisnot cannotbetotal.AndIdonotreferheremerelytotheobviousfailuresofoursocialpoliciesandourtechnologythatarerepresentedbythestarvationofpartsofthe ThirdWorld.Imeanthatthesortofcontrolweappeartowantisimpossibleunlesswecancontroldeathitself.Forunlessweconquerdeath,sufferingmustalwaysbe areminderofitaforetasteofourowndeathandofthelossofthosewelove.Unlessweconquerdeath,fertility(howeverfrighteningitmaybe)willbenecessaryfor oursurvival:newlife,issuingfromwomen'sbodies,willbeourcollectiveimmortality. Butwehavenotconquereddeath.Thereisthusbravado,tragicandpatheticbravado,intheassumptionthatmentalhealthandhappinessdependuponsuppressing fertilityandsufferingthebasicremindersthatdeathiseverinourmidst.Perhaps,then,ourculturecannotaffordtoconsidertheissueofwomenandfoodmerelyasa casestudyinhealthyandunhealthycontrol.Perhapswecannotaffordtoseebody,especiallyfemalebody,andnourishmentmerelyasthreatstohumanmastery. Indeed,ourverytendencytothinkintermsofcontrolmayencourageviolencetowardfemalebodiesandcallousnesstowardanypainwecannotmanagetoassuage. Thuswemay,morethanwerealize,needpositivesymbolsforgenerativityandsuffering.Ourculturemayfinallyneedsomethingofthemedievalsense,reflectedso clearlyintheuseofbirthingandnursingassymbolsforsalvation,thatgenerativityandsufferingcanbesynonymous.11Perhapsweshouldnotturnourbacksso resolutelyaswehaverecentlydoneeitheronthepossibilitythatsufferingcanbefruitfuloronfoodandfemalebodyaspositive,complex,resonantsymbolsofloveand generosity.


Isaidabovethatmedievallivesandrhetorichavenodirectrelevancetoours.Butevenmedievalsymbolsarenosolutiontomodernwoes.Wecannotadoptsuch symbolsasananswertotheimpoverishmentoftwentiethcenturyimages.ThatiswhyIhaverelegatedthoughtsonthemodernworldtoanepiloguethatisinnowaya conclusion.Butadeeperunderstandingofwhattheideasandlivesofmedievalwomenreallymeantnotonlyhelpsusexplainwhytheywereastheywere,italso rescuesthemfromoblivionandilluminatestheirhumanity.Andsuchilluminationgivesusmuchtoadmireaswellasmuchtoabhor.Bycomparison,wemaythusseea littlemoreclearlywhattoadmireandabhoraboutourselves.Inthissense,then,thefemalelivesIhavechronicledherearerelevanttoourown.Iftheirimagesand valuescannotbecomeouranswers,theycannonethelessteachusthatweneedricherimagesandvalues.Perhapsalsotheycanpointthedirectioninwhichweshould search.


Sourcesfrequentlycitedinthisworkarereferredtobytheabbreviationslistedbelow.TheIndexofSecondaryAuthorsdirectsthereadertothefirst,full,bibliographic citationofeachoftheotherworksmentionedintheNotes. AASSJ.BollandusandG.Henschenius,Actasanctorum...editionovissima,ed.J.Carnandetetal.(Paris:Palm,etc.,1863).Notallthevolumesinthisseries areintheirthirdedition,buttheseriesasawholeisthethirdedition. ABAnalectaBollandiana(Brussels:SocitdesBollandistes,1882). AFTheFathersofSt.Bonaventure'sCollege,eds.,Analectafranciscana,siveChronicaaliaquevariadocumentaadhistoriamFratrumminorumspectantia (Quaracchi:CollegiumS.Bonaventurae,1885). AngelaofFoligno,ed.FerrandBaudryAngelaofFoligno,LeLivredel'expriencedesvraisfidles:Textelatinpublid'aprslemanuscritd'Assise,ed.and trans.M.J.FerrandL.Baudry(Paris:Droz,1927). Aquinas,STThomasAquinas,Summatheologiae,Blackfriarsed.,61vols.(NewYork:McGrawHill,19641981). Baker,MWDerekBaker,ed.,MedievalWomen:DedicatedandPresentedtoProfessorRosalindM.T.Hill...,StudiesinChurchHistory,Subsidia1(Oxford: Blackwell,1978). Braun,AltarJosephBraun,DerchristlicheAltarinseinergeschichtlichenEntwicklung,2vols.(Munich:Koch,1924). Browe,DieWunderPeterBrowe,DieEucharistischenWunderdesMittelalters,BreslauerStudienzurhistorischenTheologie,NF4(Breslau:MllerundSeiffert, 1938). BSBibliothecasanctorum,12vols.(Rome:IstitutoGiovanniXXIIIdellaPontificiaUniversitLateranense,19611969). Bynum,JMCarolineWalkerBynum,JesusasMother:StudiesintheSpiritualityoftheHighMiddleAges,PublicationsoftheCenterforMedievaland RenaissanceStudies,UCLA,16(BerkeleyandLosAngeles:UniversityofCaliforniaPress,1982).


Bynum,"WomenMystics"CarolineWalkerBynum,"WomenMysticsandEucharisticDevotionintheThirteenthCentury,"Women'sStudies11(1984):179214. Caesarius,DialogusCaesariusofHeisterbach,Dialogusmiraculorum,ed.JosephStrange,2vols.(Cologne:Heberle,1851). CatherineofGenoa,Edizionecritica,ed.UmileBonziUmileBonzidaGenova,ed.,S.CaterinaFieschiAdorno,vol.2:Edizionecriticadeimanoscritti cateriniani(Turin:Marietti,1962). CatherineofSiena,Dialogue,ed.CavalliniCatherineofSiena,IlDialogodellaDivinaProvvidenzaovveroLibradellaDivinoDottrina,ed.GiulianaCavallini (Rome:EdizioniCateriniane,1968). CatherineofSiena,Letters,ed.MisciattelliCatherineofSiena,LeLetteredeS.CaterinadaSiena,ridotteamigliorlezione,einordinenuovodisposteconnote diNiccolTommaseoacuradiPieroMisciattelli,6vols.(Siena:GiuntiniyBentivoglio,19131922). DHGEDictionnaired'histoireetdegographieecclsiastiques(Paris:LetouzeyetAn,1912). DMADictionaryoftheMiddleAges,ed.JosephStrayer(NewYork:Scribner's,1982). Dronke,WWPeterDronke,WomenWritersoftheMiddleAges:ACriticalStudyofTextsfromPerpetua(+203)toMargueritePorete(+1310)(Cambridge: CambridgeUniversityPress,1984). DSDictionnairedespiritualit,asctiqueetmystique,doctrineethistoire,ed.M.Villeretal.(Paris:Beauchesne,1932). DTCDictionnairedethologiecatholique,ed.A.Vacantetal.,15vols.andTablesgnrales(Paris:LetouzeyetAn,19091950). Dumoutet,CDEdouardDumoutet,CorpusDomini:Auxsourcesdelapiteucharistiquemdivale(Paris:Beauchesne,1942). EngelthalKarlSchrder,ed.,DerNonnenvonEngelthalBchleinvonderGenadenberlast,BibliothekdesliterarischenVereinsinStuttgart108(Tbingen: LiterarischerVereininStuttgart,1871). Goodich,VPMichaelGoodich,VitaPerfecta:TheIdealofSainthoodintheThirteenthCentury,MonographienzurGeschichtedesMittelalters25(Stuttgart: Hiersemann,1982). Gougaud,DAPLouisGougaud,DevotionalandAsceticPracticesintheMiddleAges,trans.G.C.Bateman(London:BurnsOatesandWashbourne,1927). Grundmann,BewegungenHerbertGrundmann,ReligiseBewegungenimMittelalter:UntersuchungenberdiegeschichtlichenZusammenhngezwischender Ketzerei,denBettelordenundderreligisenFrauenbewegungim12.und13.Jahrhundert...(1935repr.withadditions,Hildesheim:Olms,1961). ImbertGourbeyre,StigmatisationAntoineImbertGourbeyre,LaStigmatisa


tion:L'ExtasedivineetlesmiraclesdeLourdes:Rponseauxlibrespenseurs,2vols.(ClermontFerrand:LibrairieCatholique,1894). JohnMarienwerder,Vitalatina,ed.WestpfahlJohnMarienwerder,VitaDorotheaeMontoviensisMagistriJohannisMarienwerder,ed.HansWestpfahl, ForschungenundQuellenzurKirchenundKulturgeschichteOstdeutschlands1(Cologne:Bhlau,1964). Julian,BookofShowings,ed.ColledgeandWalshJulianofNorwich,ABookofShowingstotheAnchoressJulianofNorwich,ed.EdmundColledgeandJames Walsh,StudiesandTexts35,2parts(part1containstheShortText,part2theLongText)(Toronto:PontificalInstituteofMedievalStudies,1978). Kieckhefer,UnSRichardKieckhefer,UnquietSouls:FourteenthCenturySaintsandTheirReligiousMilieu(Chicago:UniversityofChicagoPress,1984). McDonnell,BeguinesErnestW.McDonnell,TheBeguinesandBeghardsinMedievalCulture,withSpecialEmphasisontheBelgianScene(NewBrunswick, N.J.:RutgersUniversityPress,1954repr.ed.1969). MGH.SSMonumentaGermaniaehistorica.ScriptoresrerumgermanicarumandScriptores...novaser.(Hannover:HahnscheBuchhandlung,etc.1826). MGH.SSRMMonumentaGermaniaehistorica.Scriptoresrerummerovingicarum(Hannover:HahnscheBuchhandlung,1885). OBBernardofClairvaux,SanctiBernardiopera,ed.J.Leclercq,C.H.Talbot,andH.M.Rochais(Rome:EditionesCistercienses,1957). OeuvresdeMargueriteMargaretofOingt,LesOeuvresdeMarguerited'Oingt,ed.andtrans.AntoninDuraffour,PierreGardette,andPauletteDurdilly, Publicationsdel'InstitutdeLinguistiqueRomanedeLyon21(Paris:BellesLettres,1965). OmnibusMarionA.Habig,ed.,St.FrancisofAssisi:WritingsandEarlyBiographies:EnglishOmnibusofSources,3ded.(Chicago:FranciscanHeraldPress, 1973). Pater,MAThomasPater,MiraculousAbstinence:AStudyofOneoftheExtraordinaryMysticalPhenomena,CatholicUniversityofAmericaStudiesinSacred Theology100(Washington,D.C.:CatholicUniversityofAmericaPress,1946). PGJ.P.Migne,ed.,Patrologiaecursuscompletus:seriesgraeca,162vols.(Paris:Migne,18571866). PLJ.P.Migne,ed.,Patrologiaecursuscompletus:serieslatina,221vols.(Paris:Migne,etc.,18411864). Roisin,L'HagiographieSimoneRoisin,L'HagiographiecisterciennedanslediocsedeLigeauXIII'sicle(Louvain:Bibliothquedel'Universit,1947).


SC,Sr.mon.Sourceschrtiennes(Paris:EditionsduCerf,1941),Sriedestextesmonastiquesd'Occident(Paris:EditionsduCerf,1958). Schiller,IconographyGertrudSchiller,IconographyofChristianArt,trans.JanetSeligman,2vols.[thefirsttwovols.ofIkonographie](London:Humphries, 19711972). Schiller,IkonographieGertrudSchiller,IkonographiederchristlichenKunst,4vols.(Gtersloh:Mohn,19661980). Suso,DeutscheSchriftenHenrySuso,HeinrichSeuse:DeutscheSchriftenimAuftragderWrttembergischenKommissionfrLandesgeschichte,ed.Karl Bihlmeyer(Stuttgart:Kohlhammer,1907). Tauler,DiePredigtenJohnTauler,DiePredigtenTaulers:AusderEngelbergerundderFreiburgerHandschriftsowieausSchmidtsAbschriftender ehemaligenStrassburgerHandschriften,ed.FerdinandVetter(Berlin:WeidmannscheBuchhandlung,1910). Thurston,PPHerbertThurston,ThePhysicalPhenomenaofMysticism(Chicago:Regnery,1952). TssElsbetStagel,DasLebenderSchwesternzuTssbeschriebenvonElsbetStagel,ed.FerdinandVetter,DeutscheTextedesMittelalters6(Berlin: WeidmannscheBuchhandlung,1906). Tubach,IndexFredericC.Tubach,Indexexemplorum:AHandbookofMedievalReligiousTales,FFCommunications204(Helsinki:FinnishAcademyof SciencesandLetters,1969). "Unterlinden"JeanneAnceletHustache,ed.,"Les'VitaeSororum'd'Unterlinden.EditioncritiqueduManuscrit508delaBibliothquedeColmar,"Archives d'histoiredoctrinaleetlittrairedumoyenge5(1930):317509. Vauchez,LaSaintetAndrVauchez,LaSaintetenOccidentauxdernierssiclesdumoyenged'aprslesprocsdecanonisationetlesdocuments hagiographiques,Bibliothquedestudesfranaisesd'AthnesetdeRome241(Rome:EcoleFranaisedeRome,1981). ViedeDoucelineJ.H.Albans,ed.andtrans.,LaViedeDouceline,fondatricedesbguinesdeMarseille(Marseilles:Camoin,1879). VitaBeatricisL.Reypens,ed.,VitaBeatricis:DeAutobiografievandeZ.BeatrijsvanTienenO.Cist.12001268(Antwerp:RuusbroecGenootschap,1964). WeinsteinandBell,SSDonaldWeinsteinandRudolphM.Bell,SaintsandSociety:TheTwoWorldsofWesternChristendom,10001700(Chicago:University ofChicagoPress,1982).


Introduction 1.JohnTauler,Sermon31,SecondSermonforCorpusChristi,inTauler,DiePredigten,p.310E.ColledgeandSisterM.Jane,trans.,SpiritualConferences(St. Louis:Herder,1961),p.258. 2.Forexample,MalcolmDavidLambert,FranciscanPoverty:TheDoctrineoftheAbsolutePovertyofChristandtheApostlesintheFranciscanOrder, 12101323(London:SPCK,1961)andLesterK.Little,ReligiousPovertyandtheProfitEconomyinMedievalEurope(Ithaca:CornellUniversityPress, 1978).SeealsoJohnV.Fleming,AnIntroductiontotheFranciscanLiteratureoftheMiddleAges(Chicago:FranciscanHeraldPress,1977),pp.73109and below,chap.3n.159. 3.Forrecentexamples,seeJohnBugge,Virginitas:AnEssayintheHistoryofaMedievalIdeal,Archivesinternationalesd'histoiredesides,sriesminor17(The Hague:Nijhoff,1975)andWeinsteinandBell,SS,pp.7399.LeoSteinberg,"TheSexualityofChristinRenaissanceArtandinModernOblivion,"October25 (Summer1983):1222(publishedinbookform,NewYork:Pantheon,1983),providesafascinatingcounterpointtotheargumentinthisbook.Steinbergsees Christ'ssexuality(bywhichhereallymeansChrist'sgenitality)asabasicsymbolofhishumanity.HethereforestressesthemalenessofChristinfifteenthcenturyart andpiety,whereasI,beginningwithfoodsymbolism,findaChristwhosehumanityissymbolizedinfemaleaswellasmaleimages. 4.PeterBrown,"Response"toRobertM.Grant,"TheProblemofMiraculousFeedingsintheGraecoRomanWorld,"CenterforHermeneuticalStudies:Protocol oftheFortySecondColloquy(Berkeley:GraduateTheologicalUnionandUniversityofCalifornia,1982),p.23. 5.AsFernandBraudelpointsout,povertywasattheheartofthelongcourseofMediterraneanhistory,andfaminewasrecurrent,thenaturaloutcomeofageneral shortageofresources.SeeFernandBraudel,TheMediterraneanandtheMediterraneanWorldintheAgeofPhilipII,trans.SinReynolds,2vols.(NewYork: HarperandRow,197273),vol.1,esp.pp.24156.Onlatermedievaleconomichistory,seeTheCambridgeEconomicHistoryofEurope,vol.1,2ded.,ed. M.M.Postan(Cambridge:CambridgeUniversityPress,1966),andvols.2and3,ed.M.M.Postanetal.(Cambridge:CambridgeUniversityPress,1952,1963) RobertBoutruche,LaCrised'unesocit:SeigneursetpaysansduBordelaispendantlaguerredecentans(1947Paris:BellesLettres,1963)Robert


Brenner,''AgrarianClassStructureandEconomicDevelopmentinPreIndustrialEurope,"PastandPresent70(February1976):3075andthesymposium articlesonBrenner'sworkinPastandPresent7897(February1978November1982).Theextentoftheeconomiccrisisoftheearly(i.e.,preplague) fourteenthcenturyhasbeengreatlydebated,especiallyforEnglandseethesummaryofthedebateinIanKershaw,"TheGreatFamineandAgrarianCrisisin England13151322,"inR.H.Hilton,ed.,Peasants,KnightsandHeretics:StudiesinMedievalEnglishSocialHistory(Cambridge:CambridgeUniversity Press,1976),pp.85132(repr.fromPastandPresent59[May1973]). 6.See,forexample,FritzCurschmann,HungersnteimMittelalter:EinBeitragzurdeutschenWirtschaftsgeschichtedes8.bis13.Jahrhunderts(Leipzig: Teubner,1900),esp.pp.5960,110,112,142WilhelmAbel,AgrarkrisenundAgrarkonjunkturinMitteleuropa,3ded.(Hamburg:Parey,1978)Marie JospheLarenaudie,"LesFaminesenLanguedocauxXIVeetXVesicles,"AnnalesduMidi64(1952):2739ElisabethCarpentier,"Autourdelapestenoire: Faminesetpidmiesdansl'histoireduXIVesicle,"Annales:Economies,socits,civilisations17.5(1962):106292H.S.Lucas,"TheGreatEuropeanFamine of1315,1316and1317,"inE.M.CarusWilson,ed.,EssaysinEconomicHistory,vol.2(London:Arnold,1962),pp.4972(repr.fromSpeculum5[1930]) andKershaw,"GreatFamine."Salimbene'schroniclefor1286givesagraphicexampleofathirteenthcenturymanwhobecameobsessedwithfearoffamineand hoardedfood.Children,angeredbyhisgreedandhypocrisy,exactedrevengeonhiscorpse.SeetheexcerptfromSalimbene'schronicleinG.G.Coulton,FromSt. FrancistoDante:TranslationsfromtheChronicleoftheFranciscanSalimbene...,2ded.(1907repr.Philadelphia:UniversityofPennsylvaniaPress,1972), pp.16364seealsoibid.,pp.19091.ThomasofCelano'ssecondLifeofFrancisofAssisispeaksofanearlythirteenthcenturyfaminesobadthatbreadwasmade fromthebarkoftreesanddeadchildrenwereeatenseeThomasofCelano,SecondLifeofFrancis,bk.2,chap.23,par.53,inAF,vol.10,pp.16364.Twosaints discussedinchap.4,below,providefurtherexamplesofhardship.Alpas'sparents,attheurgingofherbrothers,lefthertostarvebecauseshewastooilltocart manureMargaretofCittdiCastello,bornweakandblind,wasabandonedbyherfamily. 7.Foranextraordinaryexampleofdifferencesindietbasedonclassorstatusdifferences,seethepassagefromLeDespitauvillainquotedinRobertGottfried,The BlackDeath:NaturalandHumanDisasterinMedievalEurope(NewYork:FreePress,1983),pp.99100.Onthispoint,seealsoConstanceB.Hieattand SharonButler,eds.,IntroductiontoCuryeonInglysh:EnglishCulinaryManuscriptsoftheFourteenthCentury(Includingthe"FormeofCury"),EarlyEnglish TextSociety(London:OxfordUniversityPress,1984),pp.56andJackGoody,Cooking,CuisineandClass:AStudyinComparativeSociology(Cambridge: CambridgeUniversityPress,1982),pp.13844. 8.See,forexample,MikhailM.Bakhtin,RabelaisandHisWorld,trans.H.Iswolsky(Cambridge:M.I.T.Press,1968)andPieroCamporesi,IlPaneselvaggio (Bologna:IlMulino,1980),esp.pp.2544. 9.See,forexample,C.H.Talbot,ed.andtrans.,TheLifeofChristinaofMarkyate:ATwelfthCenturyRecluse(Oxford:ClarendonPress,1959),pp.18289, whereChristinaandacertainMargaretfeedamysteriouspilgrim(i.e.,Christ).Oneofthesignsofhisholinessisthathe"tastesratherthaneats."Forasimilarstoryof feedingamysterious


strangerwhoseextraordinarinessisprovenbythefactthathedoesnotreallyeat,seeViedeDouceline,chap.8,pars.69,pp.6669. 10.LifeofMargaretofCortona,chap.3,par.51,AASSFebruary,vol.3(Paris,1865),p.313.ReadersshouldnotethatIgivedateofdeathandidentifying informationthefirsttimeanindividualismentioned.SeetheGeneralIndexforthepagewherethatfirstreferenceoccurs. 11.GuntherofPairis,Deoratione,jejunioeteleemosynalibritredecim,bk.12:Dejejunio,chap.3,PL212,col.210.OnGunther,seeDictionnairedes auteurscisterciens,ed.EmileBrouette,AnselmeDimier,andEugneManning,LaDocumentationcistercienne16(Rochefort,Belgium:AbbayeNotreDamedeSt. Remy,197578),vol.1,fasc.3,cols.32425. 12.LifeofCatherineofSweden,chap.1,par.4,AASSMarch,vol.3(Paris,1865),p.504. 13.TractatusbeatiGregoriipapecontrareligionissimulatores,chap.69,inMarvinColker,ed.,AnalectaDublinensia:ThreeMedievalLatinTextsinthe LibraryofTrinityCollegeDublin(Cambridge:MedievalAcademyofAmerica,1975),p.47seealsop.6forthedating. 14.Foradiscussionofrecentanthropologicalstudiesoffoodpractices,seeGillianFeeleyHarnik,TheLord'sTable:EucharistandPassoverinEarlyChristianity (Philadelphia:UniversityofPennsylvaniaPress,1981),pp.618andGoody,Cooking,CuisineandClass,pp.1039.Forapsychoanalyticinterpretationoffood ritual,seeMaryEllenRossandChery1LynnRoss,"Mothers,Infants,andthePsychoanalyticStudyofRitual,"Signs:JournalofWomeninCultureandSociety9.1 (1983):2639.AlthoughausefulcorrectivetoFreud,thisarticledoesnottakeusveryfarinunderstandingthemass. 15.MechtildofMagdeburg,OffenbarungenderSchwesterMechtildvonMagdeburgoderDasFliessendeLichtderGottheit,ed.GallMorel(Regensburg: Manz,1869repr.Darmstadt,1963),bk.2,chap.22,p.43trans.LucyMenzies,TheRevelationsofMechtildofMagdeburg(12101297)orTheFlowing LightoftheGodhead(London:Longmans,1953),p.48.OnMechtild'sdeathdate,seeHansNeumann,"BeitrgezurTextgeschichtedes'FliessendenLichtsder Gottheit'undzurLebensgeschichteMechtildsvonMagdeburg,"NachrichtenderAkademiederWissenschafteninGttingen,PhilologischhistorischeKlasse (1954),p.70. 16.Hadewijch,Mengeldichten,ed.J.VanMierlo,LeuvenseStudinenTekstuitgaven(Antwerp:N.V.StandaardBoekhandel,1954),poem16,p.79trans. ColumbaHart,Hadewijch:TheCompleteWorks(NewYork:PaulistPress,1980),p.353. 17.JohnTauler,Sermon30,FirstSermonforCorpusChristi,inTauler,DiePredigten,p.293trans.ColledgeandSisterM.Jane,SpiritualConferences,p.100. Inthissermon,TauleractuallymovesquicklyawayfromoureatingGodasanimageofuniontoadiscussionofGod'seatingus("gnawingatourconsciences")asan imageofpunishment(DiePredigten,pp.29495). 18.WilliamofSt.Thierry,ExpossurleCantiquedescantiques,ed.J.M.Dchanet,SC82,Sr.mon.8(1962),chap.38,p.122trans.ColumbaHart,The WorksofWilliamofSt.Thierry,vol.2:ExpositionontheSongofSongs,CistercianFathersSeries6(Spencer,Mass.:CistercianPublications,1970),p.30.


19.WilliamofSt.Thierry,Meditativaeorationes,chap.10,PL180,col.236trans.SisterPenelope,TheWorksofWilliamofSt.Thierry,vol.1:On ContemplatingGod...,CistercianFathersSeries3(Spencer,Mass.:CistercianPublications,1971),pp.15253.Forotherexamplesoffoodimagery,seeJ. Huizinga,TheWiningoftheMiddleAges:AStudyoftheFormsofLife,ThoughtandArtinFranceandtheNetherlandsintheXIVthandXVthCenturies, trans.F.Hopman(1924repr.GardenCity:Doubleday,1956),pp.197200. 20.Allfiveoftheimportantrecentworksonmedievalsaintsdealwiththisissue.SeePierreDelooz,SociologieetCanonisations(Lige:Facultdedroit,1969), whichissummarizedinidem,"TowardsaSociologicalStudyofCanonizedSainthoodintheCatholicChurch,"inStephenWilson,ed.,SaintsandTheirCults: StudiesinReligiousSociology,FolkloreandHistory(Cambridge:CambridgeUniversityPress,1983),pp.189216Vauchez,LaSaintetWeinsteinandBell, SSGoodich,VPandKieckhefer,UnS.Onthewayinwhichaholypersonservesasanexemplarormodelforasociety,seealsoPeterBrown,"TheSaintas ExemplarinLateAntiquity,"Representations1.2(Spring1983):125.Forabibliographyofrecentworksonsanctityandhagiography,seeWilson,Saintsand TheirCults,pp.309417.Forbasicbiographicalandbibliographicalinformationonindividualsaints,thebestreferenceworkisnowBibliothecasanctorum.The standardguidetoeditionsistheBollandists,eds.,Bibliothecahagiographicalatinaantiquaeetmediaeaetatis,Subsidiahagiographica6,2vols.(18981901 repr.Brussels:SocitdesBollandistes,1949). 21.Hagiography,byitsnature,ismorereliableasevidenceforwhatpeoplebelievedthanasevidenceforthedetails(especiallythechronology)ofindividuallives. Indeed,theprocessofapplyingmodernpsychologicalormedicalmodelstomedievallivesoftentemptshistorianstotrusttheparticularsofmedievalaccountsmore thaniswise.Understandingthisshouldnot,however,leadonetofallintotheoppositeerrorofignoringthedistinctionbetweenclearlylegendarymaterial,ontheone hand,andfairlytrustworthycontemporaryaccounts,ontheother.Seebelow,chap.6n.82.Forasplendiddiscussionofthesemethodologicalproblems,see SiegfriedRingler,"DieRezeptionmittelalterlicherFrauenmystikalswissenschaftlichesProblem,dargestelltamWerkderChristineEbner,"inPeterDinzelbacherand DieterR.Bauer,eds.,FrauenmystikimMittelalter,WissenschaftlicheStudientagungderAkademiederDizeseRottenburgStuttgart,22.25.Februar1984,in Weingarten(OstfildernbeiStuttgart:Schwabcnverlag,1985),pp.178200. 22.Afewminordetailsofformatfollowfromthisapproach.First,inordertoaidscholarswhowishtotrackdownreferencesandmayhavetoresorttodifferent editionsfromthoseIuse,Icitemedievalworksbychapterandparagraph(wheretheseareavailable)aswellasbypagenumber.Second,whenIgiveadditional materialinthefootnotes,Iusuallycitethetextsintheoriginallanguage.Thesefurtherexamplesareintendedforscholars,butitmayinterestthegeneralreaderaswell toseethevarietyofvernacularlanguagesinwhichwomen'sideassurvive.Third,Iprovideinthenotessomehistoriographicalcommentonthedifferencesbetweenmy interpretationsandthoseofotherscholars,somediscussionofmethodology,andanoccasionalsuggestionforfurtherresearch.Exceptforthetreatmentofanorexia nervosainchapter6,however,Ihaverefrainedfromclutteringthetextwithdiscussionofmoderninterpretations.Oneother


matterofformatisalsoworthmentioning.Ioccasionallyrepeatanexamplewhenitservestodemonstratetwoverydifferentanalyticalpoints.Insuchcases,Ido notrepeatthedocumentation,butreaderscanfindthefirstoccurrenceoftheexamplebyusingtheGeneralIndex.Incrossreferences,anotenumberstanding alonereferstothesamechapterwhenacrossreferenceistoadifferentchapter,thechapternumberisgivenaswell. 1 ReligiousWomenintheLaterMiddleAges 1.JamesofVitry,LifeofMaryofOignies,prologue,pars.68,AASSJune,vol.5(Paris,1867),p.548translationadaptedinpartfromtranslationsbyHenry OsbornTaylor,TheMedievalMind:AHistoryoftheDevelopmentofThoughtandEmotionintheMiddleAges,2vols.,4thed.(London:Macmillan,1925), vol.1,pp.47778andMcDonnell,Beguines,p.330. 2.Muchofchapter1willappearunderthesametitlebutinsomewhatdifferentforminTheEncyclopediaofWorldSpirituality,vol.17:ChristianSpirituality: HighMiddleAgesandReformation,ed.JillRaitt(NewYork:Crossroad,1987).ItappearsherewithpermissionoftheCrossroadPublishingCompany. 3.SuzanneF.Wemple,WomeninFrankishSociety:MarriageandtheCloister,500to900(Philadelphia:UniversityofPennsylvaniaPress,1981). 4.RichardW.Southern,WesternSocietyandtheChurchintheMiddleAges,PelicanHistoryoftheChurch2(Harmondsworth:Penguin,1970),pp.31831. 5.SeeRosalindB.BrookeandChristopherN.L.Brooke,"St.Clare,"inBaker,MW,p.276ChristopherN.L.BrookeandWimSwaan,TheMonasticWorld (London:Elek,1974),pp.167,17778,254n.2. 6.Inthemodernworldthereareroughlythreewomeninreligiousorderstoeveryman(BrookeandBrooke,"St.Clare,"p.276),thoughrecentlythenumberofnuns intheUnitedStateshassharplydeclined(see"VowsofDefiance,"Newsweek,19March1984,pp.97100).Thechangefromwomenasaminorityofthosein religiousorderstoalargefemalemajorityseemstohavecomeinthelaterMiddleAges. 7.Onreligiouswomen,thebasicworksareKarlBcher,DieFrauenfrageimMittelalter,2ded.(Tbingen:Laupp,1910)JosephGreven,DieAnfngeder Beginen:EinBeitragzurGeschichtederVolksfrmmigkeitunddesOrdenswesensimHochmittelalter,VorreformationsgeschichtlicheForschungen8(Mnster: Aschendorff,1912)Grundmann,BewegungenPhilibertSchmitz,HistoiredeI'ordredesaintBenot,7vols.(Maredsous:EditionsdeMaredsous,19421956), vol.7:LesMonialesStephanusHilpisch,DieDoppelklster:EnstehungundOrganisation(Mnster:Aschendorff,1928)idem,Geschichteder Benediktinerinnen,BenediktinischesGeistesleben3(St.Ottilien:EosVerlagderErzabtei,1951)MichelinePontenaydeFontette,LesReligieusesl'geclassque dudroitcanon:Recherchessurlesstructuresjuridiquesdesbranchesfmininesdesordres(Paris:Vrin,1967)andRobertE.Lerner,"BeguinesandBeghards," DMA,vol.2(1983),pp.15762.Forfurtherbibliography,seeC.EricksonandK.Casey,"WomenintheMiddleAges:A


WorkingBibliography,"MedievalStudies37(1975):34059andBynum,JM,pp.916,182n.33. 8.SeeAASSMarch,vol.3(Paris,1865),pp.36163theBenedictinesofParis,Viesdessaintsetdesbienheureux...,vol.3forMarch(Paris:LetouzeyetAn, 1941),p.481. 9.Forotherexamplesofwomenwhofoundedorders,seeGoodich,VP,p.174. 10.TheConradofMarchtaltextisquotedbySouthern,WesternSocietyandtheChurch,p.314andbyA.Erens,"LesSoeursdansI'ordredePrmontr,' AnalectaPraemonstratensia5(1929):10n.20.Thereisnomanuscriptcopyofthiscondemnation,whichfirstappearsinasixteenthcenturyworkofdubious reliability.SeeNorbertBackmund,MonasticonPraemonstratenseidest,HistoriacircariarumatquecanoniarumcandidietcanoniciOrdinis Praemonstratensis,3vols.(Straubing:Attenkofer,19491956),vol.1,p.85n.5andCarolNeel,"Women'sRolesinMedievalMonasticLife:DoubleMonasteries andtheTwelfthCenturyReform,"paperdeliveredtotheSixthBerkshireConferenceontheHistoryofWomen,13June1984,n.4oftypescript.Forthequotation fromBernard,seeSermonessuperCanticacanticorum,Sermon65,par.4,inOB,vol.2(1958),pp.17475.(Bernardoften,however,wrotetoindividual womenwithtactandgraciousness.)SeealsoGilesConstable,"AelredofRievaulxandtheNunofWatton:AnEpisodeintheEarlyHistoryoftheGilbertineOrder,"in Baker,MW,pp.20526. 11.JohnB.Freed,"UrbanDevelopmentandthe'CuraMonialium'inThirteenthCenturyGermany,"Viator3(1972)31127idem,TheFriarsandGerman SocietyintheThirteenthCentury,MedievalAcademyofAmericaPublications86(Cambridge:MedievalAcademyofAmerica,1977)andFrederickStein,"The ReligiousWomenofCologne,11201320"(Ph.D.dissertation,YaleUniversity,1977).SeealsomapsandindextoFrdricVanderMeer,Atlasdel'ordre cistercien(Amsterdam:Elsevier,1965)andBrookeandBrooke,"St.Clare,"p.276n.2. 12.SeeNeel,"DoubleMonasteries."Premonstratensiandoublehousesdid,however,disappearinwesternEurope. 13.Freed,"UrbanDevelopment." 14.MichaelGoodich,"ContoursofFemalePietyinLaterMedievalHagiography,"ChurchHistory50(1981):2032idem,VP,pp.17385BrendaM.Bolton, "VitaeMatrum:AFurtherAspectoftheFrauenfrage,"inBaker,MW,pp.25373Roisin,L'Hagiographie,pp.113,129. 15.See,forexample,RichardC.Trexler,"LeClibatlafindumoyenge:LesReligieusesdeFlorence,"Annales:Economies,socits,civilisations27(1972): 132950Freed,"UrbanDevelopment."Regionalvariationsinthetypesofreligiousstructuresavailabletowomenarecurrentlybeingexploredinamajorresearch projectconductedbyMaryMartinMcLaughlinandSuzanneWempleatBarnardCollege.Astudyoftheextenttowhichwomenwereoverrepresentedaswitnesses andadherentsincanonizationproceedings,regardlessofthesexofthesaint,wouldbeinstructiveasanotherindexoffemalereligiosity.Someofthematerialin Goodich,VP(esp.pp.163,209)suggeststhattheywereinfactoverrepresented,althoughGoodichdoesnotpursuethepoint. 16.GottfriedKoch,FrauenfrageundKetzertumimMittelalter:DieFrauenbewegungimRahmendesKatharismusunddesWaldensertumsundihresozialen Wurzeln:12.14.Jahrhundert,ForschungenzurmittelalterlichenGeschichte9(Berlin:AkademieVerlag,1962)EleanorC.McLaughlin,"LesFemmesetl'hrsie mdivale:UnProblmedans


l'histoiredelaspiritualit,"Concilium111(1976):7390RichardAbelsandEllenHarrison,"ThePositionofWomeninLanguedocianCatharism,"Medieval Studies41(1979):21551. 17.Thereisaverylargeliteratureontwelfthandthirteenthcenturyheresy.Fortworecentinterpretations,seeMalcolmLambert,MedievalHeresy:Popular MovementsfromBogomiltoHus(NewYork:HolmesandMeier,1977)andR.I.Moore,TheOriginsofEuropeanDissent(NewYork:St.Martin'sPress, 1977). 18.SeeRobertE.Lerner,TheHeresyoftheFreeSpiritintheLaterMiddleAges(BerkeleyandLosAngeles:UniversityofCaliforniaPress,1972)EleanorC. McLaughlin,"TheHeresyoftheFreeSpiritandLateMedievalMysticism,"MedievaliaetHumanistican.s.4(1973):3754. 19.ThiswasbasicallyGrundmann'sinterpretationseeBewegungen. 20.Inadditiontotheworkscitedinn.11above,seeMcDonnell,BeguinesBrendaM.Bolton,"Mulieressanctae,"inStudiesinChurchHistory,vol.10:Derek Baker,ed.,SanctityandSecularity:TheChurchandtheWorld(1973),pp.7795andKasparElm,"DieStellungderFrauinOrdenswesen,Semireligiosentum undHresiezurZeitderheiligenElisabeth,"inUniversityofMarburg,ed.,SanktElisabeth:Frstin,Dienerin,Heilige:Aufstze,Dokumentation,Katalog (Sigmaringen:Thorbecke,1981),pp.728. 21.Lerner,"BeguinesandBeghards,"p.160Stein,"ReligiousWomenofCologne." 22.SeeBcher,FrauenfrageandGreven'ssummaryofearlierliteratureinAnfnge,pp.127.Formorerecenteconomicandsocialinterpretations,seeDayton Phillips,BeguinesinMedievalStrasburg:AStudyoftheSocialAspectofBeguineLife(Stanford:StanfordUniversityPress,1941)andErnstWernerandMartin Erbstsser,IdeologischeProblemedesmittelalterlichenPlebejertums.DiefreigeistigeHresieundihresozialenWurzeln(Berlin:AkademieVerlag,1960). 23.SeeWernerandErbstsser,IdeologischeProblemeEvaG.Neumann,RheinischesBeginenundBegardenwesen:EinMainzerBeitragzurreligisen BewegungamRhein,MainzerAbhandlungenzurmittlerenundneuerenGeschichte4(MeisenheimamGlan:Hain,1960)Freed,"UrbanDevelopment."Seealso Lerner,HeresyoftheFreeSpirit,p.231. 24.See,forexample,Bcher,FrauenfrageandDavidHerlihy,"WomeninMedievalSociety,"repr.inTheSocialHistoryofItalyandWesternEurope,700 1500,Variorumreprints(London,1978). 25.Forthereligioussurplusexplanation,seeGreven,AnfngeGrundmann,BewegungenSouthern,WesternSocietyandtheChurch,pp.31831Bolton, "Mulieressanctae." 26.Ghentmemorialof1328,inPaulFredericq,CorpusdocumentorumInquisitionishaereticaepravitatisNeerlandicae,vol.1(Ghent:Nijhoff,1889),p.176 trans.adaptedinpartfromMcDonnell,Beguines,p.83. 27.Seeabove,n.10.Onmisogynygenerally,seeDianeBornstein,"Antifeminism,"DMA,vol.1(1982),pp.32225. 28.Freed,"UrbanDevelopment"idem,FriarsandGermanSocietyStein,"ReligiousWomenofCologne." 29.AliceA.Hentsch,Delalittraturedidactiquedumoyenges'adressantspcialementauxfemmes(Cahors:Coueslant,1903)andMatthusBernards, SpeculumVirginum:GeistigkeitundSeelenlebenderFrauimHochmittelalter(Cologne:Bhlau,1955).Seealso


ClarissaAtkinson,"'PreciousBalsaminaFragileGlass':TheIdeologyofVirginityintheLaterMiddleAges,"JournalofFamilyHistory8.2(Summer1983): 13143andPeterBrown,VirginityandSociety:Men,WomenandRenunciationinLateAntiquity,forthcoming. 30.Vauchez,LaSaintet,pp.21618.Ifoneconsidersallkindsofsaintstogether,menaccountfor81.7percentoftheproceedingsand85.7percentofthe canonizationswomenaccountfor18.3percentoftheproceedingsand14.3percentofthecanonizations.Onlyinthecategoryoflaysaintsdidwomenfareslightly betterthanmen.Between1198and1431,womenaccountfor41.2percentoftheproceedingsand44.5percentofthecanonizations,menfor58.8percentofthe proceedingsand55.5percentofthecanonizations. 31.WeinsteinandBell,SS,pp.22021.SeealsoVauchez,LaSaintet,pp.24349,31618,40210JaneTibbettsSchulenberg,"SexismandtheCelestial Gynaeceumfrom500to1200,"JournalofMedievalHistory4(1978):11733andGoodich,VP,p.173.Schulenberg,usingtheBibliothecasanctorum, estimates15percentby1250,24percentby1300.Vauchez,usingcanonizationproceedings,calculatesthat16.3percentofsaintsinthethirteenthcenturyand27.3 percentintheperiodfrom1305to1431werewomen. 32.MarcGlasser,"MarriageinMedievalHagiography,"StudiesinMedievalandRenaissanceHistoryn.s.4(1981):334,esp.p.32n.58Vauchez,LaSaintet, p.442.WeinsteinandBell'stables(SS,pp.12337)indicatethatahigherpercentageoffemalethanofmalesaintsweremarriedafactthatpartlyexplainsthelarger percentageofholywomenwhoexperiencedconflictarisingfromtheirsexuallives(ibid.,p.97). 33.WeinsteinandBell,SS,pp.9799,22527Vauchez,LaSaintet,p.44045. 34.WeinsteinandBell,SS,pp.194219,221(table)Vauchez,LaSaintet,pp.24349,317.AccordingtoVauchez,womenaccountfor21.4percentofthe proceedingsamongmendicantsbutforonly12.5percentofthecanonizations. 35.Vauchez,LaSaintet,p.317. 36.IhavediscussedthistrendinBynum,JM,pp.921,25054.Vauchez,LaSaintet,pp.24360,40210,discussesthefeminizationoflaypiety,especially undermendicantauspices,andtheclericalizationofmalepiety. 37.SeeBynum,JM,p.15JeanLeclercq,"MedievalFeminineMonasticism:Realityvs.RomanticImages,"Benedictus:StudiesinHonorofSt.Benedictof Nursia,StudiesinMedievalCistercianHistory8(Kalamazoo:CistercianPublications,1981),p.61andJosefJungmann,TheMassoftheRomanRite:ItsOrigins andDevelopment(MissarumSollemnia),trans.F.A.Brunner,2vols.(NewYork:Benziger,1951,1955),vol.2,p.386n.95. 38.QuotedinFrancineCardman,"TheMedievalQuestionofWomenandOrders,"TheThomist42(1978):596.SeealsoIdaRaming,TheExclusionofWomen fromthePriesthood:DivineLaworSexDiscrimination?trans.N.R.Adams(Metuchen,N.J.:ScarecrowPress,1976),pp.8182. 39.AccordingtothetablesinGoodich,VP,pp.21140,144of518saintswhoflourishedbetween1215and1334werewomen.Ofthesefemalesaints,mostwere religiousorquasireligious.(Goodichlists131asbeingaffiliatedwithanorder,butthisnumberisprobablytoohigh[seeatn.48below].)Only36,however,arelisted aseitherabbessesorprioressesanother5aredescribedasfoundersoforders.SeealsoBynum,


JM,pp.24762,esp.p.249WeinsteinandBell,SS,pp.22138.Themostextravagantpractitionersofpenitentialasceticismandecstasieswerealmostby definitiondisqualifiedfrommajoradministrativepositions. 40.SeeEileenPower,"ThePositionofWomen,"inG.C.CrumpandE.F.Jacobs,eds.,TheLegacyoftheMiddleAges(Oxford:ClarendonPress,1926),pp. 40134JoAnnMcNamaraandSuzanneWemple,"ThePowerofWomenthroughtheFamilyinMedievalEurope,5001100,"FeministStudies1(1973):126 41idem,"SanctityandPower:TheDualPursuitofMedievalWomen,"inRenateBridenthalandC.Koonz,eds.,BecomingVisible:WomeninEuropeanHistory (Boston:HoughtonMifflin,1977),pp.90118andthevariousarticlesinHerlihy,SocialHistoryofItaly. 41.Forrecent,convincingcritiquesofthenotionofa"status"ofwomen,seeMartinKingWhyte,TheStatusofWomeninPreindustrialSocieties(Princeton: PrincetonUniversityPress,1978),esp.pp.11617MichelleZimbalistRosaldo,"TheUseandAbuseofAnthropology:ReflectionsonFeminismandCrossCultural Understanding,"Signs:JournalofWomeninCultureandSociety5(1980):401NaomiQuinn,"AnthropologicalStudiesonWomen'sStatus,"AnnualReviewof Anthropology6(1977):18183andPennySchineGold,TheLadyandtheVirgin:Image,AttitudeandExperienceinTwelfthCenturyFrance(Chicago: UniversityofChicagoPress,1985),preface. 42.Forexamplesofthesecollectivebiographies,see"Unterlinden"TssEngelthalAnnavonMunzingen,"ChronikdesKlostersAdelhausen,"ed.J.Knig, FreiburgerDizesanArchiv13(1880):13193A.Birlinger,ed.,"LebenheiligeralemannischerFrauendes14./15.Jahrhunderts,4:DieNonnenvonKirchbergbei Hagerloch,"Alemannia11(1883):120F.W.E.Roth,ed.,''AufzeichnungenberdasmystischeLebenderNonnenvonKirchbergbeiSulz,"Alemannia21(1893): 10348H.ZeIlerWerdmllerandJ.Bchtold,eds.,"DieStiftungdesKlosterstenbachunddasLebenderseligenSchwesterndaselbst,"ZrcherTaschenbuch N.F.12(1889):21376A.Birlinger,ed.,"LebenheiligeralemannischerFrauendes14./15.Jahrhunderts,5:DieNonnenvonSt.KatharinenthalbeiDieszenhofen," Alemannia15(1887):15084andKarlBihlmeyer,ed.,"MystischesLebenindemDominikanerinnenklosterWeilerbeiEsslingenim13.und14.Jahrhundert," WrttembergischeVierteljahrsheftefrLandesgeschichteN.F.25(1916):6193.SomeoftheseworksarecitedanddiscussedinBrowe,DieWunderWalter Muschg,DieMystikinderSchweiz,12001500(Frauenfeld:Huber,1935),pp.20541andLouisCognet,Introductionauxmystiquesrhnoflamands(Paris: DescledeBrouwer,1968),pp.196201andpassim. 43.Dumoutet,CD,p.125.Gerson,acentralfigureinthefourteenthandfifteenthcenturydebateoverwomen'svisions,wassuspiciousofBridgetofSwedenbut sympathetictoJoanofArc.Ingeneral,hefeltthatwomen'sreligiousenthusiasmwasexcessiveandsuspectseeJohnGerson,Deexaminationedoctrinarum,pt.1. considerations2aand3a,inJohnGerson,JoannisGersonii...omniaopera,ed.LouisElliesDupin,5vols.(Antwerp,1706),vol.1,pp.1426quotedinJulian, BookofShowings,ed.ColledgeandWalsh,vol.1,p.151.ButGerson'sDeprobationsspiritumprovidedtestsforauthenticatingvisions. 44.Lerner,HeresyoftheFreeSpiritVauchez,LaSaintet,pp.43948WeinsteinandBell,SS,pp.22832.Onmalesuspicionofvisionarywomen,seealso OttoLanger,"ZurdominikanischenFrauenmystikimsptmittelalterlichenDeutschland,"andDieter


R.Bauer,"Diskussionberblick,"inDinzelbacherandBauer,Frauenmystik,pp.34146,373. 45.OnmedievalmisogynyseeHentsch,LaLittraturedidactiqueAugustWulff,DiefrauenfeindlichenDichtungenindenRomanischenLiteraturendes MittelaltersbiszumEndedesXIII.Jahrhunderts,RomanischeArbeiten,ed.CarlVoretzsch,vol.4(Halle:Niemeyer,1914)VernL.Bullough,"MedievalMedical andScientificViewsofWomen,"Viator4(1973):48793EleanorC.McLaughlin,"EqualityofSouls,InequalityofSexes:WomeninMedievalTheology,"in RosemaryRuether,ed.,ReligionandSexism:ImagesofWomenintheJewishandChristianTraditions(NewYork:SimonandSchuster,1974),pp.21366 MarieThrsed'Alverny,"Commentlesthologiensetlesphilosophesvoientlafemme?"LaFemmedanslescivilisationsdesXeXIIIesicles:Actesducolloque tenuPoitiersles2325septembre1976,Cahiersdecivilisationmdivale20(1977):10529andBornstein,''Antifeminism."Therecentbibliographyon witchcraftisenormous:seeH.C.ErikMidelfort,"Witchcraft,MagicandtheOccult,"inStephenOzment,ed.,ReformationEurope:AGuidetoResearch(St. Louis:CenterforReformationResearch,1982),pp.183209.Forthetheorythattheromanticizationofwomen(inthecultoftheVirginandincourtlylove)maybe causallylinkedtothepersecutionofwomen,seeJeffreyB.Russell,WitchcraftintheMiddleAges(Ithaca:CornellUniversityPress,1972),p.284butseealsoE. W.Monter,"ThePedestalandtheStake:CourtlyLoveandWitchcraft,"inBridenthalandKoonz,BecomingVisible,pp.11936.Foradiscussionofthewitchasan imageofdisorderor"misrule"(i.e.,aninversionofordinarysocialstructuresandvalues),seeStuartClark,"Inversion,MisruleandtheMeaningofWitchcraft,"Past andPresent87(May1980):98127.Responsiblescholarshiponwitchcrafthaspaidsurprisinglylittleattentiontotheimagesofwomanentailedinbothwitchbelief andwitchpersecution.Fortwoworksthatdotreatthistopic,seeThomasForbes,TheMidwifeandtheWitch(NewHaven:YaleUniversityPress,1966)and ChristinaLarner,EnemiesofGod:TheWitchHuntinScotland(London:ChattoandWindus,1981),esp.pp.34.OntheMalleusmaleficarumitself,themost extremeexampleofmedievalmisogyny,seeSydneyAnglo,"EvidentAuthorityandAuthoritativeEvidence:TheMalleusMaleficarum,"inS.Anglo,ed.,The DamnedArt:EssaysintheLiteratureofWitchcraft(London:RoutledgeandKeganPaul,1977),pp.131. 46.Anumberofwomensaintsweresuspectedofwitchcraftordemonicpossessione.g.,CatherineofSiena,LidwinaofSchiedam,andColumbaofRieti,all discussedinchapters4and5below. 47.Twentiethcenturyscholarshiphasbeeninagreementonthebasiccharacteristicsofwomen'sspirituality.See,forexample,Taylor,MedievalMind,vol.1,pp. 45886Leclercq,"MedievalFeminineMonasticism,"pp.6566andtheworkscitedinBynum,JM,pp.1419,17073,24762.Thequantitativeworkof Vauchez,LaSaintet,andWeinsteinandBell,SS,pp.22038,basicallysupportstheseearlierinterpretations.WeinsteinandBellargue(SS,p.237)thattherewas a"masculinetype"ofsaint(aholderoftemporalorecclesiasticalpower,amissionaryorpreacher,aheroicpublicfigure),calledmasculinebecausesuchapattern waslimitedtomen.Buttheycallthecontrastingtypeofsaint(characterizedbypenitentialasceticism,mysticalecstasy,andsupernaturalsigns,especiallyvisionsand miraculousbodilychanges)"androgynous"ratherthan"feminine"becausesuchspiritualconcerns,althoughmoreprominentinwomen'slives,arefound


inmen'salso.If,however,apietycanbecharacteristicofwomenonlyifitislimitedtothembycanonlaworsocialconvention,therecanbenopietycharacteristic ofwomenbecausethereisnoreligiousroleexclusivetothem(nunbeingonlyafemaleversionofmonkandbeguinehavingamalecounterpart,beghard).Itseems better,therefore,tospeakofawomen'spietywhenwefind,aswedointhethirteenthtothefifteenthcentury,certaindevotionalemphases(forexample,suffering) significantlymorepopularwithwomen,especiallyiftheseemphasesare(asIargueinchapter9below)closelytiedtoculturalstereotypesof"thefemale."The compositepictureofwomenmysticsinElizabethPetroff,ConsolationoftheBlessed(NewYork:AltaGaiaSociety,1979),pp.182,overinterpretsthe evidenceinitstheoryof"sevenstages"andoveremphasizesthe"feminine"elementinvisions,butithasbrilliantinsights.Onthegeneralquestion,seethewise wordsofDronke,WW,pp.xxi.SeealsoPeterDinzelbacher,''EuropischeFrauenmystikdesMittelalters.Einberblick,"inDinzelbacherandBauer, Frauenmystik,pp.1123. 48.Boltonmakesthispointin"VitaeMatrum,"p.260. 49.Seebelow,chap.4andSimoneRoisin,"LaMthodehagiographiquedeThomasdeCantimpr,"MiscellaneahistoricainhonoremAlbertideMeyer,2vols. (Louvain:BibliothquedeI'Universit,1946),vol.1,p.552. 50.WeinsteinandBell,SS,pp.1947.Thetablesonpp.12337indicatethatofthe646malesaintssurveyed,357(55percent)convertedasteenagersandonly96 (15percent)aschildrenof172femalesaints,55(31percent)convertedaschildrenand58(34percent)asadolescents.Ihavediscussedthesignificanceofthis findingatgreaterlengthinCarolineW.Bynum,"Women'sStories,Women'sSymbols:ACritiqueofVictorTurner'sTheoryofLiminality,"inFrankReynoldsand RobertMoore,eds.,AnthropologyandtheStudyofReligion(Chicago:CenterfortheScientificStudyofReligion,1984),pp.10525.Seealsobelow,chap.10n. 51. 51.Seebelow,chap.4.OnUmilianadeiCerchi,seeVauchez,LaSaintet,p.244. 52.See,forexample,thecaseofFrancescade'PonzianiofRome,inWeinsteinandBell,SS,pp.3940. 53.SeeBynum,"Women'sStories,Women'sSymbols." 54.WeinsteinandBell,SS,pp.22038Vauchez,LaSaintet,pp.24356. 55.Seebelow,pp.7677,200201,and21011. 56.AttheprayersofTiedalaofNivelles,amonkofVillersreceivedtheChristchildathisbreastseeMcDonnell,Beguines,p.328andBrowe,DieWunder,p. 106.ElizabethPetroff(Consolation,p.74)pointsoutthattheItalianwomensaintsshehasstudiednursedonlyfromChrist,neverfromMary,intheirvisions.Anun ofTss,however,receivedthe"pure,tenderbreast"ofMaryintohermouthtosuckbecauseshehelpedMaryreartheChristchild(Tss,pp.5455).AndLukardis ofOberweimarhadavisionofMarynursingJesusuponasking,shereceivedMary'sbreasttodrinkfromandtasted"greatdelightbeyondhumansweetness"(Lifeof Lukardis,AB18[1899]:31819).FormenwhonursedfromMary,seebelow,chap.9n.56. 57.Seeabove,n.47ErnstBenz,DieVision:ErfahrungsformenundBilderwelt(Stuttgart:Klett,1969)andPeterDinzelbacher,VisionundVisionsliteraturim Mittelalter(Stuttgart:Hiersemann,1981),pp.22628.Onthebasisofthetablesonpp.12337ofWeinsteinandBell,SS,itappearsthatwomensaints,whowere about18percentof


thosecanonized,accountforabouthalfofthesaintswhowereespeciallydevotedtoJesusbutforonlyaboutathirdofthesaintscharacterizedbydevotionto Mary.Suchastatisticdoesnotsupportthenotionthatwomenturnedespeciallytofemalefiguresasmediators.Insofarasthesewomendiddisplaysomewhat moreattachmenttoMarythandidmen,thefactseemsaccountedforbythegreateraffectivityoffemalepietygenerally:womenweremoreinterestedinall membersoftheHolyFamily(includingJoseph,Anne,andJoachim)thanweremen.Roisin,L'Hagiographie,pp.108,111120,hasfoundthatinthirteenth centuryCistercianvisionsfromthenorthofEurope,theVirginismoreimportanttomen.ThehumanityofChristis,however,moreimportanttowomen. 58.WeinsteinandBell,SS,p.216. 59.Vauchez,LaSaintetWeinsteinandBell,SSKieckhefer,UnSGoodich,"ContoursofFemalePiety."Onreclusesandtheeremiticallife,seeLouisGougaud, Ermitesetreclus:Etudessurd'anciennesformesdeviereligieuse(Ligug:AbbayeSaintMartindeLigug,1928),andL'EremitismoinOccidenteneiSecoliXI eXII,Pubblicazionidell'UniversitcattolicadelSacroCuore,MiscellaneadelCentrodiStudiMedioevali4Contributi3ser.,Varia4(Milan:SocietEditriceVitae Pensiero,1965). 60.OnAngela,seebelow,chap.4onMechtild,seeBynum,JM,pp.22847onChristina,seeTalbot,LifeofChristinaofMarkyate,andChristopherJ. Holdsworth,"ChristinaofMarkyate,"inBaker,MW,pp.185204onCatherineofSiena,seebelow,chap.5. 61.SeeBynum,JM,pp.24047,25255Goodich,"ContoursofFemalePiety"Roisin,L'Hagiographie,pp.113,129. 62.SeeColumbaHart,IntroductiontoHart,Hadewijch:Works,p.4.OnHadewijch,seebelow,chap.5. 63.Vauchezindeedadmitsthis(LaSaintet,pp.25556). 64.Seebelow,chap.4,fortheFlemishsaints,especiallyLidwinaofSchiedam,andchap.5forthetwoItalianCatherines,ofSienaandofGenoa,andforBeatriceof Nazareth. 65.Homeyimagesareverycommoninwomen'svisions.See,forexample,mydiscussionofthenunsofHelftainBynum,JM,pp.170262ElsbetStagel'saccount ofthevisionsofthenunsofTssinTssthevisionsofthelaywomanMargeryKempe,inS.B.MeechandHopeEmilyAllen,eds.,TheBookofMargeryKempe, EarlyEnglishTextSociety212(London:OxfordUniversityPress,1940)andPetroff'sdiscussionofItaliannunsandtertiariesinConsolation.Forexamplesof women'svisionsofJesusasbaby,seeBynum,"WomenMystics,"p.189.Menalsousedhomeyimagerysee,forexample,thediscussionofSusoinchap.3below. 66.OnGertrudeofHelfta,seeBynum,JM,pp.186209onGertrudevanOosten,seebelow,chap.3,andonMargeryKempe,below,chap.7. 67.Seebelow,pp.26367and29093. 68.Forexamplesofmalewriterswhosawwomenasweakandurgedthemtospiritualvirility,seeJohnTauler,Sermon33,FourthSermonforCorpusChristi,in Tauler,DiePredigten,pp.12930LifeofIdaofLouvain,AASSApril,vol.2(Paris,1865),p.159,wheretheanonymous(almostcertainlymale)compiler, workingfrommaterialprovidedbyIda'sconfessor,saysthatIda"wasnotawomanorlazybutlikea


strongmaninconstancy"andthatthedevilwasfrustratedbyher"manlyboldness"LifeofJulianaofCornillon,AASSApril,vol.1(Paris,1866),p.442,wherea maleauthorwritesthatJulianahastenedtoperfection,"hersexforgotten,"althoughshe"hadcorporealfragilitybehindwhichmanyhidetheircowardiceand lukewarmness''LifeofIdaofLau,AASSOctober,vol.13(Paris,1883),p.112,whereamaleauthorsaysIda"waslikeamanseizingweapons"andfoughtthe devil"virilely,notinawomanlyway."ThomasofCelano,inhisprefatoryletter(addressedtoPopeAlexanderIV)totheLifeofClareofAssisi(inFrancesco Pennacchi,ed.,LegendasanctaeClaraevirginis,SocietinternazionaledistudiFrancescaniinAssisi[Assisi:Tipografiametastasio,1910],pp.13),callsClare a"modelfortheweakersex"andstressesherimitatioMarine(incontrasttoFrancis'simitationofJesus),althoughClare'sownwritings,editedinthesame volume,stressimitatioChristi.Seealsochap.5belowonCatherineofSienaandUmbertoMattioli,"LaTipologia'virile'nellabiografiaenellaletteratura cateriniana,"Atti,CongressoInternazionalediStudiCateriniani,SienaRoma,2429Aprile1980(Rome:CuriaGeneraliziaO.P.,1981),pp.198222. 69.Caesarius,Dialogus,Distinctio8,chaps.7178,vol.2,pp.14148,areonconfessorsDist.8,chaps.7989,vol.2,pp.14856,areaboutvirgins. 70.Seeabove,n.1,andbelow,chap.2atn.119. 71.Seeabove,n.68andWeinsteinandBell,SS,pp.23536. 72.JohnAnson,"TheFemaleTransvestiteinEarlyMonasticism:TheOriginandDevelopmentofaMotif,"Viator5(1974):132. 73.See,forexample,theworksonthequestionofordinationcitedinn.38aboveMcNamaraandWemple,"PowerofWomen"idem,"SanctityandPower"E. McLaughlin,"EqualityofSouls"RosemaryRuether,"MisogynismandVirginalFeminismintheFathersoftheChurch,"inRuether,ReligionandSexism,pp.15083 MarinaWarner,AloneofAllHerSex:TheMythandtheCultoftheVirginMary(NewYork:Knopf,1976)idem,JoanofArc:TheImageofFemaleHeroism (NewYork:Knopf,1981)CarolP.Christ,"HereticsandOutsiders:TheStruggleoverFemalePowerinWesternReligion,"Soundings61.3(1978):26080and Petroff,Consolation. 74.Arelatedproblemisthetendencyofrecentwritersonspiritualitytoignorewomen'sperspective.Vauchez,LaSaintet,andWeinsteinandBell,SS,forexample, treatthenotionofwomanassexualtemptation,foundinmisogynistwriting,asthekeyreligiousconcernbearingdownonwomen.GeorgesDuby,TheKnight,the LadyandthePriest:TheMakingofModernMarriageinMedievalFrance,trans.BarbaraBray(NewYork:Pantheon,1983),treatsmarriageastheexchangeof womenbymen.Allthreeauthors,althoughanimatedbyarhetoricallyheightenedconcernforwomen'ssuffering,treatwomanasobject,viewedby,manipulatedby, subjugatedby,oradmiredbymen,ratherthanassubject,generatingherownspirituality. 75.Forapsychoanalyticinterpretationofwhyfoodisasymbolofmutilationandaggression,seeLillianMalcove,"BodilyMutilationandLearningtoEat," PsychoanalyticQuarterly2(1933):55761.SeealsoPeggyReevesSanday,DivineHungerandCannibalMonsters:CannibalismasaCulturalSystem (Cambridge:CambridgeUniversityPress,forthcoming).Sandayshowstheconnection,inanumberofcultures,betweencannibalism(actualormetaphorical)and widespreaduseofsymbolstakenfromphysiological


processes.Forastartlingevocationoftheeucharistascannibalism,seeFrancineduPlessixGray,WorldwithoutEnd(NewYork:PBJ,1982),pp.13637. 2 FastandFeast: TheHistoricalBackground 1.PopeLeotheGreat,Sermon20,NinthSermonfortheDecemberFast,pars.23,PL54,cols.18990.OnLeo'snotionoffasting,seeAlexandreGuillaume, JeneetcharitdansI'gliselatinedesoriginesauXIIesicleenparticulierchezsaintLonleGrand(Paris:EditionsS.O.S.,1954).Forthesamesentiment, seePeterChrysologus(d.450),Sermon41,PL52,col.317:"Fratres,sintdeliciaepauperumnostrajejunia,uttemporalejejuniumnostruminaeternaspossitnobis deliciasimmutari." 2.Seeabove,pp.1and34. 3.Augustine,CityofGod,bk.10,chap.6,PL41,col.284CHilary,TractatusinCXXVpsalmum,par.6,PL9,col.688BCidem,DeTrinitate,bk.8,chaps. 1314,PL10,cols.24647,esp.col.246:"Eosnunc,quiinterPatremetFiliumvoluntatisingeruntunitatem,interrogoutrumnepernaturaeveritatemhodieChristus innobissit,anperconcordiamvoluntatis?SienimvereVerbumcarofactumest,etverenosVerbumcarnemcibodominicosumimusquomodononnaturaliter manereinnobisexistimandusest,quietnaturamcarnisnostraejaminseparabilemsibihomonatusassumpsit,etnaturamcarnissuaeadnaturamaeternitatissub sacramentonobiscommunicandaecarnisadmiscuit?Itaenimomnesunumsumus,quiaetinChristoPaterest,etChristusinnobisest.QuisquisergonaturaliterPatrem inChristonegabit,negetpriusnonnaturalitervelseinChristo,velChristumsibiinessequiainChristoPater,etChristusinnobis,unuminhisessenosfaciunt.Sivere igiturcarnemcorporisnostriChristusassumpsit,etverohomoille,quiexMarianatusfuit,Christusest,nosqueveresubmysteriocarnemcorporissuisumimus(etper hocunumerimus,quiaPaterineoest,etilleinnobis)quomodovoluntatisunitasasseritur,cumnaturalispersacramentumproprietas,perfectaesacramentumsit unitatis." 4.AlanofLille,Summadeartepraedicatoria,chap.34:Dejejunio,PL210,col.177D. 5.Aquinas,ST,II,IIae,q.148:Degula,art.3,vol.43,pp.12224.ForthepatristicnotionthatAdam'ssinwasgluttony,seeHerbertMusurillo,"TheProblemof AsceticalFastingintheGreekPatristicWriters,"Traditio12(1956)17n.43. 6.Ambrose,Hymn3:Splendorpaternaegloriae,inA.S.Walpole,EarlyLatinHymns(London:CambridgeUniversityPress,1922),p.38.BecauseLatinhymns losesomuchinliteraltranslationandmaybefamiliartomanyreaders,Ihavecitedthemintheoriginal. 7.ClemensBlume,ed.,Analectahymnicamediiaevi,vol.54(Leipzig:Reisland,1915),p.257trans.adaptedfromJosephConnelly,HymnsoftheRoman Liturgy(Westminster,Md.:NewmanPress,1957),p.130.Forothereucharisticsequencesofthethirteenthandfourteenthcenturies,seeBlume,Analectahymnica, vol.54,pp.258ff. 8.Cyprian,Letter63,PL4,cols.37289,esp.384B:"Quoetipsosacramentopopulusnosterostendituradunatusut,quemadmodumgranamultainunumcollecta etcommolitaetcommistapanemunumfaciunt,sicinChristo,quiestpaniscoelestis,unum


sciamusessecorpus,cuiconjunctussitnosternumerusetadunatus."SeealsoAdalbertHamman,"Mystreeucharistique,"inDS,vol.4,pt.2(1961),cols.1570 71. 9.ForCyprian,seeabove,n.8GregorytheGreat,40homiliaruminEvangelia,Homily15,par.5,PL76,col.1137.AquinasquotesGregoryinST,II,IIae,q. 147,art.2,vol.43,p.94. 10.ForLeo,seeabove,n.1andseeGuillaume,Jene,p.83. 11.SeeJ.A.MacCullough,"Fasting,"EncyclopediaofReligionandEthics,ed.JamesHastingsetal.,13vols.(NewYork:Scribner's,19081927),vol.5,pp. 75965HenriLeclercq,"Jenes,"Dictionnaired'archologiechrtienneetdeliturgie,ed.FernandCabrolandHenriLeclercq,vol.7,pt.2(Paris:Letouzeyet An,1927),cols.2481504A.Villien,''Abstinence,"inDictionnairededroitcanonique,vol.1(Paris:LetouzeyetAn,1935),cols.12935PlacideDeseille, "Jene,"inDS,vol.8,pt.2(1974),cols.116479F.Mugnier,"Abstinence,"inDS,vol.1,cols.11233RudolphArbesmann,"FastingandProphecyinPaganand ChristianAntiquity,"Traditio7(19491951):172Goody,Cooking,CuisineandClass,pp.11619andEricN.Rogers,Fasting:ThePhenomenonofSelf Denial(Nashville:Nelson,1976),aninterestingpopularaccountthat,unfortunately,lacksadequatedocumentation. 12.MacCullough,"Fasting,"p.760Deseille,"Jene,"col.1165Arbesmann,"FastingandProphecy,"pp.78. 13.Seeworkscitedinn.11above,andMusurillo,"AsceticalFasting,"pp.164. 14.Seeesp.Musurillo,"AsceticalFasting,"p.62.Ofcourse,theearlyChristianswerealsoreactingagainstJewishfoodprohibitionsand,therefore,againstfood prohibitionsasameansofgroupdefinition.MarcelSimon("Del'observancerituellel'ascse,"RevuedeI'histoiredesreligions193[1978]:77)suggeststhatfree accesstofoodwasboughtbytherenunciationofmarriage.ButcompareGoody,Cooking,CuisineandClass,pp.14445. 15.Augustine,Sermon207,ThirdSermonforLent,par.1,PL38,col.1043. 16.Augustine,Sermon210,SixthSermonforLent,chap.10,par.12,PL38,col.1053.Onthenewawarenessofthepoorinthelateantiqueworld,seeEvelyne Patlagean,PauvretconomiqueetpauvretsocialeByzance:4e7esicles(Paris:Mouton,1977). 17.Maximus,Sermon50a,par.3,ed.AlmutMutzenbecher,Corpuschristianorum,serieslatina23(Turnhout:Brepols,1962),p.203. 18.Walpole,Hymns,pp.32021. 19.IsidoreofSeville,Deecclesiasticisofficiis,bk.1,chap.44,PL83,col.776B. 20.Arbesmann,"FastingandProphecy,"p.3. 21.ClementofAlexandria,Eclogaepropheticae,14.2,ClemensAlexandrinus,ed.OttoSthlin,vol.3,DiegriechischenchristlichenSchriftstellerderersten Jahrhunderte17(Berlin:AkademieVerlag,1970),p.140quotedandtrans.byMusurillo,"AsceticalFasting,"p.13. 22.AbbotNilus,Tractatusdeoctospiritibusmalitiae,chap.1,PG79,col.1145Bquotedandtrans.byMusurillo,"AsceticalFasting,"p.16. 23.[Pseudo]Athanasius,Devirginitate,chap.7,ed.EduardF.vonderGoltz,TexteundUntersuchungenzurGeschichtederaltchristlichenLiteraturN.F.14 (Leipzig:Hinrichs,1905),p.41quotedandtrans.byMusurillo,"AsceticalFasting,"p.17. 24.AlineRousselle,"AbstinenceetcontinencedanslesmonastresdeGaulemri


dionalelafindeI'antiquitetaudbutdumoyenge:Etuded'unrgimealimentaireetdesafonction,"HommageAndrDupont:Etudesmdivales languedociennes(Montpellier:FdrationHistoriqueduLanguedocMediterranenetduRousillon,UniversitPaulValery,1974),pp.23954. 25.JohnCassian,Institutionscnobitiques,bk.5,chap.11,ed.JeanClaudeGuy,SC109,Sr.mon.17(1965),p.206.CassianevenattributedSodom'sfallto gluttonyseeJohnBoswell,Christianity,SocialToleranceandHomosexuality:GayPeopleinWesternEuropefromtheBeginningsoftheChristianErato theFourteenthCentury(Chicago:UniversityofChicagoPress,1980),p.98. 26.Jerome,Letter54,par.9,SanctiEusebiiHieronymiepistulae,pt.1,ed.IsidoreHilberg,Corpusscriptorumecclesiasticorumlatinorum54(Vienna:Tempsky undFreytag,1910),p.476. 27.Seeworkscitedabove,n.11,andF.Cabrol,"Carme,"inDictionnairededroitcanonique,vol.2(1937),cols.134554. 28.EmberDayswereWednesday,Friday,andSaturdayfasts,observedinthefourth,seventh,andtenthmonthsoftheyear.SeeArbesmann,"Fastingand Prophecy,"p.44. 29.Arbesmann,"FastingandProphecy,"pp.35,3437. 30.SeeMugnier,"Abstinence."OnIrishpractice,seeLouisGougaud,ChristianityinCelticLands:AHistoryoftheChurchesoftheCelts,TheirOrigin,Their Development...,trans.MaudJoynt(London:SheedandWard,1932),pp.9699andJohnRyan,IrishMonasticism:OriginsandEarlyDevelopment(London: Longmans,Green,1931),pp.38697.Ryan(p.392)tellsofthreeIrishmonkswhodiedfromfasting. 31.RuleofSt.Benedict,chaps.3941,43,49,inTimothyFryetal.,eds.,RB1980(Collegeville,Minn.:LiturgicalPress,1981),pp.23840,24244,252.(See alsop.433.)Inadditiontothefastsprescribedbythechurch,Benedictalsoprescribesfastsi.e.,daysonwhichthebrothersdonoteatuntilafterNone(about3:00 P.M.)onWednesdaysandFridaysfromPentecosttoSeptember14andoneveryweekdaythereafteruntilLent.SeeDavidKnowles,"TheDietofBlackMonks," DownsideReview52,n.s.33(1934):27390,esp.p.276reprintedinidem,TheMonasticOrderinEngland:AHistoryof1tsDevelopmentfromtheTimesof St.DunstantotheFourthLateranCouncil,9401216(19402ded.,Cambridge:CambridgeUniversityPress,1963),pp.45665.Thedietaryregimeof WesternmonksbeforeBenedictwasmoresevere:seeRousselle,"Abstinence,"p.246. 32.Mugnier,"Abstinence,"col.122. 33.JohnChrysostom,HomilyonMatthew4647,PG58,col.480quotedandtrans.byMusurillo,"AsceticalFasting,"p.41.Johngoesontosaythathedoesnot wishtodenigrateortrivializefastingbut,rather,topointoutthatfastingisnotsufficientforsalvationifotherpracticesandvirtuesareneglected. 34.GregoryofNyssa,Devirginitate,chap.21,PG46,col.401CquotedbyMusurillo,"AsceticalFasting,"p.40. 35.Musurillo,"AsceticalFasting,"pp.5051. 36.CuthbertButler,ed.,TheLausiacHistoryofPalladius...,2vols.(Cambridge:CambridgeUniversityPress,18981904),vol.2,p.52.SeeArbesmann, "FastingandProphecy,"p.34 37.JohnChrysostom,Destudiopraesentium,Homily5,PG63,col.489quotedand


trans.byMusurillo,"AsceticalFasting,"p.7.Chrysostomgoesontopointoutthatthesewomencaredforthesickandpreparedfoodforothers.Womenalso advisedfoodasceticism.IntheSayingsoftheFathers,acertainSyncleticaisreportedasurgingherfollowersnottobeseducedbythedelightsoftheworld.She admonishes:"Othersholdasvaluabletheartofcookingbutyou,throughfastsandvilefood,gobeyondtheminabundanceofnourishment"(Apopththegmata Patrum,sayingsofSyncletica,par.5[87],PG65,col.422C). 38.RomanosMelodes,Hymnes,ed.JosGrosdidierdeMatons,5vols.,SC99,110,114,128,283(19641981),vol.1,pp.32837. 39.Ibid.,pp.364403. 40.Ibid.,p.390. 41.Ibid.,pp.39294. 42.Ibid.,vol.3,pp.11031. 43.Ibid.,vol.4,p.550. 44.Ibid.,p.556. 45.Ibid.,vol.3,p.168. 46.Foramodernstatementofthissensibility,seeAlexandreSchmemann,"Jeneetliturgie,"Irenikon27(1954):292301. 47.Ingeneral,WesternChristiansthroughouttheMiddleAgeswererequiredbothtofast(thatis,torefrainfromeatinguntileveningormidafternoon)andtoabstain frommeatand,usually,fromotherfoodofanimaloriginonallFridaysandSaturdays,onthequarterdays,onthevigilsofafewgreatfeasts(e.g.,Christmas),andon allthedaysofLentexceptSundays.Completefastwasrequiredbeforereceptionofcommunion.Forabriefdiscussion,seeP.M.J.Clancy,"FastandAbstinence," NewCatholicEncyclopedia(NewYork:McGrawHill,1967),vol.5,pp.84650.Onabstinence,seeAquinas,ST,II,IIae,q.147,art.8,vol.43,pp.11416. AsAquinasnotes,therewaslocalvariationinwhetherabstinencefromeggs,milk,andmilkproductswasrequired. 48.Lambert,HistoryoftheCountsofGuines,chap.113,MGH.SS,vol.24(1879repr.ed.NewYork:KrausReprint,1964),p.615citedinDuby,The Knight,theLadyandthePriest,p.263. 49.BarbaraKetchamWheaton,SavoringthePast:TheFrenchKitchenandTablefrom1300to1789(Philadelphia:UniversityofPennsylvaniaPress,1983),pp. 1214andBridgetAnnHenisch,FastandFeast:FoodinMedievalSociety(UniversityPark:PennsylvaniaStateUniversityPress,1976),pp.2858.Fora descriptionofmedievaltreatmentsoffoodfromamedicalpointofview,seeLynnThorndike,"ThreeTractsonFoodinBaselManuscripts,"BulletinoftheHistory ofMedicine8(1940):35556. 50.Mugnier,"Abstinence,"cols.12329E.Vacandard,"Carme,jenede,"inDTC,vol.2,cols.173744Guillaume,Jene,pp.15563GerdZimmermann, OrdenslebenundLebensstandard.Die"CuraCorporis''indenOrdensvorschriftendesabendlndischenHochmittelalters,BeitrgezurGeschichtedesalten MnchtumsunddesBenediktinerordens32(Mnster:Aschendorff,1973),pp.4051. 51.Aquinas,ST,II,IIae,q.147,art.4,vol.43,pp.98104. 52.Wheaton,SavoringthePast,p.12.Seealsobelow,n.124. 53.SeeColker,AnalectaDublinensia,p.57andKnowles,"Diet,"pp.28082. 54.Aquinas,ST,II,IIae,q.148,arts.46,vol.43,pp.12434.


55.Zimmermann,Ordensleben,pp.4041. 56.Mugnier,"Abstinence,"cols.12329.SeealsoPeterDamian'saccountsofSaintsRomuald,Venerius,andRudolph,PL144,cols.96162,97475,1011and idem,DeQuadragesimaetQuadragintaduabusHebraeorummansionibus,PL145,cols.54345. 57.OnthispointseeGilesConstable,AttitudestowardSelfInflictedSufferingintheMiddleAges,NinthStephenJ.Brademas,Sr.,Lecture(Brookline,Mass.: HellenicCollegePress,1982),pp.2122. 58.Bonaventure,Vitismystica,additamentum5,chap.42,par.135,Operaomnia,vol.8(Quaracchi:CollegiumS.Bonaventurae,1898),pp.21617.Theconcern for"circumstances"herereflectsadesiretoavoidscandalizingothers. 59.PeterofCelle,Sermon15,PL202,col.681CD.SeealsotheLentenSermonsofIsaacofStella,PL194,cols.1787f.,esp.col.1791. 60.PetertheChanter,Verbumabbreviatum:Opusmorale,chap.133,PL205,col.328. 61.BernardofClairvaux,Sermon3forLent,pars.24,PL183,cols.175C76C. 62.QuotedfromSuso'slettertoElsbetStagelinLifeofSuso,inSuso,DeutscheSchriften,p.107trans.M.AnnEdwardinTheExemplar:LifeandWritingsof BlessedHenrySuso,O.P.,ed.NicholasHeller,2vols.(Dubuque:PrioryPress,1962),vol.1,p.103. 63.AlanofLille,Summa,chap.34,PL210,cols.17678quotedpassagesat176D77A,178AC. 64.Aquinas,ST,II,IIae,qq.14647,vol.43,pp.82117,esp.pp.92,106. 65.Seebelowatnn.1034. 66.Quoted,respectively,fromthe"Pange,lingua":"Observatalegeplene/Cibusinlegalibus,/Cibumturbaeduodenae/Sedatsuismanibus"(AquinasByrnes,ed.,The HymnsoftheDominicanMissalandBreviary[St.Louis:Herder,1943],p.168)and"Sacrissolemniis":"Noctisrecolitur/Cenanovissima,/QuaChristus creditur/Agnumetazyma/Dedissefratribus/Juxtalegitima/Priscisindultapatribus"(ibid.,p.172). 67.Ibid.,p.174.Seealso"Lauda,Sion,Salvatorem"inibid.,pp.18088. 68.Tubach,Index.Seeentriesfor"abstinence,""fasting,""bread,""loavesandfishes,"''meat,""host,"and"chalice." 69.Onearlymonasticism,seeDerwasJ.Chitty,TheDesertaCity:AnIntroductiontotheStudyofEgyptianandPalestinianMonasticismundertheChristian Empire(1966repr.London:Mowbray,1977).Forapsychoanalyticinterpretationofmonasticismasasubstituteformartyrdom,seeCarlA.Mounter,"Guilt, MartyrdomandMonasticism,"JournalofPsychohistory:AQuarterlyJournalofChildhoodandPsychohistory,9.2(Fall1981):14571. 70.SeeP.Brown,"ResponsetoGrant." 71.SeeVictorSaxer,Morts,martyrs,reliquesenAfriquechrtienneauxpremierssicles:LesTmoignagesdeTertullien,CyprienetAugustinlalumire deI'archologieafricaine,Thologiehistorique55(Paris:Beauchesne,1980),pp.14149. 72.See,forexample,Bede'saccountofPopeGregory'sletterof601tothemissionaryMellitusBede,AHistoryoftheEnglishChurchandPeople,bk.1,chap. 30,trans.LeoSherleyPriceandR.E.Latham(rev.ed.,Harmondsworth:Penguin,1968),p.87.SeealsoRonaldC.Finucane,MiraclesandPilgrims:Popular BeliefsinMedievalEngland(Totowa:RowmanandLittlefield,1977),pp.3132.


73.WayneA.Meeks(TheFirstUrbanChristians:TheSocialWorldoftheApostlePaul[NewHaven:YaleUniversityPress,1983],p.158)pointsoutthat festivemealswerecommoninthevoluntaryassociationsoftheMediterraneanworldandthatourearliestevidenceaboutChristianitysuggeststhatoutsiderssawthe eucharistinthisway. 74.A.Hamman,E.Longpr,E.Bertaud,etal.,"Eucharistie,"inDS,vol.4,pt.2(1961),cols.15531648,esp.cols.156896. 75.RobertMurray,SymbolsofChurchandKingdom:AStudyinEarlySyriacTradition(London:CambridgeUniversityPress,1975),pp.7679,quoted passagesonpp.77and76,respectively.OnCyprianandRomanos,seeabove,nn.8,3845. 76.FeeleyHarnik,Lord'sTable,pp.13964.Meeks(FirstUrbanChristians,pp.15763)alsostressestheextenttowhich"thesingleloafusedintheritual symbolizestheunity...ofthecommunity."Heemphasizesthat"PaulusesthesymbolismoftheSupperritualnotonlytoenhancetheinternalcoherence,unity,and equalityoftheChristiangroup,butalsotoprotectitsboundariesvisvisotherkindsofculticassociation"(p.159). 77.SeeHamman,"Mystreeucharistique,"cols.155386,andJ.H.Strawley,"Eucharist,"EncyclopediaofReligionandEthics,vol.5,pp.54063. 78.Walpole,Hymns,pp.35051. 79.Ibid.,pp.34546.The"Sancti,uenite"istheoldesteucharistichymninexistence. 80.Dumoutet,CDF.BaixandC.Lambot,LaDvotionl'eucharistieetIeVIIecentenairedelaFteDieu(Gembloux:Duculot,1964)PeterBrowe,Die VerehrungderEucharistieimMittelalter(Munich:Hueber,1933)JulesCorblet,Histoiredogmatique,liturgiqueetarchologiquedusacrementde l'eucharistie,2vols.(Paris:SocitGnraledeLibrairieCatholique,18851886). 81.DecreesoftheFourthLateranCouncil,inHenryDenzinger,Enchiridionsymbolorum:Definitionumetdeclarationumderebusfideietmorum,34thed.,ed. A.Schnmetzer(Freiburg:Herder,1967),document802,p.260.Notethecloseconnectionbetweenthenotionoftheunityandexclusivityofthechurchandthe doctrinethattheeucharistisGod'sbodyandblood. 82.SeeBrowe,DieWunderDumoutet,CD.SeealsoEdouardDumoutet,LeDsirdevoirI'hostieetlesoriginesdeladvotionauSaintSacrement,Universit deStrasbourg(Paris:Beauchesne,1926). 83.Dumoutet,CD,pp.10910. 84.SeeAquinas,ST,III,qq.7576,vol.58,pp.52122.SeealsoDumoutet,CD. 85."Pange,lingua"inStephenGaselee,ed.,TheOxfordBookofMedievalLatinVerse(repr.Oxford:ClarendonPress,1937),p.144andByrnes,Hymns,p. 168trans.adaptedfromConnelly,Hymns,p.120.InwritingtheofficeforCorpusChristi,Thomasborrowedfromanearlieroffice.Theextentofhis"authorship"of thesehymnsisindoubtseeBaixandLambot,LaDvotion,pp.8991.SeealsoF.T.E.Raby,AHistoryofChristianLatinPoetryfromtheBeginningstothe CloseoftheMiddleAges,2ded.(Oxford:ClarendonPress,1953),pp.40214. 86."Sacrissolemniis,"inByrnes,Hymns,p.172trans.adaptedfromConnelly,Hymns,pp.12123. 87."Verbumsupernumprodiens,"inGaselee,MedievalLatinVerse,p.145trans.adaptedfromConnelly,Hymns,p.123.


88."Lauda,Sion,Salvatorem,"inGaselee,MedievalLatinVerse,pp.14647andByrnes,Hymns,pp.18088trans.adaptedfromConnelly,Hymns,p.126. 89.Dumoutet,CD,pp.150. 90.Seetheworkscitedinnn.74and80,above,esp.EmileBertaud,"Dvotioneucharistique:Esquissehistorique,"DS,vol.4,pt.2,cols.1621ff. 91.LionelRothkrug,"PopularReligionandHolyShrines:TheirInfluenceontheOriginsoftheGermanReformationandTheirRoleinGermanCulturalDevelopment," inJamesObelkevich,ed.,ReligionandthePeople,8001700(ChapelHill:UniversityofNorthCarolinaPress,1979),pp.3032. 92.LouisGougaud,"Etudesurlarclusionreligieuse,"RevueMabillon13(1923):8687. 93.SeeBaixandLambot,LaDvotion,p.67.Inhissynodalstatutes,OdoofSully,bishopofParis(11961208),requiredhisprieststoelevatethehost.The practiceexistedintheCistercianorderbefore1210seeMcDonnell,Beguines,p.311.SeealsoBrowe,DieVerehrung,p.35M.CamilleHontoir,"LaDvotionau saintSacrementchezlespremierscisterciens(XIIeXIIIesicles),"StudiaeucharisticaDCCanniaconditofestosanctissimiCorporisChristi(Antwerp:De NederlandscheBoekhandel,1946),pp.13256andAntonL.Mayer,"DieheilbringendeSchauinSitteundKult,"inOdoCasel,ed.,Heiligeberlieferung: AusschnitteausderGeschichtedesMnchtumsunddesheiligenKultes:...[fr]IldefonsHerwegen,BeitrgezurGeschichtedesAltenMnchtumsunddes Benediktinerordens,Supplementband(Mnster:Aschendorff,1938). 94.Browe,DieVerehrungJungmann,MassoftheRomanRite,vol.1,pp.11921,andvol.2,pp.206ff. 95.TheincidentiscitedbyRothkrug,"PopularReligion,"p.36,andbyAntonMayer,DieLiturgieindereuropaischenGeistesgeschichte:GesammelteAufstze, ed.E.vonSeverus(Darmstadt:WissenschaftlicheBuchgesellschaft,1971),p.45,referringtoEdouardDumoutet,L'lconographiedeI'introitduIerdimanchede I'avent...(1925),pp.3436,whichIhavebeenunabletoconsult. 96.SeeJohnMarienwerder,SeptililiumB.Dorotheae,treatise3:Deeucharistia,chap.2,ed.FranciscusHipler,inAB3(1884):409.Inhisworkonthelifeof Christ,LudolfofSaxonyassimilated"eating"to"seeing":''VeniasetnihilominusquotidieutvideasJesusinpraesepiospiritual,scilicetinaltari,utcarnissuaefrumento mereariscumanimalibussanctisrefici"(quotedinMaryImmaculateBodenstedt,The"VitaChristi"ofLudolphustheCarthusian,CatholicUniversityofAmerica StudiesinMedievalandRenaissanceLatinLanguageandLiterature16[Washington,D.C.:CatholicUniversityofAmericaPress,1944],p.133n.94). 97.Seeesp.BaixandLambot,LaDvotion,pp.75ff.andBertaud,"Dvotioneucharistique,"cols.162137. 98.Bertaud,"Dvotioneucharistique,"col.1632. 99.BaixandLambot,LaDvotion,pp.11323Gougaud,DAP,pp.75130andBynum,JM,pp.13233,173n.12,19193. 100.TheodorKlauser,AShortHistoryoftheWesternLiturgy:AnAccountandSomeReflections,trans.JohnHalliburton(2ded.,Oxford:OxfordUniversity Press,1979),pp.98103,120Jungmann,MassoftheRomanRite,vol.2,pp.37480C.N.L.Brooke,


"ReligiousSentimentandChurchDesignintheLaterMiddleAges,"BulletinoftheJohnRylandsLibrary,50.1(Autumn1967):1333. 101.Klauser,WesternLiturgy,p.110Jungmann,MassoftheRomanRite,vol.2,pp.38182BaixandLambot,LaDvotion,pp.4041Corblet,Histoire dogmatique,vol.1,pp.18891Browe,DieWunder,pp.9798. 102.Jungmann,MassoftheRomanRite,vol.2,pp.38185,41214.AmongCisterciansandDominicans,anablutionscupwasgiventocommunicants(usually aftermasswasover),anditsusecontinuedafterthechalicewaswithdrawninthelaterthirteenthcentury.SeeArchdaleKing,LiturgiesoftheReligiousOrders (London:Longmans,1955),pp.12930,372. 103.Aquinas,ST,III,q.80,art.12,replyobj.3,vol.59,pp.8485.SeealsoIII,q.76,art.2,vol.58,pp.96100. 104.Jungmann,MassoftheRomanRite,vol.2,p.364. 105.QuotedinYvesCongar,"ModlemonastiqueetmodlesacerdotalenOccidentdeGrgoireVII(10731085)InnocentIII(1198),"Etudesdecivilisation mdivale(IXeXIIesicles):MlangesoffertsEdmondRenLabande(Poitiers:C.E.S.C.M.,1973),p.159. 106.Quotedinibid. 107.FrancisofAssisi,"LettertoaGeneralChapter,"inFrancis,OpusculasanctipatrisFrancisciAssisiensis,ed.theFathersofSt.Bonaventure'sCollege, BibliothecaFranciscanaAsceticaMediiAevi1,2ded.(Quaracchi:CollegiumS.Bonaventurae,1949),pp.1023trans.B.FahyinOmnibus,p.105. 108.Brooke,"ReligiousSentiment." 109.JosephDuhr,"Communionfrquente,"DS,vol.2(1953),cols.123492,esp.cols.123671. 110.AlberttheGreat,CommentariiinIVSententiarum,dist.13,art.27,inAlbert,Operaomnia,ed.AugustBorgnet,vol.29(Paris:LudovicusVivs,1894),pp. 37880andLiberdesacramentoEucharistiae,Dist.4,tract.4,chap.3,inOperaomnia,vol.38(1899),p.432:"Dehisautemquimulieresomnidie communicant,videturmihiquodacriterreprehendendisunt:quianimiousuvilescerefaciuntsacramentum,velpotiusexlevitatemulierumputaturessedesideriumquam exdevotionecausatum."SeealsoDuhr,"Communionfrquente,"col.1260. 111.ThecrucialtextfromAugustine,quotedoverandoverinthediscussionsoffrequentcommunion,is"Credeetmanducasti,"Tractate25ontheGospelofJohn, chap.12,PL35,col.1602.AlberttheGreat,forexample,citesitinhiscommentaryontheFourthBookoftheSentences,Dist.9,Operaomnia,vol.29,p.212.In theMiddleAges,itwasoftenusedtoargueforsubstituting"spiritualcommunion"(i.e.,innermeditation)forreception.SeeDuhr,"Communionfrquente,"col.1246. 112.LifeofMargaretofCortona,AASSFebruary,vol.3,pp.341,344.Desirefortheeucharistandobsessivefearofreceivingitunworthilyarethemesthroughout Margaret'svita(seepp.30463passim). 113.GertrudetheGreat,Oeuvresspirituelles,ed.PierreDoyere,vol.2:LeHraut,SC139,Sr.mon.25(1968),pp.3037. 114.Ibid. 115.Seebelow,chap.4,forthecasesofMargaretofCortona,IdaofLouvain,Lid


winaofSchiedam,DorothyofMontau,AlpisofCudot,andColetteofCorbie.SeealsoDuhr,"Communionfrquente,"cols.126263,1268,forexamplesof latemedievalwomenwhoobtainedfrequentcommunionorweredeniedit. 116.IdaofLauwasdeniedthecupwhentheCistercianspassedlegislationforbiddingittonunswhowentintoecstasyatcommunion(LifeofIdaofLau,AASS October,vol.13,pp.11314)seeMcDonnell,Beguines,p.315n.140.SeealsoLifeofJulianaofCornillon,AASSApril,vol.1,pp.44546. 117.SeethecaseofDorothyofMontau,discussedbyKieckhefer,UnS,pp.2223. 118.JohnMarienwerdercommentsthatDorothyofMontau'shungerfortheeucharistwassovastthat,ifshehadbeenpermitted,shewouldhavesnatchedthehost fromthehandsofthepriestwithherteeth(SeptililiumB.Dorotheae,treatise3,chap.2,inAB3,p.409). 119.JamesofVitry,LifeofMaryofOignies,AASSJune,vol.5,p.568.Seealsoepigraphtochap.1andBynum,"WomenMystics." 120.Browe,DieWunderBynum,"WomenMystics." 121.Thenewemphasison"seeing"Godisreflectedintheincreasingnumberofmiraclesconnectedwithelevationratherthanreception.Inorders(e.g.,Franciscan nunsortertiaries)wherecommunionwasinfrequent,ecstasiestendedtocomeattheelevation.Eucharisticmiraclescouldeveninvolveknowingwhether"Christ"(i.e., theconsecratedhost)waspresentonthealtar,orbeingtransported,whentherewasnoservice,intothetabernacletotasteChrist.SeeLifeofJulianaofCornillon, AASSApril,vol.1,p.450ViedeDouceline,pp.13335LifeofIdaofLouvain,AASSApril,vol.2,p.172.Idaalsoknewmiraculouslytheexactmomentof consecration,eveniftheelementswerenotelevated(ibid.,p.173). 122.Wheaton,SavoringthePast,pp.126ReayTannahill,FoodinHistory(NewYork:SteinandDay,1973),pp.20933. 123.Wheaton,SavoringthePast,pp.12,1516,21.Onsotelties,seealsoConstanceB.HieattandSharonButler,PleynDelit:MedievalCookeryforModern Cooks(Toronto:UniversityofTorontoPress,1976),p.156Henisch,FastandFeast,pp.20636.ForexamplesofmedievalfoodsandfeastsseeLynnThorndike, "AMedievalSauceBook,"Speculum9(1934):18390andHieattandButler,CuryeonInglysch. 124.Wheaton,SavoringthePast,p.13Henisch,FastandFeast,pp.4849.ABaselmanuscriptinafifteenthcenturyhand,describedbyThorndike("Three TractsonFood,"p.364),givesadescriptionoffoodforFridaysandLentthatmakesitclearthattheabsenceoffleshmeatdidnotnecessarilymeanareductioninthe varietyoreleganceofmeals.Foracatalogueofmiraclesinwhichonekindoffoodturnsintoanother,seeC.GrantLoomis,WhiteMagic:AnIntroductionofthe FolkloreofChristianLegend,MedievalAcademyofAmericaPublication52(Cambridge:MedievalAcademyofAmerica,1948),p.57. 125.See,forexample,Duhr,"Communionfrquente,"cols.125459C.W.Dugmore,TheMassandtheEnglishReformers(London:Macmillan,1958)Strawley, "Eucharist"Brooke,"ReligiousSentiment." 126.OnHildegard'svision,seebelow,pp.26465andplate12. 127.RupertofDeutz,Dedivinisofficiis,bk.2,chap.11,PL170,col.43.OnRupert'seucharisticteachinggenerally,seeUrsmerBerlire,L'Ascsebndictine desoriginesla


finduXII sicle:Essaihistorique(Paris:DescledeBrouwer,1927),pp.8691.SeealsoJohnH.VanEngen,RupertofDeutz(BerkeleyandLosAngeles: UniversityofCaliforniaPress,1983). 128.RevelationesGertrudianaeacMechtildianae,vol.2:MechtildofHackeborn,SanctaeMechtildisvirginisordinissanctiBenedictiLiberspecialisgratiae (Paris:Oudin,1877),bk.1,chap.1,pp.710. 129.RevelationesGertrudianaeacMechtildianae,vol.1:GertrudetheGreat,SanctaeGertrudismagnaevirginisordinissanctiBenedictiLegatusdivinae pietatis...(Paris:Oudin,1875),bk.4,chap.1,p.286.Butthisspiritualityisalsoveryindividualistic:weareassuredthateachsisterwhoreposedonChrist'sbreast enjoyedhimsofullythathemighthavebeengiventoheralone(ibid.,p.287). 130.SeeHontoir,"LaDvotion,"pp.13435,137.SeealsoRothkrug,"PopularReligion,"p.41. 131.JeanLeclercq,"LesMditationseucharisriquesd'ArnaulddeBonneval,"Recherchesdethologieancienneetmdivale13(1946):53. 132.Tubach,Index,pp.59,7576,20712,4012. 133.Browe,DieWunder,p.104.Onbodysymbolismgenerally,seeMaryDouglas,NaturalSymbols:ExplorationsinCosmology,withnewintro.(NewYork: Pantheon,1982). 134.Browe,DieWunder,p.124. 135.Ibid.,p.119.Foranother,somewhatthreateningbloodmiracle,seeAdamofEynsham,TheLifeofSt.HughofLincoln,ed.andtrans.DecimaL.Douieand HughFarmer,2vols.(London:Nelson,1961),bk.5,chap.4,vol.2,pp.9394.InthiscaseapriestrecountstoHughhow,whenhecelebratedaftercommittinga mortalsin,thehostturnedintofleshandblood,freezinghimwithfear.OtherboundaryreinforcingbloodmiraclescanbefoundinCorblet,Histoiredogmatique,vol. 1,pp.447515passim. 136.CaesariusofHeisterbach,DieFragmentederLibriVIIIMiraculorumdesCaesariusvonHeisterbach,bk.1,chap.1,ed.AloysMeister,Rmische QuartalschriftfrchristlicheAlterthumskundeundfrKirchengeschichte,Supplement,vol.13(Rome:Spithver,1901),pp.46.Fortheuseofthehostasamagical charm,seePeterBrowe,"DieEucharistiealsZaubermittelimMittelalter,"ArchivfrKulturgeschichte20(1930):13454. 137.Rothkrug,"PopularReligion,"p.29.SeealsoBrowe,DieWunder,pp.128ff. 138.Browe,DieWunder,pp.11516Jungmann,MassoftheRomanRite,vol.1,pp.119ff.,andvol.2,p.210.Foranotherexampleofbloodavenging desecration,seeHenryofHuntingdon'schronicle,bk.8,chap.22,HenriciArchidiaconiHuntendunensisHistoriaAnglorum,ed.ThomasArnold,Rerum BritannicarumMediiAeviScriptores74(London:Longman,1879),p.277,wherehereportsthatbloodbubbledoutofthewallsofachurchbeingheldasacastle andsaysthathesawthephenomenonwithhisowneyes.YetanotherexampleoccursinastoryaddedtotheLittleFlowersofSt.Francis,pt.3,chap.5,trans. RaphaelBrown,inOmnibus,pp.148182.AwellknownpassagefromFroissart'schroniclethatdescribestheflagellantsandassociatesthecollectingoftheir "miraculousblood"with"foolishwomen"isquotedinGottfried,BlackDeath,p.70. 139.SeeJamesofVitry,LifeofMaryofOignies,AASSJune,vol.5,pp.54750,56263,56566.Foreucharisticdevotionasacountertoheresy,see McDonnell,Beguines,pp.310,315,330,415andBolton,"VitaeMatrum,"pp.26768.


140.ThomasofCantimpr,LifeofLutgardofAywires,AASSJune,vol.4(Paris,1867),pp.196,197,205. 141.GertrudetheGreat,Oeuvres,vol.3:LeHraut,SC143,Sr.mon.27,bk.3,chap.18,pp.1024.Seealsoaboveatnn.11314. 142.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.159,par.209,AF10,pp.25051.Breadissometimessimplyasymbolofblessingandunity(seeibid., chap.163,par.217,p.255). 143.OnCatherine,seebelow,pp.17580. 144.Onmedievalmedicaltheory,whicharguedthatbreastmilkisprocessedblood,seeMaryM.McLaughlin,"SurvivorsandSurrogates:ChildrenandParentsfrom theNinthtotheThirteenthCenturies,"inL.DeMause,ed.,TheHistoryofChildhood(NewYork:PsychohistoryPress,1974),pp.11518MichaelGoodich, "BartholomaeusAnglicusonChildRearing,"HistoryofChildhoodQuarterly:TheJournalofPsychohistory3(1975):80andCharlesT.Wood,"TheDoctors' Dilemma:Sin,SalvationandtheMenstrualCycleinMedievalThought,"Speculum56.4(October1981):719. 145.GertrudetheGreat,Oeuvres,3:LeHraut,bk.3,chap.30,p.142. 146."DulcisJesumemoria,"inGaselee,MedievalLatinVerse,pp.11113.OnthishymnseeAndrWilmart,"Le'Jubilus'surlenomdeJsusditdesaintBernard," Ephemeridesliturgicae:Analectahistoricoascetica57,n.s.27(1943):3285,whichgivesaslightlydifferentversionofsomelines.SeealsoRaby,Christian LatinPoetry,pp.32631. 147.Ivo,letter,chap.2,pars.1415,inIves:EptreSverinsurlacharit.RicharddesaintVictor:Lesquatredegrsdelaviolentecharit,ed.Gervais Dumeige,Textesphilosophiquesdumoyenge3(Paris:Vrin,1955),pp.6163. 148.Seebelow,chap.5n.30. 149.PeterofVaux,LifeofColetteofCorbie,trans.StephenJuliacus,chap.10,par.84,AASSMarch,vol.1(Paris,1865),p.558. 150.LifeofIdaofLouvain,chap.4,pars.2324,AASSApril,vol.2,p.164. 151.Onthesemetaphorsinmonastictexts,seeJeanLeclercq,Etudessurlevocabulairemonastiquedumoyenge,StudiaAnselmiana48(Rome:Herder,1961), pp.13438andidem,TheLoveofLearningandtheDesireforGod:AStudyofMonasticCulture,3ded.,trans.CatherineMisrahi(NewYork:Fordham UniversityPress,1982),p.73. 152.SeeSchiller,Ikonographie,vol.4,pt.1:DieKirche(1976),p.62.ThismotifisrelatedtothemotifofChristinthewinepress.Forexample,inplate5,asilk embroideryfromtheearlyfifteenthcentury,weseeJesuswithhisbreastbareandhiswoundbleedingunderhisclothesintothepress.Akneelingnunreceivesthe bloodinachalice.SeeSchiller,Iconography(1972),vol.2:ThePassionofJesusChrist,pp.22829.AsJamesH.Marrowpointsout,medievaldepictionsofthe winepressshiftedfromthetwelfthcenturyimageofChristtreadingthegrapesinthepresstothefourteenthandfifteenthcenturymotifofChristasvictimpressed beneaththecrossbeam(PassionIconographyinNorthernEuropeanArtoftheLateMiddleAgesandEarlyRenaissance:AStudyoftheTransformationof SacredMetaphorintoDescriptiveNarrative[Kortrijk:VanGhemmert,1979],p.85).Similarly,earlydepictionsofthemysticalmillshowChristorGodasmiller: Schiller,Ikonographie,vol.4,pt.1:DieKirche,p.62.SeealsoBraun,Altar,vol.2,plate336.


153.ForamedievalvisionthatparallelsthemassofSt.Gregoryandmakesitperfectlyclearthatthebloodisfood,seethevisionofJohnofAlvernadiscussedbelow, chap.7n.49.SeealsoSchiller,Iconography,vol.2:Passion,pp.22628andBraun,Altar,vol.2,plate269. 154.Schiller,Iconography,vol.2:Passion,p.206. 155.Itisnotcertainthatthereare,inpatristicwritings,anyclaimstoreceiveChrist'sbodysensuallyseeE.Longpr,"Eucharistieetexpriencemystique...,"DS, vol.4,pt.2,col.1596. 3 FoodAsaFemaleConcern: TheComplexityoftheEvidence 1.LifeofAlpasofCudot,bk.1,chaps.23,AASSNovember,vol.2,pt.1(Brussels,1894),pp.178,180seebelow,n.77. 2.SeeE.CobhamBrewer,ADictionaryofMiracles:Imitative,RealisticandDogmatic(Philadelphia:Lippincott[1896]),pp.14550Tubach,Index,entries 76667,1732,2566,pp.6364,141,202andThurston,PP,pp.385ff. 3.BernardofClairvauxwassupposedlynursedbyMaryinavisionseeLonDewezandAlbertvanIterson,"LaLactationdesaintBernard:Lgendeet iconographie,"CteauxindeNederlanden7(1956):16589.ClareofAssisisupposedlynursedfromFrancis'sbreastinavisionseebelowatn.186.Forother lactationvisions,seebelow,chap.9n.56.ForlegendsthatbothPaulandCatherineofAlexandriabledmilkwhenbeheaded,seeBynum,JM,p.132n.76. 4.Forlistsofcasesof"miraculous"orextendedinedia,seeThurston,PP,passim,esp.pp.363ff.Pater,MAW.B.Gerish,intro.toTheHartfordshireWonderor StrangeNewsfromWare:BeinganExactandTrueRelationofoneJaneStretton...,HertfordshireFolklore5(London:J.Clark,1669repr.withGerish's intro.,Bishop'sStortford,1908),pp.58HyderE.Rollins,"NotesonSomeEnglishAccountsofMiraculousFasts,"JournalofAmericanFolklore34.134 (OctoberDecember1921):35776Rogers,Fasting,pp.932andH.Schadewaldt,"MedizingeschichtlicheBetrachtungenzumAnorexieProblem,"Anorexia Nervosa:Symposium24./25.April1965inGttingen,ed.J.E.MeyerandH.Feldmann(Stuttgart:Thieme,1965),pp.114. 5.BenedictXIV,DeservorumDeibeatificationeetbeatorumcanonizatione,bk.4,pt.1,chap.26,andapp.byJ.B.Beccaritobk.4,pt.1(newed.,Naples: JohannisFranciscusPacus,17731775),vol.8,pp.21929,andvol.15,pp.89127. 6.SeeJrmeRibet,LaMystiquedivine,distinguedescontrefaonsdiaboliquesetdesanalogieshumaines,2vols.,newed.(Paris:Poussielgue,1895),esp. vol.2,p.510andImbertGourbeyre,Stigmatisation. 7.SeeThurston,PPandPater,MA. 8.WilliamA.Hammond,FastingGirls:TheirPhysiologyandPathology(NewYork:Putnam,1876)RobertFowler,ACompleteHistoryoftheCaseofthe WelshFastingGirl(SarahJacob)with...ObservationsonDeathfromStarvation(London:Renshaw,1871).OnthisliteratureseeJoanJ.Brumberg,"'Fasting Girls':ReflectionsonWritingtheHistoryofAnorexiaNervosa,"inHistoryandResearchinChildDevelopment,ed.Alice


B.SmutsandJohnW.Hagen,MonographsoftheSocietyforResearchinChildDevelopment(Chicago:UniversityofChicagoPress,1986),pp.93104. 9.Rogers,Fasting,pp.10732. 10.Seebelow,chap.6. 11.See,forexample,Duhr,"Communionfrquente,"cols.125668andGougaud,DAP,pp.11314.SeealsomydiscussioninBynum,JM,pp.17072,193n. 58,257. 12.Hontoir,"LaDvotion,"pp.13256idem,"LeSeptimeCentenairedelaFteDieu:SainteJulienneetlescisterciennes,"CollectaneaordinisCisterciensis reformatorum8(1946):10916Browe,DieWunder,passim,esp.pp.2324Rothkrug,"PopularReligion,"p.28. 13.Seetheworkscitedabove,n.12McDonnell,Beguines,pp.299330andRoisin,L'Hagiographie,pp.10622. 14.SeeBaixandLambot,LaDvotion,p.70Bertaud,"Dvotioneucharistique,"cols.162324,fortheclaimthateucharisticdevotionappealedespeciallytonuns andrecluses.Fortheclaimthatitappealedtobeguines,seeGreven,Anfnge,p.69HerbertGrundmann,"ZurGeschichtederBeginenim13.Jahrhundert,"Archiv frKulturgeschichte21(1931):314E.Neumann,BeginenundBegardenwesen,p.91.Bolton("VitaeMatrum,"p.267)haspointedoutthatthedevotion cannotbeidentifiedwithanyparticularstyleoflife,andVauchez(LaSaintet,p.427)pointstolayinterestintheeucharist. 15.Onthispoint,seeAndrVauchez,LaSpiritualitdumoyengeoccidentalVIIIeXIIesicles,CollectionSUP(Paris:PressesUniversitairesdeFrance,1975), pp.58andBynum,JM,p.4. 16.ThisistrueofKieckhefer,UnS,and,toalesserextent,ofVauchez,LaSaintetWeinsteinandBell,SSandGoodich,VP. 17.Kieckhefer'sUnquietSouls,whichemphasizesreligiousconcerns,isawelcomecorrectivetothistendency. 18.WeinsteinandBell,SS,table18,p.234. 19.Kieckhefer,UnS,p.172.Ruysbroeckalsoreceivedecstasies(ifnotactualvisions)whilecelebratingseebelow,nn.24and240.Allsortsofvisionsweremore commonwithwomenthanwithmeninthisperiodseeDinzelbacher,VisionundVisionsliteratur,pp.15155,22628. 20.Vauchez,LaSaintet,pp.22426,34748,4056,45051. 21.Thurston,PP,pp.38591.Thurston,whoincludesmodernsaintsaswell,liststwentythreemenandtwentywomen.Onthecommonhagiographicalmotifof women'sdistributionofbreadthatturnsintoroses,seebelow,chap.7n.13. 22.ThefollowingparagraphisbasedonBrowe,DieWunder.Forothermiracles,seeCorblet,Histoiredogmatique,vol.1,pp.447515. 23.Browe,DieWunderp.23. 24.Foranearlyexampleofthekindofeucharisticmiraclethatsupportspriestlyauthority,seetheearlyninthcenturyLifeofEvurtiusinCataloguscodicum hagiographicorumlatinorumBibliothecanationaliParrisiensi,Subsidiahagiographica2,vol.2(Brussels:TheBollandists,1890),pp.31718andthelater versionintheLibersanctiJacobi,ed.JeanneVielliard,inLeGuideduplerindeSaintJacquesdeCompostelle(Mcon:Protat,1938),pp.5860.Inthismiracle thehandofGodappearedovertheheadofthecelebratingpriest,imitatinghisactions(andtherebydemonstratingthatChristoffersthe


sacrificeineverymass).Forafourteenthcenturyexample,seetheLifeofJanvanRuysbroeckbyHenryUtenBoghaerde(HenryPomer),whichisbk.2of"De originemonasteriiViridisvallisunacumvitisB.JoannisRusbrochiiprimipriorishujusmonasteriietaliquotcoaetaneorumejus"(AB4[1885],chap.28,pp.302 3).InthisaccountwearetoldthatRuysbroeck,oldandblind,wasforbiddenbyhissuperiortocelebratebecauseofhisfeebleness.Ruysbroekdefendedhimself, claimingthatthefeeblenesswasecstasyandthatJesushadcometohimtosay,"Tuesmeusetegotuus." 25.SeeMcDonnell,Beguines,pp.30515Hontoir,"SainteJulienne"BaixandLambot,LaDvotion,pp.7580andtheLifeofJulianaofCornillon,AASSApril, vol.1,pp.44275. 26.CyprienVagaggini,"LaDvotionauSacrCoeurchezsainteMechtildeetsainteGertrude,"CorJesu:CommentationesinlitterasencyclicasPiiPP.XII 'Haurietisaquas,'2vols.(Rome:Herder,1959),vol.2,pp.3148UrsmerBerlire,LaDvotionauSacrCoeurdansl'ordredesaintBenot,CollectionPax 10(Paris:Lethielleux,1923)Gougaud,DAP,pp.75130. 27.McDonnell,Beguines,p.313.OnAgnesBlannbekinandthescandalcausedbythepublicationofherrevelationsin1731,seeG.Allmang,"AgnsBlannbekin," DHGE,vol.1(1912),col.977andPeterDinzelbacher,"Die'VitaetRevelationes'derWienerBegineAgnesBlannbekin(&dagger1315)imRahmenderVitenund OffenbarungsliteraturihrerZeit,"inDinzelbacherandBauer,Frauenmystik,pp.15277. 28.Jungmann,MassoftheRomanRite,vol.2,pp.2021Vauchez,LaSaintet,pp.43132Duhr,"Communionfrquence,"cols.125668. 29.ImbertGourbeyre,Stigmatisation,vol.2,pp.183,4089.ForcriticismsofImbertGourbeyre,seePierreDebongnie,"EssaicritiquesurI'histoiredes stigmatisationsaumoyenge,"Etudescarmlitaines,21.2(October1936):2259andE.Amann,"Stigmatisation,"DTC,vol.14,pt.1(1939),cols.261719. 30.Caesarius,Dialogus.Bk.11concernsdyingbk.12concernsthepunishmentofthedead.Inbk.8(visions),therearethreeappearancesoftheChristchildto women(chaps.3,7,8)andtwotomen(chaps.2,5)eightappearancesofthecrucifixtomen(chaps.11,13,14,17,18,20,21,23)andfourtowomen(chaps10, 15,16,22onemightalsocountchap.9).Theopeningandclosingchaptersofbk.9(ontheeucharist)dealwithcelebrantsandtheproofoftransubstantiationandare aboutmaleschaps.3351(whichdealwiththelaity)haveninevisionstowomen(chaps.33,34,35,36,39,40,46,47,50)andtentomen(chaps.37,38,41,42, 43,44,45,48,49,51)ofthescatteredremainingchaptersonrecipients,threeareaboutmales(chaps.24,63,64)andoneaboutafemale(chap.25). 31.ConradofEberbach,Exordiummagnumcisterciense,ed.BrunoGriesser,Seriesscriptorums.ordiniscisterciensis2(Rome:EditionesCistercienses,1961) PetertheVenerable,Liberdemiraculis,PL189,cols.851954GeraldofWales,GemmaecclesiasticainGeraldofWales,Opera,ed.J.S.Brewer,vol.2 (London:Longman,1862). 32.SeeJamesofVitry,TheHistoriaoccidentalisofJacquesdeVitry:ACriticalEdition,ed.JohnF.Hinnebusch,SpicilegiumFriburgense17(Fribourg, Switzerland:UniversityPress,1972)andThomasofCantimpr,Liberquidiciturbonumuniversaledeproprietatibusapum(Cologne:JohanKoelhoff,ca.1479). Theeucharistis,however,unimportantinJames'ssermonesvulgaresseeJamesofVitry,TheExemplaorIllustrativeStories


fromtheSermonesVulgaresofJacquesdeVitry,ed.ThomasF.Crane,PublicationsoftheFolkloreSociety26(London:Nutt,1890). 33.Tubach,Index,pp.20712. 34.Women'sstoriesareahigherpercentageofthoseaboutcloisteredreligious.Of252storiesconcerningmonksandnuns,61(or24percent)areaboutwomen. 35.Tubach,Index:storiesofmalesaretoldinentries3237,2058storiesoffemalesinentries33,38,40(twostories). 36.Ibid.Entries33and38urgemoderation.Entry40concernstwowomentrickedbythedevil. 37.Ibid.Women'sstoriesaretoldinentries1176,1983,1990,3198,3718. 38.Ibid.Entry1983tellsofawomanwhofastedthreeyears.Entry3198saysMaryMagdalenfastedthirtyyears.Themonkinentry1982fastedseventyeight weeks. 39.Ibid.,entries1990,3718. 40.Jerome,Letter54,AdFuriadeviduitateservanda,inSanctiEusebiiHieronymiepistulae,pt.1,ed.Hilberg,pp.46685andidem,Letter22,Ad Eustochium,chaps.1718,PL22,cols.4045.Jerome'sothermajordiscussionoffasting,food,andlustisinContraJovinianum,bk.2,chaps.517,PL23, cols.290312.JeromealsourgedwomentoavoidexcessiveabstinenceseeArbesmann,"FastingandProphecy,"pp.3839. 41.FulgentiusofRuspe,Letter3,chap.13,PL65,col.332.SeealsoPL65,col.132. 42.PetertheChanter,chapteronfastingfromVerbumabbreviatum,PL205,cols.32728. 43.SeeA.GeorgeRigg,"'MetradeMonachisCarnalibus':TheThreeVersions,"MittellateinischesJahrbuch15(1980):13442. 44.SeeColker,AnalectaDublinensia,pp.47,57,andthepassagecitedinn.13ofmyintro.ThetwelfthcenturymonkofEvesham,whoreceivedavisionofthose sufferinginpurgatory,showednospecialconcernwithfoodabuses,however.Seebelow,n.130. 45.SeeKnowles,"Diet,"andabove,chap.2n.53. 46.EileenPower,MedievalEnglishNunneries,c.1275to1535,CambridgeStudiesinMedievalLifeandThought(Cambridge:CambridgeUniversityPress, 1922),pp.161236. 47.Seeabove,chap.2nn.110,139andBrowe,DieWunder,pp.11011. 48.JohnGerson,CollectoriumsuperMagnificat,Treatise9,inJohnGerson,Oeuvrescompltes,ed.PalmonGlorieux,vol.8:L'Oeuvrespirituelleetpastorale (Paris:Descle,1971),pp.39798andseeLongpr,"Eucharistieetexpriencemystique,"cols.16024. 49.RichardRolle'sFormofLiving,likehistwootherEnglishepistles,waswrittenforawoman.HenrySuso'sLittleBookofEternalWisdom,theheartofwhichis meditationsonChrist'sdeath,isaddressedchieflytonuns,asishisBookofLetters.ThesecondpartofRuysbroeck'sMirrorofEternalSalvationisatreatiseon theeucharistthatwasprobablywrittenforMargaretofMeerbeke.HealsoaddressedhisBookoftheSevenCloisterstoher.DionysiustheCarthusianwrotesix sermonsontheeucharistforMechtildofNimgueandotherecstatics. 50.OnGuiard,seeP.C.Boeren,LaVieetlesoeuvresdeGuiarddeLaon,1170env.1248(TheHague:Nijhoff,1956),pp.15758.Taulerpreachedmostofhis sermons,whichstressmysticismandfrequentcommunion,inGermantonunsseeKarlBoeckl,EucharistieLehrederdeutschenMystikerdesMittelalters (Freiburg:Herder,1924),pp.74122.


51.BaixandLambot,LaDvotion,pp.4852. 52.Corblet,Histoiredogmatique,vol.2,passim,esp.pp.51351. 53.Dumoutet,CD,pp.7780.Agnes,Catherine,andDorothywerealsocommonfiguresonretablesseeBraun,Altar,vol.2,p.493. 54.Dumoutet,CD,p.80andCorblet,Histoiredogmatique,vol.2,p.550. 55.VictorSaxer,LeCultedeMarieMadeleineenOccidentdesorigineslafindumoyenge,Cahiersd'archologieetd'histoire3,2vols.(Auxerre:Socit desFouillesArchologiquesetdesMonumentsHistoriquesdel'Yonne,1959). 56.Hontoir,"LaDvotion,"p.152andCorblet,Histoiredogmatique,vol.1,pp.557,563.SeealsoBraun,Altar,vol.2,p.624,foraneleventhcenturyminiature fromPraguethatassociatestheAnnunciationwithapyx,thussuggestingthatreservationofthesacramentrecapitulatesthemomentoftheIncarnation. 57.Dumoutet,CD,p.79. 58.WilliamDurandustheElder,Rationaledivinorumofficiorum,bk.1,chap.3,sect.25(Venice:MattheusValentinus,1580),fol.11rseealsoplate13. 59.Dumoutet,CD,p.79. 60.SeeBraun,Altar,vol.2,plates329,333,334,336,346,360,361.OntheMaryAltarinplate7seeCarlGeorgHeise,LbeckerPlastik(Bonn:Cohen, 1926),pp.1112. 61.Seeabove,p.68,andbelow,pp.27172and285. 62.Seeabove,nn.4041,andchap.2nn.2526andMusurillo,"AsceticalFasting,"pp.1319. 63.Musurillo,"AsceticalFasting,"pp.2539Arbesmann,"FastingandProphecy,"pp.3438Browe,DieWunder,pp.4950. 64.Seeabove,chap.2n.56. 65.JamesofVitry(LifeofMaryofOignies,bk.1,chap.5,AASSJune,vol.5,p.552),says,speakingofMary'sstigmataandfasting,thatthosewhoadmireSimeon StylitesandAnthonyshouldadmiresuchasceticismin"theweakersex."RaymondofCapua(LifeofCatherineofSiena,pt.1,chap.3,pars.6365,AASSApril [Paris,1866],vol.3,pp.87778)mentionsPaul,Anthony,andotherfasters,andsaysthatalthoughCatherinelivedinherownhome,notinamonasteryorinthe desert,shenonethelesssurpassedthesesaints"inthematterofabstinence."SeealsoRaymond,LifeofCatherine,pt.2,chap.5,p.905. 66.PeterofVaux(LifeofColetteofCorbie,chap.17,par.166,AASSMarch,vol.1,p.573)comparesColettetotheFatherswho"livedincavesandpracticed austerities."But,headds,Colette"wentbeyondtheFathers." 67.LifeofSuso,chaps.20,35inSuso,DeutscheSchriften,pp.60,1037.AmongtheaphorismsincludedbySusoare:"Thefirstdutyofaspiritualbeginneristo showhimselffirminthefightagainstgluttony(Anthony)""Palefeatures,aleanbodyandahumblebearingarethebestornamentsofaspiritualperson(Helias)""An unchastebody,likeanunrulyhorse,mustbetamedbydeprivingitoffood(Hilarion)."Trans.Edward,Exemplar,vol.1,pp.1003. 68.Vauchez,LaSaintet,pp.347413andT.E.Bridgett,HistoryoftheHolyEucharistinGreatBritain,2vols.(London:KeganPaul,1881),vol.2,pp.177ff. 69.Seebelow,pp.1079. 70.Vauchez,LaSaintet,pp.34748. 71.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.5,par.170,AASS


April,vol.3,p.905LetterofStefanoMaconiinCatherineofSiena,L'OperedellaseraficasantaCaterinadaSiena,ed.GirolamoGigli,vol.1(Siena:Bonetti, 1707),pp.46089,esp.p.473andAugustaTheodosiaDrane,TheHistoryofSt.CatherineofSienaandHerCompanions...,4thed.,2vols.(London: Burns,OatesandWashbourne,1915),vol.1,pp.199202,forasummaryofvariouscontemporaryaccountsofhereatingandvomiting. 72.Seetheepigraphtothischapter. 73.Inmanycultures''noteating"ismoreadescriptionofanemotionalstatethanafactualclaim.AnthropologistKarenBrownofDrewUniversitytellsme,for example,thatinHaiti"Ihaven'teatentoday"means"Iamdepressed"andthatinbothHaitiandNigeria"Haveyoueaten?"isagreetingthatmeans"Howareyou?" 74.ForwhatfollowsseeGoodich,"ContoursofFemalePiety"Roisin,L'Hagiographie,pp.113,129andabove,chap.1n.42. 75.FelixVernet,MedievalSpirituality,trans.theBenedictinesofTalacre(London:SandsandCo.,1930),p.61. 76.TheLifeofColumbaofRieti,writtenbyherconfessor,SebastianPerusinus,suggestsboththatColumbaconsciouslyimitatedCatherineofSienafromchildhood andthatherbiographerunderlinedparallelstoCatherineashewroteColumba'svita.See,forexample,AASSMay,vol.5(Paris,1866),pp.155*59*.Onfemale saintswhomodeledthemselvesonCatherineofSiena,seeGabriellaZarri,"LeSanteVive.Perunatipologiadellasantitfemminilenelprimocinquecento,"Annali dell'IstitutoStoricoItaloGermanicoinTrento6(1980):371445. 77.Alpas'svitawaswrittenafter1180byaCistercianofEcharlissheisalsomentionedbyRobertofAuxerre,RalphCoggeshall,CaesariusofHeisterbach,James ofVitry,andStephenofBourbon.TheselatterreferencesallfocusonthemiraculousinediaJamesandCaesariusbothassociateherwithothercasesofmiraculous abstinence.SeeJamesofVitry,Historiaoccidentalis,ed.Hinnebusch,pp.8788Caesarius,Dialogus,bk.7,chap.20,andbk.9,chap.47,vol.2,pp.25,201 2andAASSNovember,vol.2,pt.1(Brussels,1894),pp.167209,whichprintsalltheearlyreferences. 78.SeeBynum,JM,pp.199201. 79.Roisin,L'Hagiographie. 80.See,forexample,Constable,SelfInflictedSuffering. 81.Kieckhefer,UnS,pp.1214. 82.JamesofVitry(LifeofMaryofOignies,bk.1,chap.1,AASSJune,vol.5,p.550)saysthatweshould"admirethefervornotimitatetheworks."Theauthorof theLifeofJamesofPorto(inAF,vol.3[1897],p.620)saysJames'sausterelifeis"magisadmirandamquamimitandam."RaymondofCapua(intheLifeof CatherineofSiena,pt.2,chap.16,par.310,p.939)underlinesthesamecontrast.SpeakingofamiracleinwhichGodfirstmultipliedwineandthenturneditsour,he saysthefirsteventshowshowhighlyGodthoughtofCatherine,thesecondhowhumblyshethoughtofherself.Thefirstteachesustohonorher,thesecondtoimitate her:"inprimodeditnobismateriamipsamhonorandi,insecundoipsamimitandi."Itwasmorecommon,however,forbiographerstourgereaderstoimitatethesaints. See,forexample,LifeofJulianaofCornillon,prologue,AASSApril,vol.1,p.442andbelow,chap.8n.43.Bonaventure'sLifeofFrancisofAssisigivesan interestingtwisttothetheme.Bonaventuresuggests


thatspectatorsatoneofFrancis'sextravagantdisplaysofselfabasementdismissedhisbehavioras"magisadmirabilemquamimitabilem"(Bonaventure,Legenda maior,pt.1,chap.6,par.2,inAF,vol.10,p.583). 83.Legatus,bk.5,chap.7,RevelationesGertrudianaeacMechtildianae,vol.1,p.543. 84.OnAbelard'sviewofwomen,seeMaryM.McLaughlin,"PeterAbelardandtheDignityofWomen:TwelfthCentury'Feminism'inTheoryandPractice,"in PierreAbelard,PierreleVenerable:Lescourants...,ColloquesinternationauxduCentreNationaldelaRechercheScientifique546(Paris:EditionsduCentre NationaldelaRechercheScientifique,1975),pp.287333JohnBenton,"Fraud,FictionandBorrowingintheCorrespondenceofAbelardandHeloise,"inibid.,pp. 469506andd'Alverny,"Commentlesthologiens...voientlafemme." 85.LifeofSuso,chap.35,inSuso,DeutscheSchriften,p.107trans.Edward,Exemplar,vol.1,pp.xxxiv,103.PresumablySusoisnotimplyingthatmensch refersonlytomalesbutsuggestingthatdifferentindividualshavedifferentcrossestobear. 86.ThomasofCelano,LifeofClareofAssisi,chap.11,par.18,inPennacchi,Legenda,pp.2627. 87.Seeabove,chap.2n.110andGrundmann,Bewegungen,p.414.AlbertsaidthattheclaimofanuntonurseJesus"fatuitasestverbrribuspotiusquamverbis corrigenda"(ibid.,p.414n.128). 88.Ibid,p.413. 89.Forexample,PeterofLuxembourg,whotriedtoliveonbreadandwateraloneandtositattablewithouteating,wasononeoccasioncommandedbythepopeto eatanddidsoobediently.(Hishealthwas,however,alreadyruined.)SeeLifeofPeter,chap.4,pars.2223,AASSJuly,vol.1(Paris,1867),p.451Processof canonization,chap.4,inibid.,pp.47075. 90.WeinsteinandBell,SS,pp.23536. 91.WalterSeton,ed.,"TheLettersfromSaintClaretoBlessedAgnesofBohemia,"ArchivumFranciscanumhistoricum17(1924):51617. 92.AngelaofFoligno,ed.FerrandBaudry,par.21,p.24:"PosteahabuisentimentaDei,ethabebamtantamdelectationeminoratione,quodnonrecordabarde comestione.Etvoluissemquodnonopportuissetmecomedere,utpossemstareinillaoratione.Etintermiscebatsehicquedamtemptatio,scilicetquodnon comederem,vel,sicomedebam,quodcomedereminparvoponderevaldesetcognoviessetemptationem."SeealsotheinadequateeditioninAASSJanuary,vol.1 (Paris,1863),chap.1,par.34,p.190.ChristhimselfsupposedlytoldAngelathatsleeping,eating,anddrinkingareacceptableifdoneinloveforhim:"Etdixerat michiperviamineundoA[s]sisiumita:'Totavitatua,comedereetbibere,dormireetomnetuumviveremichiplacet'"(AngelaofFoligno,ed.FerrandBaudry,par. 35,p.54).Angelaherselfwrotethatahumbleheartwasmoreimportantthanfastingorpoverty(ibid.,par.180,p.418). 93.VitaBeatricis,bk.2,chap.15,pp.1034.LifeofColumbaofRieti,chap.5,par.31,AASSMay,vol.5,p.162*. 94.ThomasofCantimpr,LifeofLutgard,bk.2,chap.14,AASSJune,vol.4,p.198.RaymondofCapua,LifeofCatherineofSiena,pt.2,, AASSApril,vol.3,p.904allofpt.2,chap.5,dealswithCatherine'sdetractors. 95.Seeabove,chap.2n.112.


96.Legatus,bk.4,chap.14,pp.34344. 97.Seebelow,chap.5. 98.RaymondofCapua,(LifeofCatherineofSiena,pt.2,chap.5,par.173,p.905),mentionsMaryMagdalenandtheFathersasexamplesofextremefasting, addingthat"sanctitydependsoncharitynotfasting."ForRaymond'sowndifficultieswithfasting,seeDrane,HistoryofSt.Catherine,vol.1,p.223Hyacinthe MarieCormier,LeBienheureuxRaymonddeCapoue...savie,sesvirtues,sonaction,2ded.(Rome:ImprimerieVaticane,1902),pp.11316andConeth Kearns,trans.,TheLifeofCatherineofSiena(Wilmington,Del.:Glazier,1980),p.xv.InalettertoPhilipofAlenon,CardinalofOstia,Raymondsomewhat guiltilydefendedhimselffromthechargethathewasahypocritebecauseheurgedotherstofastbutfailedtofasthimself.Hisshortcoming,heargued,wasdueto physicalincapacityatleast,headded,heassistedthesaintswhoprovidedmanyworthyexamples.Healsosuggestedthatthecriticismofhiseatingwasdeflectingthe unfairattacksthathadbeenmadeonabstainers(H.M.Cormier,B.RaymundiCapuani...opusculaetlitterae[ PropagandaFide,1899],pp.6668).ForRaymond'sLifeofCatherineaspropagandaforObservantreform,seeRobertFawtier,SainteCatherinedeSienne: Essaidecritiquedessources:Sourceshagiographiques,BibliothquedesEcolesFranaisesd'AthnesetdeRome121(Paris:deBoccard,1921),pp.11830. AlthoughFawtierisexcessivelyskepticalaboutsomeofthedetailsinRaymond'saccount,hispictureofRaymond'smotivesisuseful.Onthecontroversyoverthe CatherinelegendgeneratedbyFawtier,seeKearnsinLifeofCatherineofSiena,pp.lxlxx. 99.SeeJohnofMantua,Processofcanonization,AASSOctober,vol.9(Brussels,1858),pp.816,840. 100.LifeofColumbaofRieti,chap.12,par.110,AASSMay,vol.5,p.184*. 101.SeeGregoryofTours,LibervitaePatrum,prologue,MGH.SSRM,vol.1,pt.2,ed.W.ArndtandB.Krusch(1885),pp.66263.Onthispoint,seeH. Delehaye,TheLegendsoftheSaints:AnIntroductiontoHagiography,trans.Mrs.V.M.Crawford(London:Longmans,1907)andRenAigrain, L'Hagiographie:SesSources,sesmthodes,sonhistoire(Paris:BloudetGay,1953).Plate9aboveillustratesthepointbyshowinghowartiststransferred iconographicalmotifsfromonesainttoanothersimplybychangingthename. 102.WeinsteinandBell,SS,p.46. 103.AelredofRievaulx,GenealogiaregumAnglorum,PL195,col.715.Susolearnedpenitentialasceticismfromhismother(LifeofSuso,chap.42,inSuso, DeutscheSchriften,pp.14243).IdaofLouvainwastakentomassbyhermother(Life,bk.1,chap.1,AASSApril,vol.2,p.159).Herhagiographer,who workedfromrecordskeptbyherconfessor,stressesherreactionagainstherfather'swealth. 104.PeterofLuxembourg,Processofcanonization,chap.1,arts.210,andchap.4,andLifeofPeter,chap.3,par.19,andchap.4,par.29,AASSJuly,vol.1, pp.46465,47075,457,459.Peter'sfatherfastedandgaveawaymoneyhismothergaveawayfood.BothparentsdiedwhenPeterwasquiteyoung. 105.PeterofVaux,LifeofColette,chap.1,par.10,AASSMarch,vol.1,p.542. 106.JohnMarienwerder,VitaLindana,chap.1,pars.15,17,AASSOctober,vol.13(Paris,1883),pp.5056seealsochap.2,par.44,p.515.SeeKieckhefer, UnS,pp.2526.


LidwinaofSchiedam,however,hadamodeloffastinginhergrandfatherseeVitaprior,chap.1,par.5,AASSApril,vol.2(Paris,1865),p.271. 107.LifeofJuliana,bk.1,chap.1,AASSApril,vol.1,pp.44344. 108.AccordingtoAnceletHustache,thereisnoreasontobelievethetraditionthatSophia,whowaspious,persecutedElizabeth(seeJeanneAnceletHustache, SainteElisabethdeHongrie[Paris:Editionsfranciscaines,1946],pp.12324). 109.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.1,par.25,AASSApril,vol.3,p.869. 110.Seebelow,epigraphtochap.7. 111.Browe,DieWunder,p.50. 112.Einhard,Annalesfor825,inMGH.SS,vol.1,ed.G.H.Pertz(1826repr.NewYork:KrausReprint,1963),p.214.CitedinSigibert,Chronica,foryear823, inMGH.SS,vol.6,ed.Pertz(1844),p.338andinHugh,Chroniconforyear823,inMGH.SS,vol.8,ed.Pertz(1848),p.353. 113.AASSFebruary,vol.3(Paris,1865),pp.52977,givessixshortvitaeofWalburgathatbyWolfhardisonpp.52948.SeealsoFrancescaM.Steele,The LifeofSt.Walburga(London:HeathCranton,1921). 114.Wolfhard,LifeofWalburga,chap.1,pars.34,p.530. 115.Steele,LifeofWalburga,pp.13336.OneofWalburga'slaterhagiographers,BishopPhilipofEichsttt,claimed(in1306)tohavebeencuredbytheoiland alsoassertedthatitflowedmorecopiouslyduringmassseePhilip,LifeofWalburga,chap.7,pars.3738,AASSFebruary,vol.3(Paris,1865),pp.56768. 116.SeeSteele,LifeofWalburga,p.151andHerbertThurston,ed.,Butler'sLivesoftheSaints,vol.2(London:Burns,OatesandWashbourne,1930),pp. 33839. 117.ThestoriesofIrchinbaldandFrideradearefoundinWolfhard,LifeofWalburga,bk.1,chap.6,par.23,p.534andbk.4,chap.3,pp.54648,respectively. 118.SeeAgnesB.C.Dunbar,ADictionaryofSaintlyWomen,vol.1(London:Bell,1904),pp.13235.(Dunbar'swork,thoughquiteuncritical,isusefulfor summarizinglegends.) 119.LawrenceofDurham,LifeofBridgetofKildare,chap.3,par.14,AASSFebruary,vol.1(Paris,1863),p.174. 120.MatthewParis,HistoriamajorjuxtaexemplarLondinense1571verbatimrecusa,ed.WilliamWats(London:RichardHodgkinson,1640),p.327.Forthis period,MatthewdrawsmostlyfromRogerofWendover'sFlowersofHistory. 121.JamesofVitry,Historiaoccidentalis,ed.Hinnebusch,pp.8788. 122.Caesarius,Dialogus,bk.9,chap.47,vol.2,pp.2012cf.bk.7,chap.20,vol.2,pp.2528. 123.RogerBacon,Opusminor,inFr.RogeriBaconoperaquaedamhactenusinedita,ed.J.S.Brewer,vol.1(London:Longman,Green,LongmanandRoberts, 1859),pp.37374. 124.ThomasNetter[Waldensis],Opusdesacramentis,inquodoctrinaeantiquitatumfideiEcclesiaecatholicaecontraWitclevistas,Hussitaseteorum asseclasLutheranosaliosquehaereticoscontinentur(Salamanca:ApudIoannemMariamdaTerranovaetIacobumArcharium,1557),fols.111v112r.Thestory ofJoanisfollowedbyanaccountofLidwinaofSchiedamthatemphasizesherinediaandseveremedicalproblems.


125.Forthefraudulentfaster,seeFlaminioMariaAnnibalidaLatere,VitadellaVergineSantaColeta...(Rome:AntonioFulgoni,1805),p.87.Forthecure,see Miracula(compiled1471),par.7,AASSMarch,vol.1(Paris,1865),p.594. 126.SeePater,MARollins,"NotesonSomeEnglishAccounts"Schadewaldt,"MedizingeschichtlicheBetrachtungen"andGerish,intro.toTheHartfordshire Wonder,p.6. 127.Schadewaldt,"MedizingeschichtlicheBetrachtungen,"p.7andGregoryZilboorgwithGeorgeM.Henry,AHistoryofMedicalPsychology(NewYork: Norton,1941),pp.20710. 128.SeeBrowe,DieWunder,p.50.Thestoryofahermitwholivedinatreeandwasfedonmannafromheaven,toldinthevitaofLidwinaofSchiedam,isso clearlyabitofromanticfictionthatIhavenotcounteditseebelow,p.126.NorhaveIcountedthefourteenthcenturystoryofFrancisofAssisifastingforfortydays seebelow,n.140. 129.OnPeterofLuxembourg,seeabove,n.89.LifeofJamesOldo,chap.2,pars.1415,AASSApril,vol.2(Paris,1865),p.6034. 130.EdwardArber,ed.,TheRevelationtotheMonkofEvesham:1196,CarefullyEditedfromtheUniqueCopynowintheBritishMuseumoftheEdition [of]...WilliamdeMachliniaabout1482(London:5QueenSquare,Bloomsbury,n.d.),pp.19,27modernEnglishtrans.byValerianPaget,TheRevelationto theMonkofEveshamAbbey(NewYork:JohnMcBride,1909),pp.35,61.Themonk'srefusaltoeatistreatedasillnessratherthanasceticism.Itisalsopertinent tonotethatthemonk'sownvisionofsoulsinpurgatoryshowsnointerestinfoodabuses.Greedismentionedinpassingasoneofthesinsofreligiousmen (Revelation,ed.Arber,chap.3,p.73). 131.SeeWalterDaniel,LifeofAelred,inTheLifeofAelredofRievaulxbyWalterDaniel,ed.andtrans.F.M.Powicke(NewYork:OxfordUniversityPress, 1951),pp.48ff.WalterstressesAelred'sfoodasceticismforthefouryearsbeforehisdeath:"Necmirum,siquidemparumcomedensetminusbibensciborum appetitumabstinencieinediaincredibilisextinxitomninoinseipso."HealsosaysthatAelredtookmedicinesoutofhismouthandthrewthemontheground(p.48)and atenofoodatallforseveraldaysbeforehisdeath(p.59).Thisdoesnotquiteamounttoaclaimtomiraculousabstinence. 132.ChronicapontificumetimperatorumMantuanaforyear1256,MGH.SS,vol.24(Hannover,1879),p.216.OnFacioofCremona,seeAndrVauchez, "SaintetlaqueauXIIIesicle:LaViedubienheureuxFaciodeCrmone(v.11961272),"Mlangesdel'EcoleFranaisedeRome:Moyengetemps modernes84.1(1972):1353. 133.SeeGerish,introductiontoTheHartfordshireWonder,p.5. 134.See,forexample,RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.1,pars.27,31,33,38(asachild,CatherineimitatedtheFathersbyretreatingto acave,andthoughtofimitatingEuphrosyne,oneofthetransvestitesaints)chap.3,pars.57,6364(sheimitatedDominicbyscourgingherself,andtheDesert Fathersbyfasting)chap.7,pars.11417(JesusmarriedherwitharingtheparalleltoCatherineofAlexandriaisexplicitlydrawn)pt.2,chap.5,pars.17273(her fastingisseenasparalleltobothMaryMagdalen'sandthatoftheDesertFathers)(AASSApril,vol.3,pp.86972,87678,89091,905).Seealsoabove,nn.65 67andchap.1n.68. 135.Bynum,JM,pp.126,128. 136.Ibid.,pp.11325.


137.SeeBernardofClairvaux,SermonessuperCanticaCanticorum,Sermon71,OB,vol.2(1958),pp.21424.WolfgangRiehle(TheMiddleEnglishMystics, trans.B.Standring[London:RoutledgeandKeganPaul,1981],pp.10710)seemstosuggestthatsuchmetaphorsfiguremoreprominentlyinwomen'swritings. 138.SeeVauchez,LaSaintet,pp.38183andKieckhefer,UnS,pp.4041,141.OnPeterofLuxembourgandJamesOldo,seeabove,n.129.Seealso Constable,SelfInflictedSuffering. 139.Franciscallshimselfa"mother"inhislettertoLeoseeTheFathersofSt.Bonaventure'sCollege,ed.,OpusculasanctipatrisFrancisciAssisiensis,Bibliotheca FranciscanaAsceticaMediiAevi1,2d.ed.,(Quaracchi:CollegiumS.Bonaventurae,1949),p.116trans.FahyinOmnibus,p.118.ForexamplesofFrancis's repeateddescriptionofthegoodfriarasmother,seebelow,chap.10,nn.1819.ThomasofCelanoalsoquotesbothFrancishimselfandhisfriarsascallingFrancis "mother"seeThomas,SecondLifeofFrancis,bk.2,par.137,inAF,vol.10,p.209andchap.136,par.180,inibid.,p.233.Francisdoesnotseemtoreferto himselfas"father,"althoughThomasdoessorepeatedly.BonaventurealsodescribesFrancisas"mother"seeLegendaminor,chap.3,seventhandeighthlessons,in AF,vol.10,pp.66465.OdoofCheriton,inasermonrecordedin1219,attributedtoFrancistheclaimthat"hewasawomanwhomtheLordimpregnatedbyhis wordandthushebroughtforthspiritualchildren''seeCajetanEsser,OriginsoftheFranciscanOrder,trans.AcedanDalyandI.Lynch(Chicago:Franciscan HeraldPress,1970),pp.11,208. 140.Ihavenothereconsideredthefourteenthcenturymaterial,butitisworthnotingthattheLittleFlowersofSt.Francis(chap.7)claimsthatFrancispassedone Lenteatingonlyhalfaloaf.TheFlowersalsoattributes(chap.33)afoodmiracletoClareandtells(chap.15)ofamealClareandFrancissharedatwhichneitherone ate(IFiorettidiSanFrancesco,ed.FaustaCasolini[Milan:GiacomoAgnelli,1926],pp.2932,13334,5659).Seebelow,chap.10n.7.Thereisauseful concordanceoftheearlyFrancismaterial,compiledbyT.DesbonnetsandD.Vorreuxandtrans.byM.A.HabiginOmnibus,pp.161965. 141.OnFrancis'sfoodasceticism,seeThomasofCelano,FirstLifeofFrancisofAssisi,bk.1,chap.19,par.51,AF,vol.10,pp.3940Bonaventure,Legenda maior,pt.1,chap.5,par.1,p.577andidem,Legendaminor,chap.3,firstlesson,p.662.SeealsoJordanJosephSullivan,FastandAbstinenceintheFirst OrderofSt.Francis:AHistoricalSynopsisandaCommentary,CatholicUniversityofAmericaCanonLawSeries374(Washington,D.C.:CatholicUniversityof AmericaPress,1957). 142.LifeofFrancisofFabriano,chap.1,par.6,AASSApril,vol.3(Paris,1866),p.993seealsoibid.,p.90. 143.See,forexample,ThomasofCelano,SecondLifeofFrancis,bk.2,chap.80,par.114,p.198,andchap.160,pp.25152.SeealsotheLeomaterial,chaps. 3and9,inRosalindB.Brooke,ScriptaLeonis,RufinietAngeliSociorumS.Francisci:TheWritingsofLeo...(Oxford:ClarendonPress,1970),pp.92,102. 144.ThomasofCelano,FirstLifeofFrancis,bk.1,chap.19,par.51,pp.3940. 145.FrancisofAssisi,Ruleof1223,chap.3,Opuscula,p.66trans.Fahy,Omnibus,pp.5960. 146.FrancisofAssisi,Ruleof1221,chap.9,Opuscula,pp.3638trans.Fahy,Omnibus,pp.3940.


147.FrancisofAssisi,Ruleof1221,chap.9,Opuscula,p.38,andRuleof1223,chap.3,Opuscula,p.67,respectively. 148.FrancisofAssisi,LettertoAlltheFaithful,Opuscula,p.91trans.Fahy,Omnibus,p.95.Sullivan(FastintheFirstOrderofFrancis,p.6)pointsoutthat fastingwasrelaxedintheorderduringFrancis'slifetime. 149.Brooke,ScriptaLeonis,chap.2,p.90.Sullivan(FastintheFirstOrderofFrancis,p.6)commentsthatFrancisrequiredmuchlessfastingthandidmany contemporaryreligiousorders. 150.Brooke,ScriptaLeonis,chap.1,pp.8890.SeealsoBonaventure,Legendamaior,pt.1,chap.5,par.7,pp.57980. 151.Brooke,ScriptaLeonis,chap.5,p.94ThomasofCelano,SecondLifeofFrancis,bk.2,chap.133,par.176,p.231. 152.Brooke,ScriptaLeonis,chap.26,pp.13436ThomasofCelano,SecondLifeofFrancis,bk.2,chap.15,par.44,p.158. 153.Brooke,ScriptaLeonis,chaps.29,101,pp.140,26668seealsostory4inBrooke'sappendix,pp.29698.ThomasofCelano,SecondLifeofFrancis,bk. 2,chap.23,pp.16264andTreatiseontheMiraclesofFrancis,chap.5,AF,vol.10,pp.28486.Bonaventure,Legendamaior,pt.1,chap.5,par.10,p.581, andpt.1,chap.7,par.12,ibid.,p.591. 154.Brooke,ScriptaLeonis,chaps.3940,pp.15660.ThomasofCelano,FirstLifeofFrancis,bk.1,chap.19,par.52,p.40Thomas,SecondLifeofFrancis, bk.2,chaps.48,94,pp.17778,207.Bonaventure,Legendamaior,pt.1,chap.6,par.2,pp.58283. 155.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.138,par.183,p.235trans.PlacidHermann,Omnibus,p.508.SeealsoThomas,SecondLifeof Francis,bk.2,chap.139,par.186,pp.23637. 156.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.151,par.199,p.244. 157.Seeabove,n.154andBonaventure,Legendamaior,pt.1,chap.4,par.8,pp.57475. 158.Bonaventure,Legendamaior,pt.1,chap.4,par.11,p.576,andchap.4,par.1,pp.57172. 159.SeeLambert,FranciscanPovertyFleming,IntroductiontoFranciscanLiteratureandLittle,ReligiousPoverty.Lambertisespeciallyusefulforexplaining howFrancisthoughtinimagesorstories,notlegalcategories.Muchrecentwork,emanatingfromM.Mollat'sseminarattheSorbonne,hasstressedtheimportanceof povertyasareligiousconcernagainstitssocialbackgroundsee,forexample,MichelMollat,ed.,Etudessurl'histoiredelapauvret(moyengeXVIesicle),2 vols.(Paris:PublicationsdelaSorbonne,1974). 160.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.60,par.93,pp.18586Bonaventure,Legendamaior,pt.1,chap.7,par.6,p.589. 161.SeeThomasofCelano,FirstLifeofFrancis,bk.1,chap.6,par.15,pp.1415SecondLifeofFrancis,bk.2,chaps.16263,pp.25356.Bonaventure, Legendamaior,pt.1,chap.2,par.4,andchap.14,par.3,pp.56465,62122. 162.Brooke,ScriptaLeonis,chap.39andappendix,chap.3,pp.15658,29496. 163.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.137,par.181,pp.23334.


164.ThomasofCelano,FirstLifeofFrancis,bk.3,chap.2,pars.12750,pp.10414.Onlyinpar.133(p.106)isfoodaninstrumentofhealing. 165.ThomasofCelano,SecondLifeofFrancis,bk.2,chaps.5357,59,137,pp.18285,23334. 166.Inearlyaccounts,Francissimplykissesaleper,ashamedbecausehehasearlierscornedtheirfoulsmell(ThomasofCelano,FirstLifeofFrancis,bk.1,chap.7, par.17,p.16),oreatswiththem(Brooke,ScriptaLeonis,chap.22,pp.12426).InThomas'sSecondLifeofFrancis(bk.1,chap.5,par.9,pp.13536),Francis kissestheleperandgiveshimalms.InBonaventure'sLegendamaior(pt.1,chap.1,pars.56,pp.56263),Franciskissesandgivesalmstolepersandtearsoffhis clothesforbeggars.OnlyinBonaventure'sLegendaminordowebegintofindanemphasisontheplacingofthemouthonthepusoflepers'sores(chap.1,eighth lesson,pp.65758)theaspectofFrancis'sasceticismthatItalianwomenwouldlaternotonlyechobutalsoheightenconsiderably. 167.Bonaventure,Legendamaior,pt.1,chap.1,par.6,pp.56263trans.Fahy,Omnibus,p.639. 168.ThomasofCelano,SecondLifeofFrancis,bk.2,chap.152,par.201,p.245Bonaventure,Legendamaior,pt.1,chap.9,par.2,p.598.Francis's eucharisticdevotionisnotstressedintheearliestmaterial. 169.FrancisofAssisi,Admonitions,number1ontheBodyofChrist,Opuscula,pp.35andLetter2,Opuscula,p.103. 170.Seeabove,n.169alsoFrancisofAssisi,ConcerningReverencefortheBodyofChristandCleanlinessoftheAltar,Opuscula,pp.2223andLetter5toAll SuperiorsoftheFriarsMinor,Opuscula,pp.11315.Franciswrites:"Et,siinaliquolocosanctissimumcorpusDominifueritpauperrimecollocatum,iuxtamandatum Ecclesiaeinlocopretiosoabeisponaturetconsigneturetcummagnavenerationeporteturetcumdiscretionealiisministretur.NominaetiametverbaDominiscripta, ubicumqueinvenianturinlocisimmundis,colliganturetinlocohonestodebeantcollocari"(p.114).SuchanattitudemakesthehostandtheBibleparallelandtreats bothasholyobjectsthestancereflectsnosensitivitytoeucharistasfood. 171.P.Hilarion,"S.Francisetl'eucharistie,"EtudesFranciscaines34(1922):52037. 172.OntheearlydocumentsconcerningClare,seeMariaFassbinder,"UntersuchungenberdieQuellenzumLebenderhl.KlaravonAssisi,"Franziskanische Studien23.3(1936):296335. 173.ThomasofCelano,LifeofClareofAssisi,chap.11,par.18,inPennacchi,Legenda,pp.2627trans.inTheLegendandWritingsofSaintClareofAssisi (St.Bonaventure,N.Y.:FranciscanInstitute,1953),pp.3132.SeealsoBullofcanonization,pars.5354,AASSAugust,vol.2(Paris,1867),p.750,andThomas, FirstLifeofFrancis,bk.1,chap.8,pars.1920,pp.1718Thomaslistspoorfoodandclothing,andabstinencefromfoodandspeech,astwoofthesixvirtuesof Clare'sfollowers. 174.ClareofAssisi,Rule,chap.3,par.10,inSeraphicaelegislationistextusoriginales...(Quaracchi:CollegiumS.Bonaventurae,1897),p.56. 175.ClareofAssisi,ThirdLettertoAgnes,inSeton,"LettersfromSaintClare,"p.517. 176.ClareofAssisi,Rule,chap.3,par.6,Seraphicaelegislationistextus,p.56. 177.Clare,ThirdLettertoAgnesinSeton,"LettersfromSaintClare,"p.517.


178.Ibid. 179.ThomasofCelano,LifeofClareofAssisi,chap.17,par.28,inPennacchi,Legenda,pp.3940. 180.Ibid.,chap.13,par.21,pp.3031. 181.DonaldAttwater,ed.,ThePenguinDictionaryofSaints(Harmondsworth:Penguin,1965),p.87andCorblet,Histoiredogmatique,vol.2,p.551. 182.ThomasofCelano,LifeofClareofAssist,chaps.910,pars.1516,inPennacchi,Legenda,pp.2326.SeealsoBullofcanonization,par.56,p.750. 183.ThomasofCelano,LifeofClareofAssisi,chap.7,par.12,pp.1920.Seealsoibid.,chap.24,par.38,pp.5253. 184.Ibid.,chap.8,par.14,p.23. 185.Ibid.,chap.23,par.37,pp.5052. 186.ZeffirinoLazzeri,ed.,"IlProcessodicanonizzazionediS.Chiarad'Assisi,"inArchivumFranciscanumHistoricum13(1920),3dwitness,par.29,p.458. Seealso6thwitness,par.13,p.466. 187.SeeBynum,JM,pp.11069andabove,n.139. 188.AlbertHuyskens,QuellenstudienzurGeschichtederhl.ElisabethLandgrfinvonThringen(Marburg:Elwert,1908),p.70n.3. 189.Seeabove,n.19. 190.HenrySuso,BchleinderEwigenWeisheit,chap.13,inSuso,DeutscheSchriften,pp.25152. 191.LifeofSuso,chap.42,inSuso,DeutscheSchriften,pp.14243.Susoborehismother'snameratherthanhisfather'stheprologueofthe1512editionofhis workssuggeststhathemadethischoiceinordertoimitatehervirtuesmoreeasily.SeeHeller,introductiontoEdward,trans.,Exemplar,vol.1,pp.xxxviixxxviii. 192.Suso'svitaseemstohavebeencompiledbysomeonewhoreworkedElsbetStagel'snotesitincorporatessomeofSuso'scorrespondence,butthatalsocanbe demonstratedtohavebeenreworkedseeHeller,intro.toEdward,trans.,Exemplar,vol.1,pp.xviiixliandAigrain,L'Hagiographie,p.314. 193.See,forexample,LifeofSuso,chaps.28,3738,inSuso,DeutscheSchriften,pp.8283,11430. 194.Ibid.,chap.29,pp.8485trans.Edward,Exemplar,vol.1,pp.8081.LifeofSuso(chap.22,p.63)reportsthatacertainAnnareceivedavisionofSuso withchildrenhangingontohisclothingchap.33(p.99)reportsElsbet'sownwordstoSuso,comparinghimtoapelicanwhofeedsheryoungwithherownblood. WhilethesetwopassagesmightindicatethatSuso'stwofemalefollowerssuggestedthefemininemetaphorsinthevita,Suso'sownvisionscontainother,farmore explicitlymaternalimages. 195.Ibid.,chap.20,pp.5556.Suso,meditatingonJob7:1,sawavisionofayoungmanofferinghimknightlygarb.Onceclothedinthismilitaryattire,Suso complained:"Wafengot!wieistesmirergangen,wazistussmirworden!Solichnuritensin?Ichpflegehinnanfrvillieberminsgemaches."Heagreedtoacceptthe knightlyrolewhenheunderstoodthatitmeantstruggleandpain,notglory. 196.Suso,Bchlein,chap.2,inDeutscheSchriften,p.204trans.Edward,Exemplar,vol.2,p.9.


197.LifeofSuso,chap.20,pp.5859. 198.Suso,Bchlein,chap.5,pp.21112trans.Edward,Exemplar,vol.2,pp.1718.InLifeofSuso(chap.10,p.30)hereceivestheChristchildtocuddlefrom MarybutisdescribedasSimeon. 199.LifeofSuso,chap.3,p.15andSuso,Bchlein,chap.6,p.216.Inthelatterpassage,Susospeaksofthesoulasafawnthathasleftthemotherdoe. 200.LifeofSuso,chap.3,p.15trans.Edward,Exemplar,vol.1,p.12.SusoratherlikedtheimageofGodasmotherseeSuso,Sermon1inSuso,Deutsche Schriften,p.498. 201.LifeofSuso,chap.18,pp.4950.AlthoughthepassagedoesnotexplicitlysaySusonursed,itdrawsananalogybothtoasickclericdescribedbyVincentof BeauvaisandtoJohnChrysostom,whodid. 202.Ibid.,chap.35,p.107.Seealsoabove,n.85. 203.Indeed,Susoonceusedwomanasatermofdisapprobationwhendescribinghimselfseeibid.,chap.44,pp.14952. 204.Suso,Briefbchlein,Letter4inSuso,DeutscheSchriften,p.369.WeshouldnotforgetthatthecompileroftheExemplarperhapsanunreworkedthese letters. 205.Ibid.,p.370.Susoalsousedfemaleimagesfortheholysoulwhenheaddressedwomen.See,forexample,Suso,Letter14(GrossesBriefbuch,inSuso, DeutscheSchriften,pp.44748),whereSusosaysGodhastaughtustopracticeausterityandhasraisedusfromkitchenservantsintoqueens. 206.Seeesp.LifeofSuso,chaps.4,1318,29,31,pp.1517,3453,8486,9092. 207.Suso'sfoodvisionsandmetaphorsmostlyinvolvefruit.Seeibid.,chaps.7,11,pp.2425,3132.InBchlein(chap.23,p.303),headdressestheeucharistas fruit,jewel,pomegranate,andgrapeinchap.19(p.276)heseesChristlyingdeadunderthecrossasfruit:"Herr,...alleminsinnewerdentgespisetvondiesersuzen *vruhtunderdisemlebendenbome*desKrzes."TheprominenceoffruitasanimagereflectsnotonlySuso'spersonaltastebutalsohisawarenessthathumankind firstfellthrougheatingfruitseeibid.,chap.16,pp.26566,whereMary,thesecondEve,isseenasaparadiseinwhichthesavingfruitgrows. 208.LifeofSuso,chap.20,p.61.Chap.7(p.25)alsopointsoutthathishungerandthirstsometimesgotoutofcontrol. 209.Ibid.,pp.2425. 210.ToSuso,foodwasjustoneofmanyimagesofGod'sgoodness.Forexample,inBchlein(chap.5,pp.21116),Wisdomsaystosoul:"IamyourBrother, yourSpouse....Batheyourselfinmyblood....Iwillgiveyoutheringofbetrothalandnewgarments....Iwillgiveyoumedicine,"etc.Inchap.23(pp.290303), whereeucharistandthereforefoodisemphasized,thesoulisseenasbathedandcladaswellasfed. 211.Suso,Briefbchlein,Letter8,pp.38586. 212.LifeofSuso,chap.7,pp.2425.SeeHuizinga,Waning,p.152. 213.SeeMaryFelicitasMadigan,The"PassioDomini"ThemeintheWorksofRichardRolle:HisPersonalContributioninitsReligious,Cultural,and LiteraryContext,SalzburgStudiesinEnglishLiterature,ElizabethanandRenaissanceStudies79(Salzburg:Institut


frenglischeSpracheundLiteratur,UniversittSalzburg,1978)andKieckhefer,UnS,pp.89121. 214.HenryPomer,LifeofJanvanRuysbroeck,"DeoriginemonasteriiViridisvallis...,"bk.2,chap.3,AB4,28485. 215.Seeabove,n.50andEricColledge,intro.toColledgeandM.Jane,SpiritualConferences,pp.412. 216.OnRolle,seeHopeEmilyAllen,WritingsAscribedtoRichardRolle,HermitofHampole,andMaterialsforHisBiography,ModernLanguageAssociation ofAmericamonographseries3(NewYork:Heath,1927)FrancesM.M.Comper,TheLifeofRichardRolleTogetherwithanEditionofHisEnglishLyrics (London:Dent,1928)andNicoleMarzac,RichardRolledeHampole(13001349):Vieetoeuvresetditioncritique...duTractatussuperApocalypsim, Thsepour...UniversitdeParis:FacultdesLettresetSciencesHumaines(Paris:Vrin,1968).TheOfficepreparedforRolleisinS.W.Lawley,ed.,Breviarium adusuminsignisecclesieEboracensis,vol.2,PublicationsoftheSurteesSociety75(Durham:Andrews,1883),cols.785820.Onthemiracles,seethetablein Comper,LifeofRolle,pp.31114.Allthemiraclesarecures.Ofthoseforadults,13areforwomen,7formen.Ofthesevenmiraclesconcerningchildren,sixare formalechildrenandoneforafemalechild,butsomeofthoseforboysareperformedatamother'sbehest. 217.DavidKnowles,TheEnglishMysticalTradition(London:BurnsandOates,1961),p.62.TheconjectureaboutthereasonforRolle'smisogynyisKnowles'. 218.JohnTauler,Sermon12forTuesdayinPassionWeek,inTauler,DiePredigten,p.58trans.ColledgeandM.Jane,SpiritualConferences,p.64.(The variouseditionsofTaulernumberthesermonsdifferently.IhaveusedVetter'snumbering.ThereisaconcordancetotheeditionsinGeorgHofmann,ed.,Johannes Tauler:Predigten[Freiburg:Herder,1961],pp.62834). 219.Tauler,Sermon49fortheNativityofMary,inTauler,DiePredigten,p.220.InSermon37(p.142),commentingonLuke15:8,heseesthewomanwho searchesforalostkidasasymbolofGod'sdivinityandthelampsheholdsasChrist'shumanity. 220.Tauler,Sermon31:SecondSermonforCorpusChristi,inTauler,DiePredigten,pp.31011foratranslationseebelow,p.111. 221.Tauler,Sermon33:FourthSermonforCorpusChristi,inTauler,DiePredigten,p.130trans.ColledgeandM.Jane,SpiritualConferences,p.274. 222.Tauler,Sermon81:FirstSermonforTriduumofSt.Cordula,DiePredigten,pp.43132. 223.Tauler,Sermon27:ThirdSermonforPentecost,inTauler,DiePredigten,pp.11014.Forharsherimages,seetheendofSermon37(pp.14447),where TaulerseesGodasastiffbroomthreshingusandscrubbingusclean(cf.n.219above).InSermon11forMondayinPassionWeek(ibid.,pp.5354),Taulerspeaks ofGodasafatherthrashinghischildrenwithagoodstoutstick. 224.SeeTauler,Sermon9forSecondSundayinLent,inTauler,DiePredigten,pp.4046.Ishallreturntothesignificanceofthissermonbelow,pp.24243. 225.OfficeofRolle,Reading5,inBreviarium,vol.2,cols.79596trans.Comper,LifeofRolle,p.304. 226.RichardRolle,LeChantd'amour(Melosamoris),ed.E.J.F.Arnouldandtrans.


thenunsofWisques,2vols.,SC16869,Srmon.3233(1971),chap.34,vol.2,pp.2426.Seealsoibid.,chap.42,pp.92100. 227.RichardRolle,Incendiumamoris,chap.11,inRichardRolle,The"IncendiumAmoris"ofRichardRolleofHampole,ed.,MargaretDeanesly,Publications oftheUniversityofManchester,HistoricalSeries26(Manchester:UniversityPress,1915),p.175trans.anded.byF.ComperfromRichardMisyn'stextinThe FireofLoveorMelodyofLoveandtheMendingofLife...translatedbyRichardMisyn...(London:Methuen,1914),pp.5354.SeealsoE.J.Arnould, "RichardRolleofHampole,"inJamesWalsh,ed.,PreReformationEnglishSpirituality(Bronx,N.Y.:FordhamUniversityPress,n.d.),p.143andthetableof themescitedbelow,n.248. 228.Rolle,Incendiumamoris,chap.39,pp.26566trans.ComperfromMisyninFireofLove,p.176. 229.Rolle,Chantd'amour,chap.40,vol.2,pp.7880. 230.Tauler,Sermon3forEpiphany,inTauler,DiePredigten,pp.1819trans.ColledgeandM.Jane,SpiritualConferences,pp.8283. 231.Tauler,Sermon31:SecondSermonforCorpusChristi,inTauler,DiePredigten,p.313:"Unddisewise,wiemansichallecreaturensollossenjagenunddaz lidenrechtergelossenheitundswiglicheit,dasgotberalleubunge*,vastenoderwachenoderbettenoderhalsbergetragenodertusentruten*ufdirzerslagen." 232.Tauler,Sermon27:ThirdSermonforPentecost,inTauler,DiePredigten,p.112. 233.Tauler,Sermon65:FourthSermonfortheExaltationoftheHolyCross,inTauler,DiePredigten,p.355trans.ColledgeandM.Jane,SpiritualConferences, p.104. 234.Tauler,Sermon49fortheNativityoftheVirgin,inTauler,DiePredigten,pp.22021trans.ColledgeandM.Jane,SpiritualConferences,p.170. 235.SeeTauler,Sermon40:FirstSermonfortheNativityofJohntheBaptist,inTauler,DiePredigten,p.166. 236.Tauler,Sermon21:FourthSermonforAscension,inTauler,DiePredigten,pp.8687trans.ColledgeandM.Jane,SpiritualConferences,pp.9798. 237.SeeJanvanRuysbroeck,TheSpiritualEspousals,trans.EricColledge,ClassicsoftheContemplativeLife(NewYork:Harper,n.d.),bk.2,chap.17,p.135, andchap.43,pp.17172.ThestandardeditionsofRuysbroeckareJanvanRuusbroec:WerkennaarhetstandaardhandschriftvanGroenendaal,ed.J.B. Poukensetal.,4vols.,HetRuusbroecGenootschapteAntwerpen(AmsterdamandMechlin:DeSpieghelandHetKompas,1932),andJanvanRuysbroeck,Opera omnia,ed.J.Alaertsetal.,10vols.,Studinentekstuitgavenvanonsgeestelijkerf20(Tielt:Lannoo,1981).SeealsoStephenAxters,LaSpiritualitdesPays Bas:L'Evolutiond'unedoctrinemystique,BibliothecaMechliniensis,2dser.,vol.1(LouvainandParis:NauwelaertsandVrin,1948),pp.4160. 238.JanvanRuysbroeck,"LesSeptCltures,"chap.8,OeuvresdeRuysbroeckl'Admirable,trans.theBenedictinesofSt.PauldeWisques,vol.3,3ded. (Brussels:Vromant,1921),pp.16972. 239.HenryPomer(inhisLifeofRuysbroeck,chap.22,p.299)citesasevidenceofRuysbroeck'sgreatobediencehisacceptanceofhissuperior'scommandthathe notdrinkwhilegravelyill.Onthisoccasionheclearlycravedadrink,andthereisnosuggestionthathenormallypracticedfoodasceticism.ThestatementofLoomis (inWhiteMagic,pp.23,141n.102)thatRuysbroeckfastedfromthebreastasachildisamistake.The


parallelPomerdrawstoSt.Nicholas(inchap.1,p.283)isnottofastingbuttoanothermiracle. 240.LifeofRuysbroeck,chap.29,pp.3034.Ruysbroeckmadeapointofcelebratingmassdailyhewasloathtorelinquishthispracticeeveninillhealthandold age(chaps.2728,pp.3023). 241.SeeJeanBaptistePorion,"Hadewijch,mystiqueflamandeetpotesse,13esicle,"DS,vol.7,pt.1(1969),cols.1822EricColledge,intro.toRuysbroeck, SpiritualEspousals,pp.1011andColumbaHart,intro.toHadewijch:Works,pp.1416. 242.Seeesp.Ruysbroeck,SpiritualEspousals(bk.2,chaps.920,pp.96143)forimagesofwaterandheat.Chap.17(pp.12634)discussesthesacrament, withverylittleeatingimagery.Inbk.2(chap.21,pp.13942)Ruysbroeckusesunquenchablehungerasanimageofdesire,butthepassagequicklyreturnstoimages oftouchandfire.RuysbroeckdoesstresstheimportanceofChrist'shumanityastheredemptionofourown,andheusuallysymbolizesthishumanityinfemaleimages (seeprologue,p.43). 243.Ruysbroeck,"LeMiroirdusalutternel,"chap.3,Oeuvres,pp.6566. 244.Ibid.,chap.7,pp.7980. 245.Ruysbroeck,LeLivredesXIIbguines,trans.PaulCuylits(Brussels:LibrairieSpcialedesBeauxArts,1900),pp.7576,99. 246.Ibid.,p.80. 247.SeeRuusbroec:Werken,vol.4,p.4nn.2,7,andp.5n.6.InRuysbroeck'sfirstwork,TheKingdomofLovers,heborrowedoneofHadewijch'smost extendedfoodmetaphors(PoemsinCouplets,number16,lines3140seeHartinHadewijch:Works,p.14. 248.SeeFranoisVandenbroucke,Tableofthemes,inRolle,Chantd'amour,vol.2,pp.277321,esp.pp.287,295,3079.Riehle(Mystics,pp.1078)has pointedouttheabsenceofaeucharisticemphasisinRolle,ashasVandenbrouckeinChantd'amour,vol.2,p.308. 249.Rolle,Incendiumamoris,chap.32,p.237.Foranextendedexampleofeatingimagerybecomingimageryofsong,seeRolle,Chantd'amour,chap.43,p. 110.SeealsoVandenbroucke(Chantd'amour,vol.2,p.285),whopointsoutthatsensoryexperiencesareinterchangeableinRolle'svocabularyandRiehle, Mystics,p.120. 250.SeeTauler,Sermons3033forCorpusChristi,inTauler,DiePredigten,pp.11831,29298,31016.Forquotationsseeabove,pp.1and4. 251.Tauler,Sermon30:FirstSermonforCorpusChristi,inTauler,DiePredigten,p.293trans.ColledgeandM.Jane,SpiritualConferences,p.258. 252.Tauler,Sermon32:ThirdSermonforCorpusChristi,inTauler,DiePredigten,p.118trans.ColledgeandM.Jane,SpiritualConferences,p.264. 253.Tauler,Sermon32,p.119,trans.ColledgeandM.Jane,SpiritualConferences,p.265. 254.Tauler,Sermon11forMondayinPassionWeek,inTauler,DiePredigten,pp.5056. 255.Tauler,Sermon24:SecondSermonfortheSundayafterAscension,inTauler,DiePredigten,pp.97101andSermon7forSeptuagesima,pp.3031. 256.Tauler,Sermon31:SecondSermonforCorpusChristi,inTauler,DiePredigten,pp.31011trans.ColledgeandM.Jane,SpiritualConferences,p.259. SeealsoSermon


33(pp.12526),whereTaulerwarnsthatspiritualcommunionmaybepreferabletoactualreceptionifthereceptionisautomaticorhurried. 257.Suso,atleastonce,callstears"womanly"whenhemeanssomethingnegativebytearsi.e.,whiningandweaknessseeLifeofSuso,chap.44,inSuso, DeutscheSchriftenpp.14952. 258.Cf.RaymondofCapua,whowasmoreunambiguousinadmiringanasceticisminwomenthathewasunabletoattainseeabove,n.98. 4 FoodintheLivesofWomenSaints 1.LifeofLukardisofOberweimar,AB18,pp.33738. 2.Bolton,"Mulieressanctae,"pp.7795idem,"Vitaematrum,"pp.25373McDonnell,BeguinesRoisin,L'Hagiographieidem,"L'Efflorescencecistercienne etlecourantfminindepitauXIIIesicle,"Revued'histoireecclsiastique39(1943):34278R.DeGanck,"TheCistercianNunsofBelgiumintheThirteenth Century,"CistercianStudies5(1970):16987andBynum,''WomenMystics."TothegroupofLowCountrywomenItreatbelowonemightaddYvetteofHuy(d. 1228)seeAlbertD'Haenens,"Ivetta,"BS,vol.7,cols.99293. 3.Thereisreasontothinkthathagiographers,inrevisingearliermaterialorwritinguptheirpersonalknowledgeofasubject,wereespeciallycarefultopreservethe sayings,orlogia,ofholypeopleexactlyastheyheardorreadthem.Thereforethewordsattributedtowomenmaybeespeciallytrustworthyevidence.SeeMartinus Cawley,"TheLifeandJournalofLutgardofAywires...,"VoxBenedictina1.1(January1984):2022.TheauthoroftheLifeofIdaofLau,forexample, preservessomeofherphrasesinthevernaculartheVitapriorofLidwinaofSchiedamalsopreservesafewvernacularwords. 4.JamesofVitry,LifeofMaryofOignies,bk.1,chap.4(AASSJune,vol.5,p.556)saysthatMarysometimesheardthewordsofothers"asifhoneywasinher mouth"sheoncereceivedsuchconsolationfromspiritualadvicethatshecouldnoteatmaterialfoodforawholeday.Bk.2,chap.10(p.566)speaksofMary's spiritualcommunionas"eating,""drinking,"and"beingfilled."Seealsop.59above. 5.Ibid.,bk.1,chap.1,p.551.Jameswasawarethatfastingnormallyproducesheadachesseeibid.,chap.2,p.552. 6.ThomasofCantimpr,LifeofLutgardofAywires,bk.1,chap.1,AASSJune,vol.4,p.192.Thestoryisagraphicone.AlthoughLutgardmanagedtoescape, theman'sservantsaccusedhimofrapeandLutgardwasjeeredasarapevictimwhensherodeintothetownofSt.Trond.ForearlierversionsofthelifeofLutgard, seeG.Hendrix,"PrimitiveVersionsofThomasofCantimpr'sVitaLutgardis,"Cteaux:Commentariicistercienses29(1978):153206.(Thisincidentis recordedonpp.16263and17778.)HendrixarguesconvincinglythatboththeshorterLatintext(VA)andasecondLatintextonwhichtheFrenchtext(FL)is basedareolderthanThomas'slife.Ontheotherhand,MartinusCawley("LifeandJournalofLutgard,"pp.2022)hasarguedthatThomas'stextgivesusbetter accesstoLutgard'slifebecauseVAtendstoomitany


referencestosurvivors.IhavecitedThomas'svitabelowunlessdifferencesamongthetextsmakeitnecessarytociteallthree. 7.ThomasofCantimpr,LifeofLutgard,bk.1,chap.1,p.191. 8.Ibid.,bk.3,chap.6,p.205. 9.LifeofIdaofLouvain,bk.1,chap.4,AASSApril,vol.2,pp.16465.Thepassagenotonlycallsreading"eating,"italsodrawsaparallelbetweeneatingand beingpregnant.ThevitaofIda,ofuncertaindateandwrittenbyananonymousauthorwhoclaimstobedrawingonearliermanuscripts,isnotaveryreliablehistorical account.Forexactlythisreason,itisausefulindicationofwhatmiraclesandbodilymanifestationsconfessorsandchurchofficialsconsideredtypicalofand appropriatetofemalesaints.Seebelow,n.32. 10.Ibid.,bk.1,chap.6,p.168. 11.LifeofJulianaofCornillon,bk.1,chap.2,AASSApril,vol.1,p.445.AccordingtoJuliana'shagiographer,sheatesolittlematerialfoodthathersistersinsisted nohumancreaturecouldsubsistonsolittle,butshelivedfromthesweetnessofprayerandeucharisticdesire.OnthevitaofJuliana,seeC.Lambot,"UnPrcieux ManuscritdelaviedesainteJulienneduMontCornillon,"inMiscellaneahistoricainhonoremAlbertideMeyer,UniversitdeLouvain,Recueildetravaux d'histoireetdephilologie,3esr.,22fasc.,vol.1(Louvain:Bibliothquedel'Universit,1946),pp.60312. 12.JamesofVitry,LifeofMaryofOignies,bk.2,chap.10,pp.56668. 13.LifeofMargaretofYpres,chap.24,ed.G.G.Meersseman,in"FrresprcheursetmouvementdvotenFlandreauXIIIesicle,"ArchivumFratrum Praedicatorum18(1948):11819. 14.LifeofAliceofSchaerbeke,chap.2,pars.911,AASSJune,vol.2(Paris,1867),pp.47374. 15.Ibid.,chap.2,par.12,p.474. 16.LifeofGertrudevanOosten("oftheWest")orofDelft,chap.2,par.7,AASSJanuary,vol.1(Paris,1863),p.350.OnGertrude'sfoodasceticism,seeibid., par.9,p.350. 17.JamesofVitry,LifeofMaryofOignies,bk.2,chap.12,p.571.Cf.JamesofVitry,Historiaoccidentalis,ed.Hinnebusch,chap.38,p.207,whichreferstothe sameincident. 18.LifeofIdaofLau,chap.2,pars.1920,pp.11314. 19.Ibid.,chap.2,par.18throughchap.3,par.26,pp.11215. 20.LifeofMargaretofYpres,chap.40,inMeersseman,"Frresprcheurs,"p.122. 21.LifeofIdaofLouvain,bk.1,chap.3,AASSApril,vol.2,pp.16263.LifeofChristinatheAstonishing,chap.2,par.17,AASSJuly,vol.5(Paris,1868),p. 653. 22.LifeofIdaofLouvain,bk.1,chap.6,p.163. 23.Insomecaseseucharisticdevotionbeganveryyoung.MargaretofYpresexperiencedextraordinarydesireforthehostandsweetsmellsaccompanyingitatage fiveseeherLife,chap.2,inMeersseman,"Frresprcheurs,"p.107.Amalechildsaintfromthesameperiodandgeographicalareaalsoexpressedextraordinary eucharisticpiety:Acher(orArchas)ofTurnhout(,BonumUniversale,bk.2,chap.27(notfoliated). 24.LifeofAlice,chap.2,pars.910,AASSJune,vol.2,47374LifeofIdaof


Lau,chap.2,pars.1920,AASSOctober,vol.13,pp.11314.SeealsoLifeofJuliana,chap.2,AASSApril,vol.1,pp.44546. 25.LifeofIdaofLouvain,bk.1,chap.4,andbk.3,chap.1,AASSApril,vol.2,pp.164,18283. 26.ThomasofCantimpr,LifeofLutgard,bk.2,chap.1,par.14,AASSJune,vol.4,pp.19899cf.VAinHendrix,"PrimitiveVersions,"p.168.Thevindictive noteinthestorymaynotbealateradditionbyBrotherBernard,astheBollandistssuggest:seeHendrix,"PrimitiveVersions,"p.161.Accordingtoalltheearlylives, Lutgardsaid,"Ishallobey...butChristwillvindicatethisinjuryinyourbody."Theabbesswasafflictedwithpainuntilsherelaxedtheprohibition. 27.LifeofIdaofLouvain,bk.2,chap.3,p.173ThomasofCantimpr,LifeofLutgard,bk.1,chaps.12,pp.19294. 28.ThomasofCantimpr,LifeofLutgard,bk.1,chaps.12,pp.19294.TheFrenchvita(ed.Hendrix,"PrimitiveVersions,"p.181)hasLutgardsuckingthesong fromthelamb'slips.Theseexperiencesofcomforttendedtocomeafterperiodsoftrial.Lutgard'snursingvisionscameaftershehadexperiencedattemptedrapeand humiliation.IdaofLouvainreceivedanextendedvisionofChristasababyaftershewasaccusedofhavingbeenmadepregnantbyalocalfriarseeLifeofIda,bk.2, chaps.45,pp.17577. 29.ThomasofCantimpr,LifeofLutgard,bk.1,chap.2,par.15,p.194.TheFrenchlifedescribesthevisionmoregraphicallyseeHendrix,"PrimitiveVersions,"p. 180.Ontheimportanceofthemouthinthisvita,seeCawley,"LifeandJournalofLutgard,"pp.4044. 30.LifeofIdaofLau,chap.2,par.20,AASSOctober,vol.13,pp.11314. 31.LifeofMaryofOignies,bk.1,chap.2,pp.55152. 32.LifeofIdaofLouvain,bk.1,chap.3,pp.16263.AlaterLowCountrywoman,GertrudevanOosten,supposedlyreceivedallfivestigmatain1340whenshe prayedbeforeacrucifix.ThewoundsbledseventimesadaywhileGertrudeexperiencedecstasy.ShelateraskedGodtotakeawaythebleeding,butthescars remained.SeeLifeofGertrudevanOosten,AASSJanuary,vol.1,pp.34953andViesdessaintsetdesbienheureux...,vol.1(1935),pp.12830.For doubts,partlyhistoricalandpartlytheological,aboutthesecases,seeDebongnie,"Stigmatisations,"pp.34,4950. 33.PhilipofClairvaux,LifeofElizabeth[ofSpalbeek],"nunofHerkenrode,"intheBollandists,eds.,CataloguscodicumhagiographicorumBibliothecaeregiae Bruxellensis,Subsidiahagiographica1,vol.1,pt.1(Brussels:TypisPolleunis,CeuterickandLefbure,1886),pp.363,378.Despitethereferencetoherasanun, Elizabethappearstohavebeenarecluseinherpaternalhome:seeDebongnie,"Stigmatisations,"pp.3031. 34.OnLutgard'sthreesevenyearfastsforthesakeofothers,seeThomasofCantimpr,LifeofLutgard,bk.2,chap.1,pars.1,9,andbk.3,chap.4,pp.196, 198,205.TherearereferencestoLutgard'sfoodasceticismthroughoutthevita.OnthesavingeffectsofAlice'ssuffering,seeLifeofAlice,AASSJune,vol.2,pp. 47177. 35.LifeofMaryofOignies,bk.1,chaps.24,pp.55156LifeofIdaofLouvain,bk.1,chap.2,pp.16062LifeofJuliana,bk.1,chaps.13,pp.44347Life ofIdaofLau,chap.4,par.136,andchap.6,par.54,pp.118,123andLifeofMargaretofYpres,chaps.3,16,40,inMeersseman,"Frresprcheurs,"pp.108, 114,122.Juliana'sbiogra


pherreportsthatonce,inanefforttoachievepeacewithhersisters,sheputfoodintohermouth,toreitwithherteeth,andturneditoverinhermouth,but"she wasnotabletoswallowamorselofit"(bk.1,chap.3,p.447). 36.ThomasofCantimpr,LifeofLutgard,bk.2,chap.1,par.2,p.196.TheauthoroftheLifeofIdaofLauexplainedsuchphenomenathus:"Shouldwemarvel that,tosomeonewhowasfedbyprayerandmeditation,eatingearthlyfoodintherefectorywouldbeodious?"(chap.3,par.26,p.115). 37.PhilipofClairvaux,LifeofElizabeth[ofSpalbeek],Cat.cod.hag.Bruxellensis,vol.1,pt.1,p.378.SeeDebongnie,"Stigmatisations,"p.33n.1. 38.LifeofChristina,chap.2,par.22,AASSJuly,vol.5,p.654. 39.Seeabove,chap.3n.65. 40.LifeofMargaretofYpres,chaps.43,48,inMeersseman,"Frresprcheurs,"pp.123,125. 41.ThomasofCantimpr,LifeofLutgard,bk.3,chap.1,p.204. 42.LifeofAlice,chap.2,pars.2223,andchap.3,par.27,pp.47576. 43.Seeabove,n.34. 44.LifeofMaryofOignies,bk.1,chap.3,p.553. 45.LifeofAlice,chap.3,par.26,p.476. 46.LifeofMaryofOignies,bk.1,chap.4,p.555.SeealsoBolton,"VitaeMatrum,"pp.25759. 47.LifeofChristina,chap.2,par.22,p.654. 48.LifeofJuliana,bk.1,chap.1,pp.44445. 49.LifeofIdaofLouvain,bk.1,chap.5,p.167.Wecanoftensee,inaccountsoffastingwomen,thatfoodwasreadilyavailableifthewomanwantedit. 50.Ibid.,bk.1,chap.5,pp.16566,andbk.2,chap.5,p.178. 51.ThomasofCantimpr,LifeofLutgard,bk.2,chap.2,pars.1920,25,pp.200201. 52.LifeofJuliana,bk.1,chap.6,p.451. 53.ThomasofCantimpr,LifeofLutgard,bk.2,chap.2,par.21,p.200.Theearlierversionsspeakmerelyofahemorrhagefromwhichshesuffered. 54.Ibid.,bk.1,chap.1,par.23,p.193. 55.PhilipofClairvaux,LifeofElizabeth[ofSpalbeek],Cat.cod.hag.Bruxellensis,vol.1,pt.1,p.378:"deoreipsiusnecsalivanecsputum,necdenaribusejus aliqueemunctionismateriaauthumoraliquisemanavit." 56.Theconcernisnot,however,apeculiarityofThomas's,foritisalreadypresentintheearlierversionorversionsofLutgard'svita.SeethetextsinHendrix, "PrimitiveVersions." 57.LifeofChristina,chap.1,par.9,andchap.2,par.19,pp.652,65354. 58.ThomasofCantimpr,LifeofLutgard,bk.1,chap.1,par.13throughchap.2,par.19,pp.19394. 59.Ibid.,bk.1,chap.1,par.12,p.193. 60.LifeofMaryofOignies,bk.2,chap.10,p.567.OnNicholas,seeCharlesW.Jones,SaintNicolasofMyra,Bari,andManhattan:BiographyofaLegend (Chicago:UniversityofChicagoPress,1978). 61.LifeofGertrudevanOosten,chap.3,par.14,p.350thelactationsupposedly


lastedfromChristmastothefeastofthePurification(Feb.2).Forherloveofchildrenandhertemptationbythedevilintheformofababy,seechap.2,par.11, p.350. 62.ThomasofCantimpr,LifeofLutgard,bk.2,chap.2,par.23,p.200. 63.LifeofMaryofOignies,bk.2,chap.12,p.572. 64.LifeofJuliana,bk.2,chap.9,p.475. 65.ThomasofCantimpr,forexample,emphasizestheimportanceofLutgardas"motherandnurseofthefriars."Butmanyofhermiraclesduringlifeandallofher miraclesafterdeathwereperformedforwomenseeThomas,LifeofLutgard,pp.189210. 66.Asherhagiographerspointout,Lidwina'sveryname,takenfromlydandwyt(i.e.,paterelate)meant"tosufferprofusely." 67.JohnGerlach,Lidwina'srelativeandsacristanofthemonasteryatWindesheim,wrotehervitainDutch.AsecondLife(theVitaprior)inLatinisbasedon Gerlach'sandaugmentedwithinformationfurnishedbyJohnWalterofLeiden,Lidwina'slastconfessor,andothers.Thisvita,withtheadditionsindicatedinbrackets, isgiveninAASSApril,vol.2(Paris,1865),pp.271301,alongwithasecond,longerLifebyJohnBrugman(Vitaposterior),ibid.,pp.30260.TheBollandists attributedboththeVitapriorandtheVitaposteriortoBrugman,butthemorerecenteditoroftheVitaposteriordisagrees,basinghisargumentonthedivergences ofstylebetweenthetwoaccounts.SeeJohnBrugman,IohannisBrugmanO.F.M.VitaAlmeVirginisLidwine,ed.A.deMeijer,RijksuniversiteitteUtrecht tekstenendocumenten2(Groningen:Wolters,1963),pp.vxiii.Afourthvita,byThomasKempis,isanabridgementofBrugmanwithsomeaddeddetailsthat ThomasculledatSchiedamseeThomasKempis,LifeofLidwina,inThomasKempis,Opereomnia,ed.H.Sommalius,vol.3(16001601newed.Cologne: Krakamp,1759),pp.11464.SeealsoJ.K.Huysmans,SainteLydwinedeSchiedam,16thed.(Paris:Plon,1909),whichmustbeusedwithcautionand Debongnie,"Stigmatisations,"pp.5556.MuchofthefollowingdiscussionhasappearedinCarolineBynum,"Fast,Feast,andFlesh:TheReligiousSignificanceof FoodtoMedievalWomen,"Representations11(August1985):125.IhavecitedtheVitaposteriorinboththeAASSeditionandthedeMeijeredition. 68.Forthedocument,seeAASSApril,vol.2(Paris,1865),pp.3045. 69.Brugman,Vitaposterior,pt.3,chap.6,pars.22526,AASSApril,vol.2,pp.34748(deMeijered.,pp.13135). 70.Brugman,Vitaposterior,pt.3,chap.6,pars.21821,p.346(deMeijered.,pp.13031). 71.Brugman,Vitaposterior,pt.1,chap.2,par.19,p.308(deMeijered.,pp.2021).Cf.ThomasKempis,LifeofLidwina,pt.1,chap.5,pp.11819. 72.Vitaprior,chap.1,par.9,AASSApril,vol.2,p.272seealsoThomasKempis,LifeofLidwina,pt.1,chap.2,pp.11617. 73.Vitaprior,chaps.12,pp.27275Brugman,Vitaposterior,pt.1,chaps.12,pp.3059(deMeijered.,pp.1221).Seealsoplate10,anearlyillustrationof Lidwina'slife,whichmaybethefirstpictureofskatesfromtheNetherlands. 74.Seethedocumentcitedinn.68aboveandVitaprior,chaps.23,pp.27377,andchap.7,par.76,p.286.TheauthorsofboththeVitapriorandVita posteriorgiveextensiveandhorrifyingmedicaldetails.


75.Brugman,Vitaposterior,pt.2,chap.1,par.72,p.319seealsoibid.,pt.1,chap.4,par.33,p.311(deMeijered.,pp.29,52).Itisalsoimportanttonotethat LidwinaatfirstrespondedtoherterribleillnesswithangeranddespairandhadtobeconvincedthatitwasasavingimitationofthePassionseeVitaprior,chap.5, pp.27981andThomasKempis,LifeofLidwina,pt.2,chap.1,pp.13233. 76.Vitaprior,chap.9,pars.99103,pp.29091. 77.Brugman,Vitaposterior,pt.3,chap.1,par.152,p.334(deMeijered.,p.97). 78.Vitaprior,chap.7,par.77,p.286:"usqueadmortem,neculloutebaturvelcibovelpotuvelsomno,sednecnaturaliasuperfluacorporisemittebat,praeterquam pervomitum." 79.Vitaprior,chap.11,pars.12122,pp.29495Brugman,Vitaposterior,pt.2,chap.8,pp.32931(deMeijered.,pp.8285)seealsobelow,n.94. 80.Brugman,Vitaposterior,pt.2,chap.10,par.146,p.133(deMeijered.,pp.9293).Brugman(Vitaposterior,pt.3,chap.1,par.157,p.335deMeijered., p.99)pointsoutthatachildwashealedmerelybybeingplacedonLidwina'sbed. 81.Vitaprior,chap.10,pars.1079,p.292. 82.Brugman(Vitaposterior,pt.3,chap.4,par.194,p.342deMeijered.,p.118)underlinesthepowerofdevotiontoMarythatbringssweetmilkfromarotting bodyandfoodfromavirgin. 83.Vitaprior,chap.6,pars.5860,p.282Brugman,Vitaposterior,pt.3,chap.4,pars.19394,pp.34142(deMeijered.,pp.11718)ThomasKempis, LifeofLidwina,pt.2,chap.4,pp.13536.BoththeauthoroftheVitapriorandThomasKempiscommentthatthelactatingmeansthatallthevirginswereworthy tonursethebabyJesus. 84.Brugman,Vitaposterior,pt.3,chap.4,par.194,p.342(deMeijered.,p.118).Cf.theothertwoaccountscitedinn.83,above.Itmaybethattwodifferent confessorsarereferredto. 85.SeeThomasKempis,LifeofLidwina,pt.1,chaps.19,22,pp.128,13031. 86.Vitaprior,chap.7,par.74,p.285,andchap.8,pars.8086,pp.28788Brugman,Vitaposterior,pt.2,chaps.23,pp.32023(deMeijered.,pp.55 63)ThomasKempis,LifeofLidwina,pt.1,chaps.1923,pp.12831. 87.ThomasKempis,LifeofLidwina,pt.1,chap.23,p.131. 88.Brugman,Vitaposterior,pt.2,chaps.8,10,pp.32931,33334(deMeijered.,pp.8285,9194).SeeDebongnie,"Stigmatisations,"pp.5556.The referencetostigmata,whichseemstobeBrugman'sembroideryonthestory,shouldnotbetakenliterally.Butitisimportantasareflectionofwhatsome contemporariesexpectedofholywomen. 89.Brugman,Vitaposterior,pt.2,chap.10,par.145,p.333(deMeijered.,p.92). 90.Vitaprior,chap.3,par.29,p.276,andchap.11,par.128,p.296.Wearetoldthatherrelativesandfriendsespeciallybenefited.Theauthorsaysexplicitly(p. 296):"Abhinc[1421]autemusqueadmortemsuam[1433],communiterpatiebaturfebresquartanas,etinterdumquotidianas,prosublevationeanimarumin purgatorio." 91.Brugman,Vitaposterior,pt.3,chap.1,pars.15355,pp.33435(deMeijered.,pp.9799). 92.Brugman,Vitaposterior,pt.3,chap.1,par.156,p.335(deMeijered.,p.99).


93.SeeVitaprior,chap.11,par.128,p.296.Seealsoibid.,chap.5,pars.4245,pp.27980andThomasKempis,LifeofLidwina,pt.2,chap.22,pp.155 56. 94.Vitaprior,chap.11,pp.29497Brugman,Vitaposterior,pt.2,chaps.710,pp.32834(deMeijered.,pp.7794)ThomasKempis,LifeofLidwina,pt. 2,chap.22,pp.15556.Thomasgivesaveryshortversion,inwhichLidwinafirstseesacrucifiedboy,thenawoundedhostthehostdescends,andfinallyLidwina receivesitfromthepriest.SeealsoHuysmans,Lydwine,chap.7. 95.Differentpeoplesupposedlysawdifferentpatternsinthehost,dependingontheirdegreeofholiness. 96.Brugman,Vitaposterior,pt.2,chap.7,par.121,p.328(deMeijered.,p.79). 97.Vitaprior,chap.10,pars.1079,p.292Brugman,Vitaposterior,pt.2,chap.5,pars.1067,andnotec,pp.32526(deMeijered.,pp.7071). 98.SeeVitaprior,chaps.910and12passim,pp.28998Brugman,Vitaposterior,pt.2,chaps.46,pp.32327,andpt.3,chap.2,pp.33638(deMeijer ed.,pp.6477,1017).ShewasalsoabletospothypocrisyinreligiouswomenseeBrugman,Vitaposterior,pt.2,chap.3,pars.9293,pp.32223(deMeijer ed.,pp.6263). 99.Vitaprior,chap.7,par.73,p.285ThomasKempis,LifeofLidwina,pt.1,chap.18,p.128. 100.AlthoughLidwina'ssmallgroupoffollowersdoesnotseemtohavebeenpredominantlyfemale,shedidperformmiraclesforotherwomen,someofthempathetic victimsofcruelhusbandsorgrindingpoverty.SeeVitaprior,chap.9,par.106,pp.29192.Seeesp.Brugman,Vitaposterior,pt.3,chap.5,pars.200201,p. 343(deMeijered.,pp.12122),whereLidwinapersuadesawoman,marriedtoabruteofaman,nottocommitsuicidefromdespairandconvertsthemanto tendernessbyherprayers. 101.MargaretofOingt,LifeofBeatriceofOrnacieux,esp.chaps.67,inOeuvresdeMarguerite,pp.11823.Thebiographertellsusthatforalongperiod BeatricesawthebodyofChrist"likealittlechild"everydayattheelevationofthehost. 102.Ibid.,chap.7,pars.8998,pp.12023.OnanotheroccasionBeatriceprayedbeforeapyxorportabletabernacleand,inheranguish,askedGodfordeath.A voicespoketoherfromthetabernacleandsherealizedthatherillness,particularlytheterribleheadachesfromwhichshesuffered,couldcontributetoherserviceof Christ(ibid.,chap.3,pars.6266,pp.11011). 103.Tss,pp.32,5354.AgnesBlannbekinofViennaspokeofdrinkinga"refreshingspiritualdrink"fromthewoundinJesus'sideseeGougaud,DAP,p.107. 104."Unterlinden,"p.440.AnothernunwasgivenawhitelambbyJohntheBaptistwhenshehadtointerruptherdevotionsandleavethechoironconventbusiness, andshereceivedtheeucharistdirectlyfromChristwhenshewasill(ibid.,pp.44950).Thissamenuninflictedgreatcrossshapedwoundsonherchestwithapiece ofwood"inordertoretainamemoryofChrist'spassion."ThenunsalsoreceivedmanyvisionsofChristasableedingyoungmanorasababy.Inoneparticularly touchingcase,awomanwhohadabandonedhertwoyoungchildren"scarcelyoutofthecradle"toenterthemonasteryhadavisionofChristasanewbornbaby cryingbeforeher(ibid.,p.403). 105.Engelthal,p.36:"Undhetichdich,ichgezdichvorrehterlieb!" 106.AdelheidLangmann,DieOffenbarungenderAdelheidLangmann,Klosterfrauzu


Engelthal,ed.PhilippStrauch,QuellenundForschungenzurSprachundKulturgeschichtedergermanischenVlker26(Strasbourg:Trbner,1878),pp.11 12. 107.Ibid.,pp.26,47:"deinmuntsmektnochrosenunddeinleipnochviol""meinzukersezzezundmeinhonigsezzezlip,meinzarte,meinreine,dupistmeinund ichpindein."CitedbyBrowe,DieWunder,pp.10910.TheimagerycomesfromtheSongofSongs. 108.LifeofJaneMaryofMaillbyherconfessor,MartinofBoscoGualteri,chap.2,par.14,andchap.4,esp.par.28,AASSMarch,vol.3(Paris,1865),pp. 737,73940.AwitnessinthecanonizationproceedingstestifiedthatJaneMary'sbodywaslikeskinandbonesfrommortificationwhenshedied,butthenbecame beautiful(Processofcanonization,chap.2,par.14,ibid.,p.747). 109.LifeofFloraofBeaulieu,chap.2,par.24,AASSJune,vol.2(Paris,1867),app.p.46*.SeealsoC.Brunel,ed.,"VidaemiraclesdeSanctaFlor,"AB64 (1946),Vida,chap.8,pp.1920. 110.LifeofFlora,chap.2,par.25,AASSJune,vol.2,p.46*,andchap.3,par.47,p.50*,andpassim.SeealsoVida,ed.Brunel,chaps.9,19,pp.20,27. 111.LifeofFlora,chap.3,par.48,AASSJune,vol.2,p.50*ProcessofcanonizationforJaneMaryofMaill,chap.5,par.54,AASSMarch,vol.3,pp.754 55.ChristinaEbnerreceivedavisionduringmassinwhichshesuckedfromthewoundsinChrist'sdivineheartasabeesucksfromflowers(Kieckhefer,UnS,p. 173). 112.LifeofLukardis,chap.6,AB18,p.313.Cf.chap.45,p.334,wheresheexperiencestheeucharistasasweetsmell. 113.Ibid.,chap.16,pp.31819. 114.Ibid.,chap.28,p.324. 115.Ibid.,chap.29,p.324.Ontwootheroccasions(chap.19,p.320,andchap.26,p.323),wearetold,LukardisrecoveredonEasterfromacondition resemblinghystericalparalysis,inordertotaketheeucharist. 116.Ibid.,chap.14,p.317. 117.Ibid.,chap.51,pp.33738. 118.Ibid.,chap.88,p.360.OnceLukardiscomfortedthesister,hersadnessleftandshedidnotfeelitnecessarytoreturntoherconfessor. 119.Ibid.,chaps.712,pp.31315.AfteroneofthenunsaskedLukardiswhyshedidnothavethewoundsofthecrownofthorns,sheacquiredthem(ibid.,chap. 72,p.353). 120.Ibid.,chap.55,p.340.Inasimilarincident,anunataconventfivemilesawayhadavisionofChristwithasternface.Hetoldherthatheexhibitedthisstern facetoallthosewhodidnotbelieveinthemiracleshedidthroughLukardis,whomhehadsignedwithstigmata(ibid.,chap.63,p.347). 121.Gertrude,Oeuvres:vol.2:LeHraut,bk.2,chap.6,pp.25658ibid.,chap.16,pp.29096passim.SeealsoBynum,JM,p.192n.57Gertrude,Oeuvres: vol.3:LeHraut,bk.3,chaps.18,73pp.1024,302andLegatus,bk.4,chap.21,pp.36164.AnotherHelftanun,MechtildofHackeborn,receivedChrist's heartasacupatcommunionandfeltherselfurgednotonlytodrinkbutalsotoofferthesavingdrafttohersisternunsseeMechtildofHackeborn,Liberspecialis gratiae,bk.1,chap.1,pp.710. 122.MechtildofMagdeburg,Licht,bk.6,chap.36,p.210trans.Menzies,Light,p.


199.Onthisvision,seeBynum,JM,p.237.ThereareexcerptsfromMechtild,welltranslatedbyJohnHoward,inKatharinaM.Wilson,ed.,MedievalWomen Writers(Athens,Ga.:UniversityofGeorgiaPress,1984),pp.15385. 123."Dassintdennegotessenmag"(quotedinRiehle,Mystics,p.107).SeealsoMechtildofMagdeburg,Licht,bk.2,chap.4,pp.3033,andbk.2,chap.22, p.43. 124.MechtildofMagdeburg,Licht,bk.1,chap.44,pp.2122. 125.Ibid.,bk.5,chap.8,p.136trans.Menzies,Light,p.133.SeealsoMechtildofMagdeburg,Licht,bk.3,chap.10,p.72andBynum,JM,p.236. 126."Unterlinden,"chap.5,pp.34142.Thedescriptionalsoreferstoflagellationandotherausterities. 127.ViedeDouceline,chap.9,pp.8591,onherecstasieschap.10,pp.13334,ontastingGodinthetabernaclechaps.6,9,pp.57,71,101,105onher inabilitytoeat.InDouceline'scase,thenoteating,thefearoftouch,andtheecstasieswerealsopreparationforhealingmiracles.Forafoodmultiplicationmiracleby thesaint,seeibid.,chap.12,p.183. 128.LifeofJaneMary,AASSMarch,vol.3,pp.73444andProcessofcanonization,pp.74462passim.LifeofJaneMary(chap.2,par.13,p.736)contains thestoryoftheangel,whoisidentifiedassuchbytheeditorsofthevitabutnotinthetext. 129.ForaccountsofAlpas,seeabove,chap.3n.77. 130.Seeabove,epigraphtochap.3. 131.LifeofAlpas,bk.4,chap.2,AASSNovember,vol.2,pt.1,p.200.Onhereatingdifficulties,seealsobk.2,chap.1,pp.18283. 132.AtleasttwiceAlpassawthedevilinavisionasadoctorofferingmedicine.Hetoldherthatifshewouldtakeit"likeordinarywomen"shewouldbecuredand wouldbeabletoeatordinaryfood(seeibid.,bk.3,chap.4,pp.19697,andbk.4,chap.1,p.198). 133.See,forexample,theaccountinthechronicleofRobertofAuxerre(AASSNovember,vol.2,pt.1,p.167),whichemphasizestheemptinessofAlpas's intestines,andtheaccountbyRalphCoggeshall(ibid.,p.168),whichstressesproofofherinedia. 134.Addenda,chap.4,AASSNovember,vol.2,pt.1,p.208. 135.SeethediscussionsofColumbaofRietiandCatherineofSienabelow,pp.147and16770.TheclearestcaseoffoodstealingbyamiraculousfasterisElsbet Achler.Elsbet'svitaiseditedbyKarlBihlmeyerin"DieSchwbischeMystikerinElsbethAchlervonReute(&dagger1420)unddieberlieferungihrerVita,"in GeorgBaeseckeandFerdinandJosephSchneider,eds.,FestgabePhilippStrauchzum80.Geburtstagam23.September1932,HermaeaAusgewhlteArbeiten ausdemDeutschenSeminarzuHalle31(Halle:Niemeyer,1932),pp.88109andbyAntonBirlingerin"LebenheiligeralemannischerFrauendesXIVXV Jahrhunderts,1:DiterstBchlynistvonderSeligenKlusenerynvonRthy,diegenantwazElizabeth,"Alemannia9(1881):27592.SeealsoC.Schmitt,"Elisabeth deReute,"DHGE,vol.15(1963),cols.22021.Proddedbyherconfessorintoadolescentselfrighteousness,Elsbetbecamearecluseafterconflictwithherparents, whodisownedher.Givenpermissionbothbyherconfessorhagiographerandbyanelderlyfemalerecluse,Elsbetpassedthreeyears"withouteating."Ifweread betweenthelinesofhervita,itseemslikelythatshebecameacompulsivesecreteater,vomitingupstolenfood.Asisterwhoworkedinthekitchenevenjoked,when meatdisappeared:


"Itwasstolenbythecatwithtwolegs."Severalincidentssuggestsurreptitiousgorging.Wearetold,forexample,thatthedevildisguisedhimselfasherspiritual motherandgaveherfoodthatmadeherviolentlyill.Onanotheroccasionthedevilsupposedlyhidmeatandsaltunderherbed,makingitlookasifshehad secretedthemthere(seeesp.LifeofElsbetinBirlinger,"KlusenerynvonRthy,"p.280). 136.ThebasictextsareinHuyskens,Quellenstudien.SeeAnceletHustache,Elisabeth,pp.1729,andPaulG.Schmidt,"Diezeitgenssischeberlieferungzum LebenundzurHeiligsprechungderheiligenElisabeth,"inUniversityofMarburg,SanktElisabeth,pp.16.ForanexcellentsurveyofthebackgroundtoElizabeth's experience,seeKasparElm,"DieStellungderFrau,"pp.728. 137.AnceletHustache,Elisabeth,passim,esp.pp.2016,31418andMattiasWerner,"DieheiligeElisabethundKonradvonMarburg,"inUniversityof Marburg,SanktElisabeth,pp.4569.ItwasConradwhoorderedhernottoeatfoodgainedbyexploitationofthepoorattimeshealso,tobreakherwill,forbade hertodistributealmsorbread. 138.Seethedepositionsof1235inHuyskens,Quellenstudien,pp.11240,esp.pp.11516,11921,12729,137andConradofMarburg'sletter(1233) concerningherlife,inibid.,pp.15560. 139.Huyskens,Quellenstudien,pp.5152.Elizabeth,NicholasofMyra,andCatherineofAlexandriawerethethreemostfamousmyroblytes(oilexudingsaints).It isalsoworthnotingthatawomandreamedofoilflowingfromDoucelineofMarseilles,althoughDoucelinedidnotactuallybecomeamyroblyteseeViede Douceline,p.131. 140.Huyskens,Quellenstudien,p.70n.3andseebelow,chap.7n.13. 141.GarinofGuyl'Evque,LifeofMargaretofHungary(writtenin1340),chap.4,AASSJanuary,vol.3(Paris,1866),p.518.SeealsoProcessofcanonizationof 1276inVilmosFrakni,ed.,MonumentaRomanaepiscopatusvesprimiensis(11031526),vol.1(Budapest:CollegiumHistoricorumHungarorumRomanum, 1896),pp.214,220,247. 142.LifeofMargaretofHungary,chaps.14,pp.51618Processofcanonization,ed.Frakni,passim,esp.pp.16768,219,240. 143.LifeofMargaretofHungary,chap.3,p.517Processofcanonization,ed.Frakni,p.227. 144.Processofcanonization,ed.Frakni,p.171LifeofMargaretofHungarychap.3,p.517.Onesisterdeposed(ed.Frakni,p.263)thatMargaretgaveher foodtoothersandrose,fasting,fromthetable. 145.LifeofMargaretofHungary,chap.3,p.517. 146.Ibid.,chap.1,p.516Processofcanonization,ed.Frakni,pp.213,260,264. 147.Inoneveryinterestingdeposition,asisterclaimedthatshewashealedfromaseriousillnesswhenMargaretappearedbyherbedandsaid,"Getup,sister,and eatsomething."ShealsoclaimedtohavebenefitedwhenwashwaterfromMargaret'shairwasplacedinhermouth(Processofcanonization,ed.Frakni,pp.237 38).Cf.ibid.,pp.267,288,whichsuggeststhatwaterfromMargaret'shairwasregularlyusedforhealing.Itsefficacymayhavebeenperceivedasderivedfromthe factthatMargaretrefusedtowasheitherherhairorherbodyfrequently,saying"Iwantthewormstopunishmybody"(ibid.,p.266). 148.Seeabove,chap.3n.106.ForadiscussionofthevoluminousmaterialonDor


othy,perhapsthebestdocumentedsaintofthethirteenthandfourteenthcenturies,seeKieckhefer,UnS,p.210n.2. 149.SeeJohnMarienwerder,VitaLindana,chap.1,par.15chap.2,par.44chap.3,par.72andchap.4passim,AASSOctober,vol.13,pp.505,515,527, 53543JohnMarienwerder,Vitalatina,ed.Westpfahl,bk.5,chaps.1621,pp.23645. 150.SeeRichardStachniketal.,eds.,AktendesKanonisationsprozessesDorotheasvonMontauvon1394bis1521,ForschungenundQuellenzurKirchenund KulturgeschichteOstdeutschlands15(Cologne:Bhlau,1978),pp.214,277andJohnMarienwerder,Vitalatina,ed.Westpfahl,bk.6,chap.21,pp.31820.I havebeeninfluencedbyafineunpublishedpaper(''ACultoftheMaternal:DorothyofPrussia[134794],")byStephenP.BenschoftheUniversityofCaliforniaat Berkeley.BenschstressesnotonlyDorothy'sspiritualpregnancybutalsotheimportanceofpregnancyandbirthingasimagestoher. 151.JohnMarienwerder,VitaLindana,chap.2,par.40,andchap.3,par.69,AASSOctober,vol.13,pp.514,52526. 152.Ibid.,chap.3,par.63,p.523.Forafullerdiscussion,seeKieckhefer,UnS,pp.2728. 153.SeptililiumB.Dorotheae,treatise3:Deeucharistia,chaps.2526,AB3,pp.43941. 154.Ibid.,chap.6,p.418. 155.Ibid.,chap.3,pp.41011. 156.Ibid.,chap.10,p.425.ChristclearlyunderstoodDorothy.Hetoldher,"Idon'twantyoutoabstain,forifyouabstainyouwilljustbemoreanxiousthanbefore." Onherfrenzyfortheeucharistatdeath,seeJohnMarienwerder,Vitalatina,ed.Westpfahl,bk.7,chaps.2627,pp.36468. 157.AASSMarch,vol.1(Paris,1865),givesaLatintranslationofthevitaebyPeterofVaux(pp.53888),andPetrinaofBalme(pp.600618).Ihavebeen unabletoconsultUbaldd'Alenon,LesViesdeSteColetteBoyletdeCorbie...critesparsescontemporainsleP.PierredeReims,ditdeVaux,etSoeur PerrinedelaRocheetdeBaume,Archivesfranciscaines4(Paris:Picard,1911). 158.Inneithercase,forexample,istheclaimtostigmatawelldocumented. 159.PeterofVaux,LifeofColette,chap.17,par.166,p.573. 160.TherearealsoparallelsbetweenColetteandanotherexactcontemporary,ElsbetAchler,whodiedin1420attheageofthirtyfour(seeabove,n.135).After Elsbet'sthreeyearsoftotalfast,shewasunabletokeepfoodinherstomach.Asshebecamesickandbedridden,herbodybrokeoutinsoresthatparalleledChrist's wounds.ThewoundsoozedbloodeveryFriday.SeeLifeofElsbetinBirlinger,"KlusenerynvonRthy,"pp.28183. 161.Colette'sexhortationisinapp.2toE.SainteMariePerrin,LaBelleViedesainteColettedeCorbie(13811447)(Paris:Plon,1921),pp.27477.Abrief letterofColette'sisinibid.,pp.27374. 162.PeterofVaux,LifeofColette,chap.13,pp.56365seealsochap.11,par.105,p.562,andchap.17,par.166,p.573. 163.Ibid.,chap.20("Demiraculis"),par.232,p.584,andchap.11,par.104,p.562.Seealsochap.20,addenda,par.257,p.587. 164.Ontheleper,seeibid.,chap.20,par.228,p.584.OntheVirgin'skiss,which


curedColetteofseverepaininthetongue,seechap.14,par.127,pp.56667.Onthesicknun'svision,seechap.20,par.227,p.584. 165.Ibid.,chap.20,par.233,p.584. 166.Ibid.,chap.17,par.175,p.575. 167.AccountofmiraclesperformedafterherdeathintheconventofGhent,pars.810,AASSMarch,vol.1,pp.59394. 168.PeterofVaux,LifeofColette,chap.9,par.61,pp.55455.PetertellsusthatbadsmellsbotheredColettegreatlybecauseofherpurity,butthatsheborethem patiently,asChristhaddone.Healsotellsusthatshewentforayearwithoutsleep(chap.17,p.573)andwasgreatlyafflictedbyheatandcold(chap.14,par.123, pp.56566). 169.Ibid.,chap.12,pp.56263PetrinaofBalme,LifeofColette,chap.6,pars.6162,p.612. 170.SeePeterofVaux,LifeofColette,chap.12,pars.109,113,pp.56563andUbaldd'Alenon,Miniaturesetdocumentsartistiquesdumoyengerelatifs SainteColettedeCorbie,Archivesfranciscaines5(Paris:Picard,1912),plate13(reproducedaboveasplate11c).Forapaintingwithasimilariconographic motif,seePeterMeller,"LaBeataColombadaRietiinunDipintodiBernardinodiMariotto,"AntichitViva2.910(1963):2430. 171.PeterofVaux,LifeofColette,chap.10,par.84,p.558. 172.Ibid.,chap.11,pp.56062PetrinaofBalme,LifeofColette,chap.4,pars.38,42,pp.6078. 173.Seeabove,n.121. 174.ForGherardesca'svisionsconcerningtheeucharist,seeLifeofGherardescaofPisa,chap.3,par.27chap.4,par.36andchap.6,par.57,AASSMay,vol.7 (Paris,1867),pp.16667,169,173.HerhagiographerreportsavisionofwaterflowingfromChrist'sbreast(chap.7,par.66,p.175).Thereisonevisionthat stressesbloodandmouths(chap.6,par.56,p.173):GherardescawantedtopullthenailfromChrist'sbleedingfootwithherteethandputitintoherownbody.For Umilt'seucharisticpiety,whichisnotmuchemphasized,seeLifeofUmiltofFaenza,chap.1,par.10,AASSMay,vol.5(Paris,1866),pp.2089.Her hagiographerreportsthathercellwasconstructedsothatshecouldlookintothechurchandseeandreceivethesacrament.WefindanemphasisonseeingChristin thepatheticlifeoftheblindgirlMargaretofCittdiCastello,whosupposedly"saw"Christincarnatequiteclearly(asababywithhisparents)wheneverthehostwas elevatedseehervita,chap.6,AB19(1900),p.26AASSApril,vol.2(Paris,1865),p.191andM.H.Laurent,"LaPlusAncienneLgendedelaB.Marguerite deCittdiCastello,"ArchivumFratrumPraedicatorum10(1940):12526. 175.OnColumba,seebelow,pp.14648CatherineofSienaandCatherineofGenoaaretreatedinchapter5below.ThelivesandthefoodpracticesofMargaret ofCortonaandAngelaofFolignohavenowbeentreatedinmuchgreaterdetailthanIattemptherebyRudolphBellinHolyAnorexia(Chicago:Universityof ChicagoPress,1985).HistreatmentofItalianwomenisfullerthanmineandinsomecasesbasedoneditionsnotavailabletomeIreferreaderstoit.Idiscussthe differencesbetweenBell'smethodandmineinchap.6,below. 176.LifeofMargaretofCortona,byherconfessor,JunctaBevegnati,AASSFebruary,vol.3,pp.30463,esp.chap.7,pp.33845.Inansweringherneedfor reassurance,


Christsupposedlysaidtoher(chap.4,par.63,p.315):"Tuesfiliamea,quiamihiobedis:tuessponsamea,quiamesolumdiligis:tuesmatermea,quiavolutatem Patrismei,inquantumviressufficiunt,imples."SouncertainwasMargaretthatshefearedevenhereucharisticcravingmightoffendChrist(seechap.4,par.65,p. 316):"Etquiafervoremsaepecommunicandipraereverentiailliusinaccessibilislucisinterponerenecretardarevalebat,dixit:Offendote,Dominemi,inillasiti avidissima,quamdefrequenticommunioneCorporisetSanguinistuiconcepi.ResponditDominusdicens:...valdemihideipsaplaces."AngelaofFolignoalso fearedcommunionseeAngeloofFoligno,ed.FerrandBaudry,par.63,p.126. 177.LifeofMargaretofCortona,chap.7,par.179,p.340. 178.Inibid.,chap.7,par.187,p.341,Margaretseesavisionofapriestwithblack(i.e.,sinful)handsholdingababyboy.Inpar.197,p.343,sherecognizesan unconsecratedhostbecauseshefeelsnosweetnessuponreceiving. 179.Ibid.,chap.5,par.135,p.330,andpar.106,p.325,respectively. 180.Ibid.,chap.7passim,esp.pp.339,342,345.OnMargaretseealsoJohnMoorman,AHistoryoftheFranciscanOrderfromItsOriginstotheYear1517 (Oxford:OxfordUniversityPress,1968),p.223FatherCuthbert,ATuscanPenitent:TheLifeandLegendofMargaretofCortona(London:BurnsandOates, n.d.)andthesomewhatfullerversionofJunctaBevegnati'sLifeofMargaretgiveninLodovicodaPelago,ed.,LeggendadellavitaedeimiracolidiS.Margherita diCortonascrittainlingualatinadaldileiconfessoreFr.GiuntaBevegnati...etraduzioneItaliana...(Rome:TipografiaMonaldi,1858). 181.AngelaofFoligno,ed.FerrandBaudry,par.80,p.166seealsoAngelaofFoligno,L'AutobiografiaegliscrittidellabeataAngeladaFoligno,ed.and trans.M.FalociPulignaniandMariaC.Humani(CittdiCastello:"IlSolco,"1932),pp.14042.Adifferentversionofthepassageisfoundinpar.118oftheLifeof AngelaofFolignoinAASSJanuary,vol.1(Paris,1863)p.205.Inpar.50(pp.9094oftheFerrandBaudryedition),Angeladescribesherecstasyatthe elevationofthehostandsaysthatherjointsbecameunstrung(cf.LifeofAngela,AASS,p.205).Inpar.41(FerrandBaudryedition,pp.6466),sheexplainshow shesawChristinthehostandwasunabletokneel.Sogreatwasherdelightthatshedidnotknowwhethersheranforwardorremainedstill(cf.LifeofAngela, AASS,p.204).Pars.16671(FerrandBaudryedition,pp.38092)givewhatpurportstobeAngela'steachingontheeucharist,preservedinItalian(Angela'sown language)intheAssisiandSubiacomanuscriptsbutpresentedinascholasticmodeunlikelytobehers.Thepassagestressestherealpresenceofthephysicalhuman Christandrefersseveraltimestothepowerofthehandsofthepriest.Pars.11316(FerrandBaudryedition,pp.22426)reportmoreeucharisticvisions.Thereis nocriticaleditionofAngela'swritings,whichshedictatedtoherconfessorbutwhichoftenseemtoretainherownwords.IhaveusedtheFerrandBaudryandthe PulignaniandHumanieditions.TheAASSeditionisunreliable,butwheretherelevantpassagesarepresent,Ihavegivenreferencestothemtoaidreaderswhodonot haveaccesstotherarereditions.IhavebeenunabletoconsulttheeditionbyPaulDoncoeur,LeLivredelaBienheureuseAngledeFoligno:TexteLatin(Paris: ArtCatholique,1925).MaryG.SteegmanhaspublishedanextremelymisleadingEnglishtranslationofasixteenthcenturyItaliantranslationofAngela'slife,titledThe BookofDivineConsolationoftheBlessedAngelaofFoligno(repr.ed.,NewYork:CooperSquarePublishers,1966).


182.Par.135,ed.FerrandBaudry,pp.29094(cf.LifeofAngela,par.127,AASS,p.206)seealsopar.147,FerrandBaudryed.,pp.32022andpars.51 52,ibid.,pp.96102.AfragmentcitedinthePulignaniandHumaniedition(par.204[3],pp.33032)says:"Deushabensamoremevisceratumanimae,datei blanditias,idestdulcedines,sentimentaethuiusmodi,quaeegovocoblanditias,quasanimanondeberetappetere:nontamensuntspernendaequiafaciuntanimam currere,etsuntcibuseius:etexhiisanimaascenditadamandumDeum,etinnititurtransformariinAmatum"(emphasisadded). 183.Par.17,ed.FerrandBaudry,p.16:"ettunc[Christus]vocavitmeetdixitmichiquodegoponeremosmeuminplagamlaterissui.Etvidebaturmichiquodego videremetbiberemsanguinemejusfluentemrecenterexlateresuo....EtrogaviDominumquodfaceretmetotumsanguinemmeumpropteramoremsuum,sicut feceretipseprome,spargere.Etdisposuimepropteramoremsuumquodvolebamquodomniamembrameapaterenturmortemaliampassionesua,scilicetmagis vilem."Cf.PulignaniandHumaniedition,p.16,andpar.28,AASS,p.189.Seealsopar.66,FerrandBaudryedition,p.138:"EttotaletitiaestmodoinistoDeo hominepassionato.Etaliquandovideturanime,quodcumtantaletitiaetdelectationeintretintusinilludlatusChristietcumtantaletitiavaditintusinlatusChristi,quod nullomodopossetdicivelnarrari." 184.LifeofAldaofSiena,chap.2,par.21,AASSApril,vol.3(Paris,1866),p.474.Inanotherincident,whichrevealsasimilardevotiontoChrist'sblood,Alda sawapriestspilladropof"thesacredbloodofChrist"ontothepaten.Whenshescreamedouttohim,"Lickitup,"itbegantoglowandcuredaneyeinfectionshe hadsufferedfrom(chap.2,par.15,p.474).Forothereucharisticecstasiesseechap.2,par.14,p.474.(TheLatintextinAASSistranslatedfromasixteenth centuryItalianlifebasedonthirteenthcenturydocuments.) 185.LifeofMargaretofCortona,chaps.23,AASSFebruary,vol.3,pp.30513.Seeesp.chap.3,par.51,whereMargaret'sconfessorquotesherassaying: "Patermi,cumfoeduspacisinteranimammeametcorpushabituranonsim,necunquamsibiparcerevelim,sinatismesineciborummutationeipsumatterere,quiatoto temporevitaemeae,donecdeficiat,nonquiescam:necipsumcredatisitamortificatumetdebile,utapparet:quiahocagit,utextinguamdebitum,quodcontraxitin seculo,dumvacavitdelicisetvoluptatibussuis." 186.Ibid.,chap.5,par.82,pp.31920.Therearemanyotherexamplesofsuchbehavior.UmiltofFaenzaateonlyonemealadayandlimitedthattowaterand threeouncesofbread(LifeofUmilt,chap.1,par.11,AASSMay,vol.5,p.209).(Onfeastdayssheexpandedherdiettoincludeafewcookedbitterherbs.) AgnesofMontepulcianodeprivedherselfoffoodandsleepforyearsandreceivedcommunionfromanangel(seeRaymondofCapua,LifeofAgnesof Montepulciano,chap.2,par.17chap.3,par.26andchap.6,par.54,AASSApril,vol.2[Paris,1865],pp.793,795,801).AldaofSienaateonlyonceaday, sometimestakingonlygrassesandbeansandabstainingevenfrombreadshedrankonlywater.OnFridaysshesometimesateonlyvinegarandgallormyrrhto imitateChrist.Herbiographerattributesthisasceticismtoremorseforsexualtemptation.SeeLifeofAlda,chap.2,pars.1012,p.473.ClareofMontefalco(d. 1308)carriedoutprolongedfasts(seeVauchez,LaSaintet,p.405).MargaretofCittdiCastelloalsopunishedherselfwithfasts(seeLifeofMargaretofCitt


diCastello,chap.2,AB19,p.24andLaurent,"LgendedelaB.Marguerite,"p.121).AndseeLifeofGherardesca,chap.1,par.2,AASSMay,vol.7,p. 162. 187.LifeofVillanade'Botti,chap.1,pars.3,8,AASSAugust,vol.5(Paris,1868),pp.86566.Shesupposedlysaidtoherconfessor:"EgocumepistolasPauli lego,autdivinisassistoeloquiis,mentesicreficior,utomnisillicodiffugiatcibicorporalisappetitus:itaChristicrucifiximeditationeabsorbeor,utnullaomninosit asperitastamdura,quaenonmihiamoenissimavideatur."SeealsoStefanoOrlandi,LaBeataVillana,terziariadomenicanafiorentinadelsec.XIV(Florence:"Il Rosario,"1955).Andcf.AngelaofFoligno,par.21,ed.FerrandBaudry,p.24(LifeofAngela,par.34,AASS,p.190). 188.NocontemporaryvitaofRitasurvives.SeeLifeofRitaofCascia,AASSMay,vol.5(Paris,1866),pp.22628. 189.LifeofClareGambacortaofPisa,chap.1,par.3,AASSApril,vol.2(Paris,1865),p.507.Clareimposedsuchstrictfastingonherselfthatsherefusedfruit evenwhenitwasinabundantsupply(ibid.,par.5,p.507)sheatethegarbageleftoverfrommealsand,likeFrancis,sprinkledashesonherfood(ibid.,chap.2,par. 21,p.510).Clare'svitawaswrittenbyasisterofherconvent. 190.ForeditionsofAngela'sbook,seeabove,n.181.WeknowfewdetailsofAngela'sbiographysheseemstohaveundergoneaconversionataboutageforty afteralifeasamarriedwomanandmother.SeeM.J.Ferr,"LesPrincipalesDatesdelavied'AngledeFoligno,"Revued'histoirefranciscaine2(1925):2134 PaulDoncoeur,"AngledeFoligno(Bienheureuse),"DS,vol.1(1932),cols.57071Dronke,WW,pp.21517andchap.7n.11,below. 191.Thirdletter,inAngelaofFoligno,ed.FerrandBaudry,pp.49498:"Istaestquedamhumilitasinquasuminabyssata....Setgaudebamimaginarialiquem modumuteassimulationesetiniquitatesetpeccatameapossemmanifestare.Etvellemireperplateasetcivitatesnuda,etappendereadcollummeumpiscesetcarnes dicendo:'Hecestillavilissimamulier.'"Seealsoibid.,par.101,p.200,whereAngeladescribesaperiodduringwhichshewastorturedbyfeelingsofunworthiness andwasunabletoeat. 192.SeeAngelaofFoligno,par.21,ed.FerrandBaudry,p.24,andpar.108,p.218. 193.Seeabove,chap.3n.92. 194.Thirdletter,inAngelaofFoligno,ed.FerrandBaudry,p.498. 195.Seeibid.,par.180,pp.41820,andpar.35,p.54. 196.Seeibid.,par.35,pp.5254:AngelawishedtoremainwithChristinecstasybuthewithdrew,andshefeltterriblepain.Sohegaveherasignofhislovethe crosswhichshefeltbothinherbodyasarealcrossandinhersoul.Seealsothepassagescitedinnn.18182above. 197.Ibid.,par.66,pp.13840.ButAngelaalsostressesChrist'ssufferingseeibid.,pars.12729,pp.25060par.140,pp.31214andpar.179,pp.41216. 198.Ibid.,par.151,p.326. 199.Ibid.,par.53,pp.1046seealsoPulignaniandHumaniedition,pp.9092andLifeofAngela,par.137,AASS,p.208. 200.AngelaofFoligno,par.53,ed.FerrandBaudry,p.106:"etbibimusdeillalotura.Ettantamdulcedinemsensimusquodpertotamviamvenimusinmagna suavitateacsicommunicavissemus.Etvidebaturmichirectequodegocommunicassemquia


sauvitatemmaximamsentiebam,sicutsicummunicassem[sic].Etquiaquedamscarpulaillarumplagarumeratinterpositaingutture,egoconabaradglutiendum eam,etreprehendebatmeconscientiaexpueresicutsicommunicassem,quamvisnonexpueremadej[i]ciendumsetaddeponendumeamdegutture."Theshock valueofsuchbehaviormayhavebeenincreasedbythefactthateatingblood,scabs,etc.,wastabooseeBurchardofWorms,Decretum,bk.19,chaps.84,91, PL140,cols.10023. 201.See,forexample,LifeofMargaretofCortona,chap.9,par.226,241,AASSFebruary,vol.3,pp.349,352. 202.Seeabove,n.178,andLifeofMargaretofCortona,chap.9,AASS,pp.34956. 203.LifeofMargaretofCortona,chap.7,par.190,AASS,p.342.ChristcalledMargareta"motherofsinners"anda"ladderforsinners":''CuiChristusdixit: 'Scalampeccatorumtefeci,utperexemplavitaetuaepergantadme.'EtMargaritarespondit:'Inquovirtutisexemplopeccatoresimitarimepossunt?'EtDominusad eam:'Imitabunturabstinentiastuas,jejuniatua,humilitatem,ettribulationes,quasamoremeialacriterrecepisti.'" 204.LifeofUmilt,chap.3,par.24,AASSMay,vol.5,pp.21213.Accordingtothehagiographer,piecesofaloafofbreadmultipliedinthenuns'mouthsafter Umiltblessedit,andmorepieceswereleftoverthanhadoriginallybeenplacedinfrontofthesisters. 205.JohnofFaenza,RevelationsandMiraclesofMargaretofFaenza,chap.2,par.7(xiixiii),AASSAugust,vol.5(Paris,1868),p.853.BothvitaeofMargaret usefoodmetaphorstodescribeherecstasies.John(Revelations,chap.1,par.3[v],p.852)describesJesustouchinghertonguewiththekissofpeace.Inthevitaby PetertheFlorentine(chap.2,pars.810[xiixiv],p.849),sheisdescribedasreceivinginvisiblestigmata. 206.LifeofAlda,chap.2,par.16,p.474,andchap.3,pp.47476. 207.RaymondofCapua,LifeofAgnesofMontepulciano,chap.2,pars.1718,andchap.6,pars.5657,pp.79394,8012.OnRaymond'sdescriptionofAgnes inhisLifeofCatherineofSiena,seechap.5n.68,below. 208.RaymondofCapua,LifeofAgnesofMontepulciano,chap.3chap.4,par.38andchap.7,pars.6061,pp.79598,802. 209.CatherineofSiena,Dialogue,ed.Cavallini,chap.149,pp.42829seealsoLetter58,inCatherineofSiena,Letters,ed.Misciattelli,vol.1(1913),pp.265 67,whichdiscussesAgnesasanexampletoothernuns. 210.RaymondofCapua,LifeofAgnesofMontepulciano,chap.9,pars.7881,p.806. 211.OnRitaseeabove,n.188. 212.LifeofMargaretofCittdiCastello,chap.8,AB19,pp.2728seealsoM.H.Laurent,"LgendedelaB.Marguerite,"pp.12728.Itisinterestingtonote thatthenailAldaofSienahadcarvedasadevotionalobjectsupposedlyexudedsapthreehundredyearsafteritwascarved(LifeofAlda,chap.2,par.17,p.474). 213.LifeofRoseofViterbo,AASSSeptember,vol.2(Paris,1868),pp.43339.ForarecentcriticalexaminationofRose'slife,seeGiuseppeAbate,"S.Rosada Viterbo,terziariaFrancescana(12331251):Fontistorichedellavitaelororevisionecritica,"MiscellaneaFrancescana52,fasc.12(JanuaryJune1952):112 278.ThevitainAASS,


composedtwocenturiesafterRose'sdeathaspartoftheProcessofcanonization,isacompendiumoffeedingthemesborrowedinsomeinstancesexplicitly fromthelivesofothersaints.OflittlevalueasasourceofinformationaboutRoseherself,itisanimportantindexoffifteenthcenturysensibility.Wearetoldthat babyRosefastedfromthebreastfortwodayseachweek(likeNicholasofMyra),thatwhilestillachild,shebegantomacerateherbodyinseverefastsinorder togivefoodtothepoor,thatthebreadinherapronturned(likeElizabethofHungary's)intoroseswhenherfatheraccusedherofwastingfamilygoods,thatshe fedthebirdswithherownhands(likeFrancisofAssisi),andthatherbody(likeElizabeth'sandAgnes's)producedmanna.Seealsoplates8and9. 214.IntheLifeofColumbaofRietibyherconfessor,SebastianPerusinus(chap.13,par.128,AASSMay,vol.5,p.190*),Sebastiandrawsparallelsnotonly betweenColumbaandCatherineofSienawhomshewasobviouslyawareofimitating(seeibid.,chap.1,par.8,p.155*)butalsobetweenColumbaand MargaretofHungary,AgnesofMontepulciano,JoanofOrvieto,andMargaretofCittdiCastello.Allthewomen,hesays,experiencedecstasiesinwhichtheyleft theirsenses,levitated,andmirroredintheirbodiesthePassionofChrist,withtheirarmsstretchedoutandtheirnecksextended.OnJoanofOrvieto,seeAntonino Silli,"Giovanna(Vanna)diOrvieto,"BS,vol.6(1965),cols.55657.OnCatherineofSienaasmodel,seeabove,chap.3n.76. 215.LifeofColumbaofRieti,chap.1,par.1,p.153*,andpar.6,p.154*.Herhagiographersays:"TemporeauteminfantilisinnocentiaepiaColumba,Spiritus Sanctidonasortita,adversumcarnemindicitbellum,etpugnumaggreditur."OnColumba,seealsoBaleoneusAstur[AstorreBaglioni],ColombadaRieti:"La secondaCaterinadaSiena"14671501(Rome:EdizioniCateriniane,1967),whichusesavernacularversionofSebastian'slifeofColumba. 216.SebastianPerusinus,LifeofColumba,chap.1,par.7,p.154*.TheexcerptsfromtheProcessofcanonization(par.2,AASSMay,vol.5[Paris,1866],p. 223*)alsoemphasizeherpenitence,herextendedabstinence,andhereucharisticfervor. 217.LifeofColumbaofRieti,chaps.14,pp.153*61*.Itisinterestingtonotethatthehagiographersaysthestruggleturnedhermotherintoa"harshmotherin law"andleftColumba"anorphan"(par.14,p.157*). 218.Ibid.,chap.2,pars.10,12,p.156*. 219.Ibid.,chap.4,par.27,p.161*. 220.Ibid.,par.28,p.161*. 221.Ibid.,chap.17,par.162,p.200*. 222.Ibid.,chap.4,pars.2122,p.159*:herhagiographerpointsoutthatshetriedtogiveupallfoodbutgreenfruit,breadandwater(andsometimesevenbread), butsheyearnedavidlyfor"thattruebread,theeucharist,"whichsustainscelibacy,comfortsthesoul,excitesustowar,repelsdemons,andgivesusaforetasteof glory.Seealsochap.5,pp.162*64*,andchap.13,par.119,p.187*. 223.Ibid.,chap.20,par.189,p.208*. 224.Ibid.,chap.5,par.31,p.162*.Seealsochap.3,pars.1920,p.159*. 225.Ibid.,chap.5,par.31,p.162*.Seealsochap.20,pars.18789,p.208*. 226.Ibid.,chap.5,par.32,p.162*. 227.Ibid.,chap.13,pp.186*90*,andchap.15,pars.15152,p.197*.


228.Ibid.,chap.8,par.71,p.171*. 229.Ibid.,chap.12,par.110,p.184*andchap.20,pars.191ff.,pp.209*12*. 230.Ibid.,chap.17,par.163,p.200*andchap.7,pars.49and51,p.167*. 231.Ibid.,chap.13,par.122,p.188*. 232.Ibid.,chap.22,par.217,p.217*. 5 FoodintheWritingsofWomenMystics 1.Seeabove,chap.2nn.13840,151,155. 2.SeeRiehle,Mystics,pp.10410andpassim.Riehlesays(pp.10910):"Forthemysticaffectivecontemplationimpliesreceivingwisdomandsavouringdivinelove atthesametime.Theideaofknowledgeandwisdomwhicharesensualandwhichcanbesavouredwaswidelyacceptedandcompletelytakenforgranteduntilthe seventeenthcentury,andissomethingwhichwetoday,whoaresousedtotheideaofthe'dissociationofsensibility'touseEliot'sfamousphrasehavelongsince lost."Forausefulwarningagainstreadingliteraryimagesasdirectevidenceoflifesituation,seeLillianHerlandsHornstein,"AnalysisofImagery:ACritiqueofLiterary Method,"PublicationsoftheModernLanguageAssociationofAmerica57.3(1942):63853. 3.WilliamofSt.Thierry,Denaturaetdignitateamoris,chap.10,par.31,PL184,col.399:"Haecest,inquit,vitaaeterna,utcognoscanttesolumverum Deum...(John17:3).Beatascientia,inquacontineturvitaaeterna.Vitaistaexillogustuest,quiagustare,hocestintelligere.Exhocgustuperhuncsaporeminhac sapientiaminimusilleApostolorumsatiatus,exhilaratus,confirmatus,Mihi,inquit,...dataesthaecgratia...(Ephes.3:818)."Andseeabove,chap.2atnn.146 47. 4.SeeBynum,JM,pp.186209,esp.p.200n.91. 5.SeeRiehle,Mystics,passim,andabove,pp.10212. 6.RosemaryHerde,"DasHoheliedinderlateinischenLiteraturdesMittelaltersbiszum12.Jahrhundert,"Studimedievali3.8.2(1967):9571073JeanLeclercq, MonksandLoveinTwelfthCenturyFrance:PsychoHistoricalEssays(Oxford:OxfordUniversityPress,1979). 7.SeeBynum,JM,pp.17074. 8.Forexceptions,seebelow,chap.10nn.3638. 9.ThereisverylittlegoodrecentworkonHadewijchexceptinDutch.ThebestdiscussionsinotherlanguagesareJ.VanMierlo,"Hadewijch,unemystiqueflamande du13esicle,"Revued'asctiqueetdemystique5(1924):26989,380404Porion,"Hadewijch,"DS,vol.7,cols.1323PaulMommaers,Preface,and ColumbaHart,introductiontoHart,Hadewijch:Works,pp.xiii42.ForrecentDutchbibliography,seeHart,Hadewijch:Works,andJ.Reynaert,DeBeeldspraak vanHadewijch,Studinentekstuitgavenvanonsgeestelijkerf21(Tielt:RuusbroecGenootschap,1981). 10.SeeLetter17inHart,Hadewijch:Works,pp.8284. 11.Letter15inHart,Hadewijch:Works,11.7581,p.79:"Thefourthpoint[ofninepointsforthepilgrimtravelingtowardGod]is:Youmustkeepyourselffrom gluttony,


thatis,fromanyworldlyselfsatisfaction:letnothingoutsideofGodeversufficeyouorhaveanytasteforyou,beforeyouhavetastedhowwonderfullysweetheis (Ps.33:9).Oh,rememberthis,andbearitalwaysinmind:Whateveranyonetakespleasurein,otherthanGodAlone,isallgluttony."SeeHadewijch,Brieven,ed. JanVanMierlo,vol.1(Antwerp:N.V.StandaardBoekhandel,1947),p.127.Hadewijchclearlyusesgluttonyprimarilymetaphorically. 12.Hart,Hadewijch:Works,pp.263305.Vision1comeswhenthesacramentisbroughttoherbedsidevision3comesafterreception(Hadewijch'scharacteristic wayofexpressingthisis"IhadgonetoGod")vision4comesatmass,duringtheepistlevision6comesasshefeelsgreatdesiretoreceiveinvision7she experiencesfullphysicalunionwithChristwhenhegiveshercommunioninbothkindsinavision(thevision,however,comesatMatins)vision12comesduringmass. 13.Forrecentdebateoverwhatexactlyminne(love)meanstoHadewijch,seeNorbertDePaepe,HadewijchStrofischeGedichten:Eenstudievandeminnein hetkaderder12een13eeeuwsemystiekenprofaneminnelyriek(Ghent:KoninklijkeVlaamseAcademie,1967),andHart,IntroductiontoHart,Hadewijch: Works,p.8.Forimagesoftasting,hungering,andinnersweetnessinHadewijch,seeReynaert,Beeldspraak,pp.20220. 14.SeeReynaert,Beeldspraak,pp.20810,andMommaers,Preface,inHart,Hadewijch:Works,pp.xxiiixiv.Mommaers'stranslationdifferssomewhatfrom Hart'sseeibid.,p.303.Forthetext,seePaulMommaers,ed.,DeVisioenenvanHadewijch:Middelnederlandsetekst...,Spiritualiteit15,supplement (Nijmegen:B.Gottmer,1979),vision14,11.7273:"inerenaturensmakeonghescedenmettergheheelregodheit"(editionnotpaginated). 15.Vision14,Hart,Hadewijch:Works,p.305Mommaers,DeVisioenen,supplement,vision14,11.14143. 16.See,forexample,Letter6inHart,Hadewijch:Works,11.22735,p.61:"NowadaysthisisthewayeveryoneloveshimselfpeoplewishtolivewithGodin consolationandrepose,inwealthandpower,andtosharethefruitionofhisglory.WeallindeedwishtobeGodwithGod,butGodknowstherearefewofuswho wanttoliveasmenwithhisHumanity,orwanttocarryhiscross."SeeVanMierlo,Brieven,vol.1,p.64.SeealsoHart,Hadewijch:Works,vision1,11.288ff.and 341ff.,pp.268and269:"He[Christ]continued:'...IfyouwishtobelikemeinmyHumanity,asyoudesiretopossessmewhollyinmyDivinityandHumanity,you shalldesiretobepoor,miserableanddespisedbyallmenandallgriefswilltastesweetertoyouthanallearthlypleasures....''Since,then,youareahumanbeing, liveinmiseryasman....Feelyourselfasmaninallthehardshipspropertothehumancondition,exceptsinalone.'"SeeMommaers,DeVisioenen,supplement, vision1,11.25460and31118. 17.PoemsInCouplets,poem16:Love'sSevenNames,Hart,Hadewijch:Works,p.356Hadewijch,Mengeldichten,p.83. 18.Letter18,pp.10311,inHart,Hadewijch:Works,p.87andinVanMierlo,Brieven,vol.1,p.156.Seeibid.,vol.2,pp.2225,fortheborrowingsfrom WilliamofSt.Thierry. 19.PoemsinStanzas,poem39:Love'sBlows,1.18,Hart,Hadewijch:Works,p.240seeE.RombautsandN.DePaepe,eds.,Hadewijch:Strofische Gedichten:Middelneder


landsetekstenmodernebewerking...,KlassiekenuitdeNederlandseLetterkunde...(Zwolle:W.E.J.TjeenkWillink,1961),p.274.SeealsoLetter22,in Hart,Hadewijch:Works,11.22426,p.99. 20.Letter11,inHart,Hadewijch:Works,11.1045,p.69VanMierlo,Brieven,vol.1,pp.9395. 21.Letter22,inHart,Hadewijch:Works,11.14359,p.97VanMierlo,Brieven,vol.1,19394.Bothhereandat11.25163,HadewijchquotesSongof Songs1:12. 22.Letter9,inHart,Hadewijch:Works,11.711,p.66VanMierlo,Brieven,vol.1,pp.7980. 23.PoemsinCouplets,poem16:Love'sSevenNames,Hart,Hadewijch:Works,11.3740,p.353Hadewijch,Mengeldichten,p.79.Butseebelow,nn.28and 29. 24.Vision7,inHart,Hadewijch:Works,pp.28182seeMommaers,DeVisioenen,supplement. 25.PoemsinCouplets,poem15,Hart,Hadewijch:Works,11.12,33,3740,pp.35052Hadewijch,Mengeldichten,pp.7274. 26.PoemsinCouplets,poem14,esp.11.13234,Hart,Hadewijch:Works,pp.34550Hadewijch,Mengeldichten,pp.6571. 27.Letter17,Hart,Hadewijch:Works,p.84VanMierlo,Brieven,vol.1,pp.14344. 28.PoemsinCouplets,poem16,Hart,Hadewijch:Works,11.4048,p.353Hadewijch,Mengeldichten,p.79. 29.PoemsinCouplets,poem16,Hart,Hadewijch:Works,11.16568,p.357Hadewijch,Mengeldichten,pp.8384. 30.PoemsinCouplets,poem13:TheParadoxesofLove,Hart,Hadewijch:Works,11.12,47,27,29,p.344Hadewijch,Mengeldichten,pp.6162. 31.Seen.16above. 32.Vision1,Hart,Hadewijch:Works,p.266. 33.Ibid.,p.269Mommaers,DeVisioenen,supplement,vision1,11.30910:"NadiendattumenschebestSoeleveellendechalsmensche." 34.Seevision5,Hart,Hadewijch:Works,pp.27677. 35.Vision11,ibid.,pp.29192.Thereremainsthroughout,however,astrongemphasisonHadewijch'sserviceofothers.Invision13,ibid.,p.301,Christtellsher hesendsherbackintoherbodyafterfruition"forthesakeofthosewhomyouhavechosentobecomefullgrownwithyouinthis,butwhoarenotyetfullgrown." 36.PoemsinStanzas,poem39:Love'sBlows,Hart,Hadewijch:Works,verses9and10,p.242RombautsandDePaepe,StrofischeGedichten,p.280. 37.SheevenhadavisioninwhichChrist,asayoungchild,gaveher"hisBody"(i.e.,thehost)toeat:vision7,Hart,Hadewijch:Works,p.281thevisionoccursjust beforethevisionofChristasamandescribedinn.24above. 38.Letter18,ibid.,11.110,p.85VanMierlo,Brieven,vol.1,pp.15152. 39.Seen.16above. 40.PoemsinStanzas,poem33,Hart,Hadewijch:Works,pp.22123RombautsandDePaepe,StrofischeGedichten,pp.23438. 41.OnBeatrice,seeJanVanMierlo,"BatricedeNazareth,"DS,vol.1(1932),cols.131014,andVitaBeatricis,LatinsummaryofDutchintro.,pp.39.


42.VitaBeatricis,pp.15779,givesaliteralLatintranslationofBeatrice'svernaculartextoftheSevenStepsofLovealongsidehertranslator'sversionofit.Forthe vernaculartextseeL.ReypensandJ.VanMierlo,eds.,BeatrijsvanNazarethsevenmanierenvanMinne(Louvain:VlaamscheBooekenhalle,1926). 43.Onherasceticism,seeVitaBeatricis,bk.1,chaps.47,pp.2635onhereucharisticdevotion,seebk.1,chaps.1314,18,bk.2,chaps.1516,andbk.3, chaps.2,5,pp.5257,6364,1037,12627,13334. 44.SeeVanMierlo,"Batrice,"col.1311andVitaBeatricis,bk.1,chap.11,p.48,bk.3,chap.6,pp.13436,bk.3,chap.14(whichgivesBeatrice'sown treatiseonthesevensteps),pp.16870.Inthislastpassage,Beatricesays,speakingofthefifthstepoflove:"Hocipsumquodmagiseamcruciatatquevulnerat, idipsummagisintegratetlenit,etquodeamprofundisvulnerat,hocsolumdateisanitatem."Inbk.3,chap.6,p.136,Beatriceiscalledinsanaorfatua(foolish)for love.Hadewijchalsospeaksofecstasyasinsanity(orewoet)seeabove,n.25.PhilipofClairvauxintheLifeofElizabethofSpalbeek(Cat.cod.hag.Bruxellensis, vol.1,pt.1,p.364)callsElizabeth'secstasyimbecillitas. 45.Beatrice'sbiographercommentsattheendofbk.1,chap.18,pp.6364,thatinearlylifeshewasliquifiedandmadeillbythedelightsofthesacramentbutlater shewascuredfromallsicknessbyit,andthisshouldnot,hesays,surprisethereader,forthesamesacramentis"milkandmeat." 46.InVitaBeatricis,bk.3,chap.15,pp.18083,thebiographeremphasizesherloveandserviceofothersthroughprayer,advice,andcompassion. 47.Seeabove,pp.58,13839,and14142.InVitaBeatricis,bk.2,chap.15,pp.1034,thehagiographerprovidesatheologicalglossonthesubjectoffrequent communion,sayingbothdevotion[spiritualisaffectio]andfear[timor]arenecessary.HealsoreportstheeffortsofthedeviltoconvinceBeatricethatbecauseof hersordidthoughtssheisunworthytoreceivefrequently. 48.VitaBeatricis,bk.3,chap.2,pp.12627.Thereisasimilardescriptioninbk.3,chap.5,p.133. 49.Ibid.,bk.2,chap.16,pp.1057. 50.Ibid.,bk.3,chap.13,pp.15455. 51.Ibid.,bk.1,chap.11,pp.4549.Thepreviouschaptermakesitperfectlyclearthatthesistersdiscussedsuchexperiencestogetheranddesiredthemandthat oldernunstaughtyoungersisterstoexpectthem.ThehagiographerfrequentlydescribesBeatrice'sreactionstothevisitationofthespiritasimmoderatelaughter(as wellasimmoderateweeping)seebk.1,chap.18,11.1617,p.63,andbk.2,chap.13,1.54,p.99. 52.Ibid.,bk.2,chap.6,pp.13436.Heradvisertoldherthathedidnot,however,thinkitwasasuggestionofthedevil. 53.Ibid.,bk.3,chap.15,pp.18083. 54.Ibid.,bk.3,chap.14,pp.15779. 55.Ibid.,p.174.Theparadoxicallanguage,especiallythenotionof"healthywounding,"ismoreprominentinBeatrice'sowntextthaninhertranslator'sversion. Similarlanguageisusedtodescribestepfive,p.170seebelow. 56.Ibid.,the"secondstepoflove,"p.161,andthe"sixthstep,"p.171. 57.Ibid.,p.166.


58.Ibid.,pp.16970. 59.Ibid.,bk.3,chap.12,pp.15253. 60.Ibid.,bk.3,chap.7,pp.13740. 61.ThebasicsourceforCatherineistheLegendamaiorbyherconfessor,RaymondofCapua,inAASSApril,vol.3,pp.861967.ThereisarecentEnglish translationbyConlethKearns,LifeofCatherine.AcontemporaryaccountwhichRaymondprobablydidnotknowistheanonymousIMiracolidiCaterinadi JacopodaSienadiAnonimoFiorentineacuradiFrancesoValli(Siena:R.UniversitdiSiena,CattedraCateriniana,1936).Othermajorsources,whichwere influencedbyRaymond'swork,aretheLegendaminor(anabridgmentofRaymond)andtheSupplementum,byThomasAntoniideSenis(alsocalledCaffariniand TommasoNaccidaSiena),andtheProcessofcanonization,begunin1411,knownastheCastellanoProcessortheProcessofVenice.SeeThomasAntoniide Senis,LeggendaminorediS.CaterinadaSiena(eletteredeisuoidiscepoli),ed.FrancescoGrottanelli(Bologna:PressoGaetanoRomagnoli,1868)idem, Libellusdesupplemento:LegendeprolixeVirginisBeateCatherinedeSenis,ed.GiulianaCavalliniandImeldaForalosso(Rome:EdizioniCateriniane,1974)and M.HyacintheLaurent,ed.,IlProcessoCastellano...conappendicedidocumenti...,FontesvitaeS.CatharinaeSenensishistorici9(Milan:FratelliBocca Editori,1942).ThecontroversylaunchedbyRobertFawtierin1921overthereliabilityofthesurvivingsourcesonCatherinehasproducedafloodofpainstaking researchseeRobertFawtier,SainteCatherine:Essaidecritique:Sourceshagiographiques,andidem,SainteCatherine:Essaidecritique:Lesoeuvres, BibliothquedesEcolesFranaisesd'AthnesetdeRome121and135(Paris:deBoccard,1921and1930)and,onthecontroversy,seeKearns,Lifeof Catherine,pp.IxIxx,andBell,HolyAnorexia,chap.2n.3.ForafairlyrecentbibliographyseeLinaZanini,BibliografiaanaliticadiS.CaterinadaSiena, 19011950(Rome:EdizioniCateriniane,1971).ForafullertreatmentofthechronologyofCatherine's"eatingdisorders,"seeBell,HolyAnorexia,pp.2353. WhereBellhasbeeninterestedinCatherine'sbehavior,IhavebeenmoreinterestedinCatherine'ssymbolsandtheology.Neitherofushastreatedatmuchlengthher importantpublicroletowardtheendofherlife.UsefulbiographiesofCatherineincludeInnocenzoM.Taurisano,SantaCaterinadaSiena:Patronad'Italia(Rome: F.Ferrari,1940),andArrigoLevasti,MyServant,Catherine,trans.DorothyM.White(London:Blackfriars,1954),unfortunatelywithoutfootnotes. 62.CatherineofSiena,Dialogue,ed.CavalliniEngl.trans.SuzanneNoffke,CatherineofSiena:TheDialogue(NewYork:PaulistPress,1980).Fortheletters, seetheincompleteeditionbyEugenioDuprTheseider,EpistolariodiSantaCaterinadaSiena,vol.1,Fontiperlastoriad'Italia,pubblicatedalR.IstitutoStorico ItalianoperilMedioEvo(Epistolari:SecoloXIV)(Rome:Sededell'Istituto,1940),andCatherineofSiena,Letters,ed.Misciattelli(Siena,19131922)(theFlorence 193940reprinthasdifferentpagination).Fortheprayers,seeCatherineofSiena,LeOrazioni,ed.GiulianaCavallini(Rome:EdizioniCateriniane,1978)translated bySuzanneNoffkeasThePrayersofCatherineofSiena(NewYork:PaulistPress,1983). 63.SeeFrancescoValli,L'InfanziaelapueriziadisantaCaterinadaSiena:esamecriticodellefonti,Bibliotecadi"StudiCateriniani"(Siena:IstitutodiStudi CaterinianinellaRegiaUniversitdiSiena,1931).Ihavebeenunabletoconsultidem,L'AdolescenzadiSantaCaterinadaSiena:esamecriticodellefonti(Siena, 1934).


64.ForCatherine'sinedia,seeespeciallyRaymondofCapua,LifeofCatherineofSiena,pt.1,chap.3,par.38,p.872,andchap.6,pars.5860,pp.87677pt. 2,chap.4,par.164,p.903pt.2,chap.5,pars.16577,pp.9037pt.3,chap.6,par.400,p.960andIMiracoli,chaps.49,2829,pp.59,2325.Onher eucharisticdevotion,seeRaymond,LifeofCatherine,pt.2,chap.5,pars.17071,pp.9045,andpt.2,chap.6,pars.181,18792,pp.907,909ThomasAntonii deSenis,Libellusdesupplemento,pt.2,tract.6,pp.75120andIMiracoli,chaps12,13,pp.1112. 65.RudolphBellhascollectedanumberofcontemporaryreferencestoCatherine'sinediaseeHolyAnorexia,p.195n.10. 66.Seeabove,chap.3n.98.IntheLifeofCatherineofSiena,pt.1,chap.6,par.60,p.877,Raymondseemsalsotobereflectingonhisownexperiencewith fasting. 67.Seeabove,chap.4nn.186,207,208,and210. 68.Raymond,LifeofCatherine,pt.2,chap.12,pars.32428,pp.94244.RaymondreportsthatwhenCatherinevisitedAgnes'sbody,shereceivedarainof mannaasamiracle,and,hesays,"therewasareasonwhythisparticularkindofmiracleshouldhappenthere.ForwhileAgneswasalive,arainofmannafallingonher wasausualthing." 69.Seeabove,chap.4n.209. 70.RaymondofCapua,LifeofCatherine,pt.1,chap.3,par.64,pp.87778pt.2,chap.5,par.173,pp.9056pt.2,chap.6,pars.18384,p.908. 71.See,forexample,Letter61,CatherineofSiena,Letters,ed.Misciattelli,vol.1,pp.27477,andLetter163,ibid.,vol.3,p.43.OnthispointseeKearns,Lifeof Catherine,p.177n.23. 72.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.4,pars.16263,pp.9023andpt.3,chap.6,par.414,p.963IMiracoli,chap.29,pp.2425. Fawtier,Catherine:Sourceshagiographiques,p.97,pointsoutthatvisionsofChristortheangelsfeedingCatherinearelesscommoninIMiracolithanin Raymond'saccount.ItisalsoworthnotingthatRaymondismoreapttocallthewoundinChrist'ssidea"fountain"whereasCatherine'sownwordsstressitasa "breast",LaDoubleExpriencedeCatherineBenincasa(sainteCatherinedeSienne)(Paris: Gallimard,1948),p.38. 73.IMiracoliandRaymondofCapua'sLifeofCatherineofSienagiveindependentaccountsofherincreasinginedia(seen.64above)andanumberofher contemporariesnoticedit(seen.65above).Thepapalbullof1461authorizinghercanonizationmakesexplicitmentionofherextraordinaryfastingseeAASSApril, vol.3(Paris,1866),p.983. 74.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.1,par.25,p.869.Theincidentismentionedonlyinpassing. 75.Ibid.,pt.1,chap.4,pars.4145,pp.87374.SeealsoBell,HolyAnorexia,chap.2. 76.Bell,HolyAnorexia,pp.3852,makesaconvincingcaseforCatherine'ssenseofguiltasasurvivorformingamajor(subconscious)motiveforhertheologyof sufferingandherincreasingselfstarvation. 77.IMiracoli,chap.6,p.6cf.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.4,par.46,p.874. 78.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.3,par.38,p.872.


79.Ibid.,pt.1,chap.2,pars.3334,pp.87071IMiracoli,chap.3,pp.34seealsoValli,L'Infanzia,pp.4849,7376.Oneshouldperhapspointoutthat manyoftheincidentsofchildishpietythatRaymondreportsstrikethemodernreaderasexactlythesortofplayandfantasizingchildrendoengagein. 80.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.9,pars.89ff.,pp.884ff.ThomasAntoniideSenis,Libellusdesupplemento,pt.1,tract.1,sect.5, pp.1415. 81.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.1,pars.11924,pp.89293,andpt.2,chap.5,pp.9037. 82.Ibid.,pt.2,chap.5,par.177,pp.9067. 83.Seebelow,n.85,andseeLifeofCatherineofSiena,pt.2,chap.12,par.315,p.940,whereCatherinecriesouttoRaymond(aboutherdesirefortheeucharist): "OsisciretisPaterquantumesurio!" 84.IMiracoli,chaps.49,2829,pp.59,2325LetterofStefanoMaconicitedabove,chap.3n.71ThomasAntoniideSenis,Libellusdesupplemento,pt.2, tract.2,sect.6,pp.3435,andpt.2,tract.6,sects.42,43,pp.1013Bell,HolyAnorexia,chap.2andDrane,HistoryofSt.Catherine,vol.1,pp.199ff. 85.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.5,pars.16667,171,pp.9034,905trans.Kearns,LifeofCatherine,pp.16061and164.In CatherineofSiena,Dialogue,ed.Cavallini,chap.142,pp.39499,Catherinewritesofdesirefortheeucharistasintensehunger. 86.Letter19(number92inTommaseonumbering),DuprTheseider,Epistolario,vol.1,pp.8082.SeealsoRaymondofCapua,LifeofCatherineofSiena,pt.2, chap.5,par.174,p.906,wherehereportsthatCatherinesaid:"Deuspropterpeccatameapercussitmesingulariquadampassionesiveinfirmitate,perquamacibi sumptionesumtotaliterimpedita:etegolibentissimevellemcomedere,sednonpossum"(emphasisadded). 87.Letter19,DuprTheseider,Epistolario,vol.1,pp.8182:"MandastimidicendochesingularmenteiopregassiDioch'iomangiassi.Eiovidico,padremio,e dicovelonelcospettodiDio,cheintuttiquantie'modich'iopotutitenere,sempremiso'sforzata,unavoltaodueeld,diprendareelciboepregato continovamenteepregoDioepregarchemidiagratia,cheinquestoattodelmangiareiovivacomel'altrecreature,s'eglisuavolont&grave,perchelamiaci. Edicovicheassaivolte,quand'iofattocich'iopotuto,eioentrodentrodameaconosciarelamiainfermiteIdio,chepersingularissimagratiam'abifatto correggiareelvitiodellagola,dogliomimoltoch'io,perlamiamiseria,nonI'correttaperamore." 88.Bell,HolyAnorexia,chap.2.InLifeofCatherineofSiena,pt.2,chap.12,par.311,p.939,RaymondreportsthatsomesaidCatherinecommunicateddailyand livedontheeucharistalonebutthiswas"notquitetrue." 89.Seeabove,nn.85,87IMiracoli,chap.8,p.9andRaymondofCapua,LifeofCatherineofSiena,pt.2,chap.3,par.137,p.896. 90.See,forexample,Letter267,CatherineofSiena,Letters,ed.Misciattelli,vol.4,pp.17884,andLetter214,vol.3,pp.28892.SeealsoRaymondofCapua, LifeofCatherineofSiena,pt.2,chap.4,par.149,pp.899900,wherewefindherblamingonherownsinsthepettinessofthesickwomanPalmerina.


91.SeeRaymondofCapua,LifeofCatherineofSiena,pt.2,chap.5,par.171,p.905. 92.Seeibid.,pt.2,chap.5,par.170,pp.9045,andDrane,HistoryofSt.Catherine,vol.1,p.203. 93.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.5,par.167,p.904.Itispertinenttonotethat,withamoresympatheticconfessoroneinfactinawe ofherprowessatfastingCatherinebecamesomewhatmoretractable,morewillingatleasttomakeapretenseofeatingseeibid.,pt.2,chap.5,pars.17677,pp. 9067.Inotherwords,shewassomewhatmorewillingtomodifyherbehavior(atleastsuperficially)iftheinterpretationofitssignificanceremainedinhercontrol,but shestillmanagedthingssothatshereceivedlittlerealnourishment. 94.SeeCanet,pt.2,inFawtierandCanet,DoubleExprience,pp.31112,comparingherlettersoftheearly1370swithherlettersof1378to1380.See especiallyLetter64tothehermitWilliamFlete,CatherineofSiena,Letters,ed.Misciattelli,vol.1,pp.28694,whereshesays:"Prdonoloromedesimi, spogliandosi,dell'uomovecchio,ciodellapropriasensualitevestonsidell'uomonuovoCristodolceGesseguitandolovirilmente.Questisonochesipasconoalla mensadelsantodesiderio,echehannopostopilasollicitudineinucciderelapropriavolont,cheinuccidereoinmortificareilcorpo"(pp.29192). 95.CatherineofSiena,Dialogue,ed.Cavallini,chap.149,pp.42629. 96.Thesourcesseemtodiffersomewhataboutthelengthofherretreat.IMiracoli,chap.6,p.7,sayssevenyears(probably13621370)RaymondofCapua,Life ofCatherineofSiena,pt.1,chap.6,pars,5763,pp.87677,andchap.9,pars.8283,pp.88283,suggestsitwasthreeyears.Buttheremaybenoconflictin fact,fortheretreatwasnottotal,andRaymondissimplygivingamoredetailedaccountofitsvariousaspects. 97.Wecanseesomethingoftheproblemherbehaviorposedforherfamilyinpt.2,chap.2,pars.13537,pp.89697,wherewehaveastoryofCatherinegiving awayotherpeople'sclothesandthepassingremarkthatherfamilyhadtokeepeverythinglockeduptopreventherfromgivingitaway. 98.DepositionofBrotherBartholomewDominiciinLaurent,IlProcesso,pp.29092.AnotherversionofthestoryoranotherstoryistoldbyRaymondofCapuain LifeofCatherineofSiena,pt.2,chap.3,pars.14041,pp.89798.Drane,HistoryofSt.Catherine,vol.1,p.82,reportsthatcitizensofSienastillcallsomething thatnevercomestoanend"acaskofSt.Catherine."SeealsoRaymond,LifeofCatherineofSiena,pt.2,chap.16,pars.298310,pp.93639,onmiraculousfood multiplications. 99.Catherinebecameatertiaryinherlateteens(probablyin1364or65).HerfatherdiedinAugust,1368,andafterthisthefamilyhomeasCatherinehadknownit cametoanendandthefamilyfortunesdeclined.Catherine,asiswellknown,tookonanincreasinglypublicroleasadviserandexhorterofecclesiasticshistorians havedifferedintheirestimatesofhersuccess. 100.RaymondofCapua,LifeofCatherineofSiena,pt.2,chaps.24,617,pp.895903,90739. 101.Ibid.,pt.2,chap.16,par.303,p.937. 102.Ibid.,pt.2,chap.16,pars.29899,p.936. 103.CatherineofSiena,Dialogue,ed.Cavallini,chap.149,pp.42529.Raymond


himselfdrawstheparallelbetweenDominic'sfoodmultiplicationmiraclesandCatherine'sLifeofCatherineofSiena,pt.2,chap.16,par.305,pp.93738. 104.ThomasAntoniideSenis,Libellusdesupplemento,pt.2,tract.4,sects.1314,pp.6264. 105.SeedepositionofFrancescoMalavoltiinLaurent,IlProcesso,pp.39496andDrane,HistoryofSt.Catherine,vol.2,pp.6164.SeealsoRaymondof Capua,LifeofCatherineofSiena,pt.2,chap.13,par.276,p.930. 106.RaymondofCapua,LifeofCatherineofSiena,pt.3,chap.4,pars.37076,pp.95456.Semia,forwhomCatherineperformsthemiracle,criesout:''Omater meadilecta!Venistiaddomummeamclausisjanuisadfaciendummihicoquinam.Nuncscioverequiasanctaes."ItisworthnotingthatCatherinesometimesherself escapeddomesticchoresthroughecstasies,althoughatothertimessheinsistedondoingmorethanhershareofthehousework.SeeLifeofCatherineofSiena,pt.2, chap.2,pars.12627,pp.89394,wherehersisterinlawLisafindsherinecstasywhensheoughttobeturningthespittoroastmeat."Quodadvertens... Lysa...sciensmodumvirginis,coepitipsavertereveru,etpermisiteamcoelestissponsifruiamplexibus.Cumquecoctiscarnibusillisetfactacoenacunctorum domesticorum,adhuciliainextasipermaneretLysapraefata,perfectiscunctisquaevirgosacrafaceresolebatservitiis,ipsampermisitadlibitumdivinispotirisolatiis." 107.Ibid.,pt.2,chap.16,par.308,p.938trans.Kearns,LifeofCatherine,p.285. 108.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.16,par.300,pp.93637trans.Kearns,LifeofCatherine,pp.27879,withmychanges. 109.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.8,pars.21218,pp.91416IMiracoli,chap.27,pp.2223andseeCanetinFawtierand Canet,DoubleExprience,pp.337ff.,esp.pp.35455. 110.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.9,pars.22023,pp.91617pt.3,chap.7,par.417,p.964. 111.Ibid.,pt.2,chap.11,pars.24144,pp.92223seealsoFawtier,Catherine:Sourceshagiographiques,p.135. 112.See,forexample,above,n.108LetterofStefanoMaconiinCatherineofSiena,Letters,ed.Misciattelli,vol.6,Lettersofdisciples.Letter12,p.81("per ch'iocredoveramenteecosconfesso,chelaMammanostrabenignissimamammaefermasperanzacheognidconpichiarolumecredareconfessarcon maggioreefficacia,leiesseremamma")andthepanegyricofWilliamFlete,quotedinDrane,HistoryofSt.Catherine,vol.2,p.214,andvol.1,pp.17679.(On WilliamFleteseealsoFawtier,Catherine:Sourceshagiographiques,pp.5381.)SeealsoBell,HolyAnwexia,chap.2. 113.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.4,pars.155,16263,pp.901,9023,andpt.3,chap.7,pars.412,414,p.963IMiracoli, chaps.3233,pp.2829ThomasAntoniideSenis,Libellusdesupplemento,pt.2,tract.2,sect.4,p.34. 114.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.4,par.162,p.902. 115.Ibid.,par.163,p.903trans.Kearns,LifeofCatherine,pp.15556. 116.RaymondofCapua,LifeofCatherineofSiena,pt.3,chap.7,par.414,p.963. 117.CatherinealsoexperiencedwhatRaymondcallsanexchangeofheartswithChrist,andfromthenceforthshefeltasifshelivedwithoutherheartseeibid.,pt.2,


chap.6,par.179,p.907.(LutgardofAywiresinthethirteenthcenturysupposedlyexperiencedasimilarsensation.). 118.Seeabove,nn.64,72,85,88. 119.DepositionofBrotherFrancesoofLuccainLaurent,IlProcesso,pp.36869.ForCatherine'srespectforpriests,whomshecalls"christs,"seeCatherineof Siena,Dialogue,ed.Cavallini,chaps.14,23,11318,pp.3742,5154,27486andpassim,andThomasAntoniideSenis,Libellusdesupplemento,pt.2,tract. 6,sects.126passim,pp.7688. 120.ForthethemeofdrinkingfromChrist'ssideinRaymond'saccount,seeLifeofCatherineofSiena,pars.16263(thevisiondiscussedabove),pp.9023par. 187(anothervisionofdrinkingfromChrist'sbreast),p.909par.191(visiondiscussedbelow,n.121),p.909andpar.199(avisionsupposedlyreportedbyher earlierconfessor,ThomasdellaFonte,ofCatherinenursedatthebreastsoftheVirgin),p.911.Seealsoabove,n.72. 121.RaymondofCapua,LifeofCatherineofSiena,pt.2,chap.6,pars.18891,p.909trans.GeorgeLamb,TheLifeofSt.CatherineofSienabyBlessed RaymondofCapua(London:HarvillPress,1960),p.173,withminorchanges.(Lamb'stranslationismuchhardertoobtainthanKearns'butisoftenmoreliteraland accurate.)Forthehistoryofthemetaphor,seeAndrCabassut,"UneDvotionmdivalepeuconnue:Ladvotion'JsusnotreMre,'"MlangesMarcelViller, Revued'asctiqueetdemystique25(1949):23445Bynum,JM,pp.11069EleanorC.McLaughlin,"'ChristMyMother':FeminineNamingandMetaphorin MedievalSpirituality,"NashotaReview15(1975):22648Julian,BookofShowings,ed.ColledgeandWalshprefaceandintro.toJulianofNorwich: Showings,trans.ColledgeandWalsh,introductionbyJeanLeclercq(NewYork:PaulistPress,1978)andValerieLagorio,"VariationsontheThemeofGod's MotherhoodinMedievalEnglishMysticalandDevotionalWritings,"Studiamystica8(1985):1537.SeealsoGabriellaAnadol,''LeImmaginidellinguaggio caterinianoelelorefonti:LaMadre,"Rassegnadiasceticaemistica22(1971):33743.InhispsychologicalportraitofCatherine,RudolphBell(HolyAnorexia, chapter2)makesmuchofherpictureofnursingandweaningasincludingbitternessandpain.HecitesthispassageandespeciallyLetter81(Tommaseonumber239) toPopeGregoryXI(DuprTheseider,Epistolario,pp.33233)andcallsattentiontoLapa'sinexperienceatweaning,whichhedocumentsbyreferenceto Raymond,LifeofCatherineofSiena,par.26,p.869.ItmaybethatCatherine'spersonalexperienceofweaningwasapainfulone(althoughonemustpointoutthat wehavenoevidenceofthis),butweshouldalsonotethatmanymedievalwritersspeakofmothersasteasinganddiscipliningtheirbabies. 122.SeeCatherineofSiena,Dialogue,ed.Cavallini,chaps.14(bothpriestsandChristseenasnursingmothers),96(Christasnursingmother),141(theHolySpirit asmothernotanextendedimage),and151(Godspeaksasanursingmother),pp.3742,22530,39293,440andseeLetter1*,CatherineofSiena,Letters, ed.Misciattelli,vol.6,pp.14(charityisamotherwhonursesherchildrensheisalsoafoodthatnurturesthesoul)Letter86,ibid.,vol.2,pp.8188(wemust nurseatthebreastofcharitythesoulmustfeedonthepainsofthecross,whicharesweet)Letter260,ibid.,vol.4,pp.13741,esp.13940(Christisthenurse whodrinksbittermedicineinordertofeedthechild)andLetter2*,ibid.,vol.6,pp.59(Christisthenurseofthesoul).Seealsothe


lettertoGregoryXIcitedabove,n.121,inwhichthepopeisurgednottoturnawayfromthebreastbecausethemilkisbitter(i.e,becausethevirtuouspathisa painfulone).BecauseCatherine'slettersinLetters,ed.Misciattelli,vol.6,arenumberedseparately,Ihaveusedastar(*)afterthenumberingforthatseries. 123.CanetinFawtierandCanet,DoubleExprience,pp.3046,makesthispoint. 124.Letter86,CatherineofSiena,Letters,ed.Misciattelli,vol.2,pp.8182.IntranslatingCatherine'sItalianIhavebeenaidedbytheFrenchtranslationofE. Cartier,LettresdesainteCatherinedeSienne,4vols.,BibliothqueDominicaine,2ded.(Paris:EditionsTqui,1886).IamalsogratefultoRachelJacoffof WellesleyCollegeforassistance. 125.SeeLetter81,DuprTheseider,Epistolario,pp.33233CatherineofSiena,Dialogue,ed.Cavallini,chap.96,pp.22530,andchap.151,p.440Canetin FawtierandCanet,DoubleExprience,pp.332,3046andabove,n.122. 126.CatherineofSiena,Dialogue,ed.Cavallini,chap.14,pp.4041,trans.Noffke,Catherine:TheDialogue,p.52. 127.See,forexample,Letter184,CatherineofSiena,Letters,ed.Misciattelli,vol.3,p.146(hereshedescribesChristonthecrossas"arrostitoinsulacroceal fuocodell'ardentissimacarit")Letter358,vol.5,p.284. 128.CatherineofSiena,Dialogue,ed.Cavallini,chap.124,p.314trans.Noffke,Catherine:TheDialogue,p.239. 129.CatherineofSiena,Dialogue,ed.Cavallini,chap.142,pp.394400,esp.p.394seealsochaps.12829,pp.33245,whereCatherinediscussespriestswho onlypretendtoconsecrateorwhosaythewordsofconsecrationincorrectly. 130.Ibid.,chap.142,pp.39699. 131.SeeRaymondofCapua,LifeofCatherineofSiena,pt.2,chap.6,pars.17982(CatherineandChristexchangehearts),pp.9078,andpt.2,chap.2,pars. 13537,pp.89697(ChristclothesCatherinewithatunictakenoutofhissidetokeepherwarm).Andseeabove,n.120,forvisionsinwhichCatherinejoinswith Christ'sbodybynursingathisbreast. 132.IntheDialogueoneofCatherine'sdominantimagesisChrist'sbodyasabridgeupwhichweclimb.WhenshespeaksofthesoulreachingChrist'smouth, however,sheimpliesnotprimarilythatwereposethereinakiss(astheSongofSongssuggests)butthatweeatwithChristwebecomehismouthandwhatwe eatissuffering(i.e.,rejectionofourphysicalityandsalvationofourneighborsbyvicarioussuffering).See,forexample,CatherineofSiena,Dialogue,ed.Cavallini, chaps.26,5155,andesp.76,pp.5759,11425,16871seebelow,n.141,foraquotation. 133.ItissignificantthatCatherineherselfchoosestoreporttwokindsoffoodmiraclesintheDialoguetheeucharisticmiraclesreferredtoabove,n.130,andthe foodmultiplicationmiraclesmentionedabove,n.103althoughshedoesnotreportothermiracles. 134.IMiracoli,chaps.36,29,pp.37,2425RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.1,par.29,p.870,andchap.7,pars.11417,pp. 89091.SeealsoFawtierinFawtierandCanet,DoubleExprience,p.38. 135.Letter221,CatherineofSiena,Letters,ed.Misciattelli,vol.3,p.337:"Benvedituchetuseisposa,echeeglit'hasposata,eteeognicreaturaenonconanello d'argento,


maconanellodellacarnesua."Letter50,vol.1,p.236:"Vedibene,cheilFigliuolodiDiotutticisposnellacirconcisione,quandositaglilacarnesua,dandoci quantounastremitd'anello,insegnochevolevasposarel'umanagenerazione."Letter261,vol.4,p.146:"Equestofal'animache,essendoliberatadalla servitudinedeldimonio,ricomperatadelsanguediCristocrocifisso,nond'oroned'argento,madisangue...e,avendolaDiofattasposadelVerbodelsuo Figliuolo,ilqualedolceGeslasposconlacarnesua(perocch,quand'eglifucirconciso,tantacarnesilevnellacirconcisionequantaunaestremitd'uno anello,insegnochecomesposovolevasposarel'umanagenerazione)edellaamandoalcunacosafuoradilui,opadreomadre,osorellaofratelliocongiuntio ricchezzeostatidelmondo,diventaadultera,enonsposalealenfedelealspososuo.''AndseeLetter143,vol.2,pp.33738.SeealsoPrayer25:"you[God] espouseoursoulstoyouwiththeringofyourflesh[orcharity]."Noffke,Prayers,11.5052,pp.215,219n.8theItaliantexthas"charity,"theLatinhas"flesh." OnRaymond'sbowdlerization,seeCanetinFawtierandCanet,DoubleExprience,pp.24546,whopointsoutthatCatherine,likeBridgetofSweden,was devotedtotherelicoftheCircumcision.TheViennesebeguineAgnesBlannbekinwasalsodevotedtotheforeskin,afactthatcreatedscandalwhenher revelationswerepublishedintheeighteenthcenturyseeAllmang,"AgnsBlannbekin,"col.977. 136.SeeCatherineofSiena,Dialogue,ed.Cavallini,chap.13,p.37(trans.Noffke,Catherine:TheDialogue,p.50),whereshesaysGod'sIncarnationis"veiling" hisdivinityin"thewretcheddungheapofAdam."Seealsochap.98,p.234,andchap.123,p.307,whereshespeaksofsensualityas"filth." 137.CatherineofSiena,Dialogue,ed.Cavallini,chap.96,p.226trans.Noffke,Catherine:TheDialogue,p.179:"Thesoulwhohasreachedthisfinalstage[of unionwithGod]restsonthebreastofmy[i.e.,God's]divinecharityandtakesintothemouthofherholydesirethefleshofChristcrucified.Inotherwords,she followshisteachingandhisfootsteps,becauseshehadlearnedinthethirdstagethatshecouldnotfollowafterme,theFather.Fornopaincanbefallme,theeternal Father,butitcanbefallmybelovedSon....Andyoucannotwalkwithoutpain,butmustachieveprovenvirtuethroughsuffering."Seealsobelow,n.142. 138.Seethepassagesquotedabove,n.135. 139.CatherinealsolaysmuchemphasisonourcreationintheimageofGodandstressesthatthisimageisthebasisofourpossibilityofreturningtoGodCatherineof Siena,Dialogue,Cavallini,chap.12,pp.3133.Moreover,theimageisinsomesensehumanity,becausethatiswhatweandChristhaveincommon."I[God]gifted youwithmyimageandlikeness.Andwhenyoulostthelifeofgracethroughsin,torestoreittoyouIunitedmynaturewithyou,hidingitinyourhumanity.Ihadmade youinmyimagenowItookyourimagebyassuminghumanform"(trans.Noffke,Catherine:TheDialogue,p.46). 140.Vomiting,forexample,istoCatherinenotonlyabasicimageforpurgingoremptyingbutapositiveimageaswell,forthesoulthatvomitsisreadyagaintohunger for(desire)God.SeeCatherineofSiena,Dialogue,ed.Cavallini,chaps.95,151,pp.22223,437andLetter208,CatherineofSiena,Letters,ed.Misciattelli,vol. 3,p.256:"Adempiteilmiodesiderioinvoi,sicchiofaccialaPasqua,comedetto.Efatecomecoluichemoltobevecheinebbriaeperdesmedesimo,enonsi vede.Ese'lvinomolto


glidiletta,anconebevepiintantoche,riscaldatolostomacodalvino,nolputenere,esi'lvomicafuore.Veramente,figliuolo,cheinsuquestamensanoi troviamoquestovinociol'costatoapertodelFigliuolodiDio."TheletteralsocallsChrist"food,table,andservant,"discusseshungerforChristasinsatiable, andconcludesthat,byeatingChrist,wetoobecomefoodandbleedforothers. 141.See,forexample,CatherineofSiena,Dialogue,ed.Cavallini,chap.76,pp.16869trans.Noffke,Catherine:TheDialogue,p.140:"[Thesoul]runsontothe thirdstair[ofChrist],thatis,tohismouth,whereitisclearthatshehasarrivedatperfection....Nowshehasarrivedathismouth,andsheshowsthisbyfulfillingthe mouth'sfunctions.Themouthspeakswithitstongueandtastesflavors.Themouthtakeswhatisofferedtothestomach,andtheteethchewit....Soitiswiththe soul.Firstshespeakstomewiththetongueofholyandconstantprayerthatisinthemouthofherholydesire.Thistonguehasanexternalandaninteriorlanguage. Interiorly,thesouloffersmetenderlovingdesiresforthesalvationofsouls.Externally,sheproclaimstheteachingofmyTruth....Sheeatsthefoodofsoulsformy honoratthetableofthemostholycross....Andshechewsit...withhatredandlove,thetworowsofteethinthemouthofholydesire.Thereshetakesthisfood andchewsitwithhatredforherselfandloveforvirtueinherselfandinothers."SeealsoLetter208,CatherineofSiena,Letters,ed.Misciattelli,vol.3,pp.25558 Letter11,vol.1,p.44Letter340,vol.5,pp.15866andbelowatnn.146,150. 142.See,forexample,CatherineofSiena,Dialogue,ed.Cavallini,chap.92,p.213trans.Noffke,Catherine:TheDialogue,p.170:"Themoreshe[thesoul] hungers,themoresheisfilled,andthemoresheissated,themoreshehungers."AndCatherineofSiena,Dialogue,ed.Cavallini,chap.101,pp.24445trans. Noffke,Catherine:TheDialogue,pp.19293:"Thesoul[whichhasbeenofferedthepledgeofeternallife]beginstohungerfor...God...Andbecausesheis hungryshefeastsonthatcharityforherneighborswhichshesohungersandlongsfor....Sheremainsinsatiablyandcontinuallyhungry.Thus,likeapledge,this hungerisabeginningofthecertaintyIgivethesoul....WhenIsaythatthispledgeisnotperfect,Imeanthatthesoulwhoenjoysithasnotyetreachedthesortof perfectionthatwillknownosufferinginherselforinothers....Myservants[inthislife]findtheirnourishmentatthetableofholydesire,andtheyareatonceboth happyandsorrowful,justasmyonlybegottonSonwasonthewoodofthemostholycross." 143.SeeLetter208,CatherineofSiena,Letters,ed.Misciattelli,vol.3,pp.25558Letter34,vol.1,p.157Letter8,pp.3438andLetter75,vol.2,pp.2124, whichmakesitclearthat,toCatherine,hungerandthirstareinfiniteandinsatiableandthattheyrepresentreachingoutandgrasping,notwaitingpassively. 144.See,forexample,Letter227,ibid.,vol.3,p.364. 145.InCatherineofSiena,Dialogue,ed.Cavallini,chap.131,p.352,Catherinesaysexplicitlythattoeatistoserve,explainingthatpriestsadministerthebloodand takecareofsoulsandthisis"thetaskofeatingsouls." 146.Letter329,CatherineofSiena,Letters,ed.Misciattelli,vol.5,pp.1067. 147.Letter87,ibid.,vol.2,pp.9092. 148.Letter2*,ibid.,vol.6,pp.56. 149.See,forexample,CatherineofSiena,Dialogue,ed.Cavallini,chaps.14,23,


113ff.,pp.3742,5154,274ff.SeealsoLetter270,CatherineofSiena,Letters,ed.Misciattelli,vol.4,pp.19293,inwhichsheurgesthepopetobeamother tosouls. 150.Letter11,CatherineofSiena,Letters,ed.Misciattelli,vol.1,p.44. 151.Letter293,ibid.,vol.4,pp.29192. 152.SeeLetter242,ibid.,vol.4,pp.5051,andLetter296,vol.4,pp.30510.Thislatterletteractuallyusesthemetaphorofcannibalismtodescribehungerfor souls:"Epregovichepigliatequestifigliuoli,morti,insulamensadellasantissimacroce,einemangiatequestocibo,bagnatinelsanguediCristocrocifisso"(p.309). 153.Letter273,ibid.,vol.4,pp.21718:"Dolcissimopadre,l'animavostra,laqualemis'fattacibo(enonpassapuntoditempo,cheiononprendaquestocibo allamensadeldolceAgnellosvenatocontantoardentissimoamore)."Thislettergoesontomixtogetherimagesofwashinganddrinking(oreating)asdescriptionsof theeffectsofChrist'ssacrifice. 154.See,forexample,Letter262,ibid.,vol.4,p.148,andCatherineofSiena,Dialogue,ed.Cavallini,chap.110,p.265trans.Noffke,Catherine:TheDialogue, p.206:"ThepersonoftheIncarnateWordwaspenetratedandkneadedintoonedoughwiththelightofmyGodhead....AndtowhomhaveIentrustedit?Tomy ministers...sothatyoumighthavelifewhentheygiveyouhisbodyasfoodandhisbloodasdrink."SeealsoCatherineofSiena,Dialogue,ed.Cavallini,chap.135, p.373. 155.Letter266,CatherineofSiena,Letters,ed.Misciattelli,vol.4,p.175,andLetter52,ibid.,vol.1,pp.24243.Thephrasealsooccursinaletterfrom FrancescoMalavoltitoNeridiLandoccioaproofboththatCatherine'slanguageinfluencedothersandthatsuchgraphicdescriptionswerenotoffensiveto fourteenthcenturyreadersseeCanetinFawtierandCanet,DoubleExprience,p.244,andLetter40,CatherineofSiena,Letters,ed.Misciattelli,vol.6,Lettersof disciples,p.145("Pace,gaudioeletizianelSignore,condesideriodilavarelemaculcdellenostreiniquitnelsanguedelloisvenatoAgnello,arrostitopernoisullegno dellasantissimacroce").HuizingacitesasimilarphraseinaworkbyoneJeanBerthelemyseeJ.Huizinga,HerfsttijderMiddeleeuwen...(Haarlem:TjeenkWillink andZoon,1921),p.293,citingamanuscriptwork(1912)byCh.Oulmont. 156.Letter75,CatherineofSiena,Letters,ed.Misciattelli,vol.2,p.23andLetter73,p.14.AndseeCatherineofSiena,Dialogue,ed.Cavallini,chap.78,p.177. 157.SeeDrane,HistoryofSt.Catherine,vol.2,p.271andFawtierandCanet,DoubleExprience,pp.23032,268. 158.FawtierandCanet,DoubleExprience,pp.26873Gougaud,DAP,pp.75130andM.D.Chenu,"SangduChrist,"DTC,vol.14(1939),cols.109497. 159.See,forexample,Letter143,CatherineofSiena,Letters,ed.Misciattelli,vol.2,pp.33738,whereChristmarrieshumankindwiththeringoffleshofthe Circumcision,andthebloodChristshedonthecrossissaidbothtowashawaysinandtoprovideaweddingfeastfromGod'sownbody.Seealsoabove,n.153. 160.Seeabove,n.119Letter28,CatherineofSiena,Letters,ed.Misciattelli,vol.1,pp.11524andLetter2,ibid.,vol.1,pp.511. 161.Forexample,CatherineofSiena,Dialogue,ed.Cavallini,chap.14,pp.3738(ministersdrinkfromthebreastsofthechurchandserveup"themilkandblood ofthebride")chap.23,pp.5153(theyshepherdsoulsbyadministeringtheblood)chap.115,


pp.27678(thechurchisthewinecellar,whichcontainstheblood,andfromthebloodallthesacramentsderive)chap.131,pp.35254(priestsareespecially entrustedwiththetaskof"eatingsouls"becausetheyhavethe"ministryoftheblood").Drane,HistoryofSt.Catherine,vol.1,p.261,pointsouthowoftenshe referstopriestsas"chalices.'' 162.Forexample,CatherineofSiena,Dialogue,ed.Cavallini,chap.115,p.278,whereshesays:"Christonearth[i.e.,thepope],then,hasthekeystothe blood"(trans.Noffke,Catherine:TheDialogue,p.215).AndseeLetter346(toUrbanVI),CatherineofSiena,Letters,ed.Misciattelli,vol.5,p.202. 163.CatherineofSiena,Dialogue,ed.Cavallini,chap.124,pp.31314.Herlongdiscussioninchap.110,pp.26369,ofthedoctrineofconcomitanceappearsto revealsomeanxietyaboutthecrumblinessofthehost.Herinterestinthedoctrineseemstostemfromherdesiretobesureshereceivestheblood(whichisdenied her)alongwiththewafersheisregularlygiven. 164.See,forexample,ibid.,chaps.2324,pp.5156. 165.CatherineherselfdescribestheincidentinalettertoRaymondLetter273,CatherineofSiena,Letters,ed.Misciattelli,vol.4,pp.21723.SeealsoThomas AntoniideSenis,Legendaminore,pt.2,chap.7,p.94. 166.SeeBynum,JM,p.18n.25. 167.Letter215,CatherineofSiena,Letters,ed.Misciattelli,vol.3,pp.29297Letter54,vol.1,pp.24951Letter262,vol.4,pp.14550(seeesp.p.148, wherethenuptialchamberisthewoundinChrist'sside).WeshouldalsonotethatinLetter112(vol.2,pp.197202),wheresheoffersChristasasubstitutetoa marriedwomanwhohaslosttwohusbands,sheoffershimnotasbridegroombutasfood. 168.Seeabove,nn.122,125,141,143. 169.Seeabove,n.135. 170.Seeabove,n.136. 171.See,forexample,Letter205,CatherineofSiena,Letters,ed.Misciattelli,vol.3,pp.24243,andNoffke,introductiontoCatherine:TheDialogue,p.21.See alsobelow,pp.21617and26169.WeshouldnotforgetthatalthoughCatherinethinksfemininemeansweak,andvirile,strong,sheappliesbothadjectivesto bothsexesandexhortswomenaswellasmentoboldness(clearlyassumingittobeattainable).InLetter215,Catherine,Letters,ed.Misciattelli,vol.3,p.296,for example,sheexhortswomentobe"knights"instrengthanddetermination. 172.Letter30,CatherineofSiena,Letters,ed.Misciattelli,vol.1,pp.13542seealsoLetter144,vol.2,pp.34142. 173.Seeabove,atnn.12426. 174.Seebelow,pp.265,270. 175.Letter18,CatherineofSiena,Letters,ed.Misciattelli,vol.1,p.75. 176.Letter1*,ibid.,vol.6,pp.12. 177.Letter342,ibid.,vol.3,p.174. 178.Letter145,ibid.,vol.2,pp.34849. 179.Manycommentatorsnotethissee,forexample,Noffke,Catherine:TheDialogue,p.206n.3. 180.Letter208,CatherineofSiena,Letters,ed.Misciattelli,vol.3,pp.25557:"QuestalaPasquach'iovogliochenoifacciamociodivederciallamensa dell'Agnello


immancolato,ilqualecibo,mensaeservitore.Insuquestamensasonoe'fruttidellevereerealivirt....Questaunamensaforata,pienadiveneche germinanosangueetraglialtrivihaunocanale,chegittasangueeacquamescolatoconfuoco....OfigliuolodolcissimoinCristoGes,corriamocon sollicitudineaquestamensa....Equandoeglihabenebevutoedegli'lgittasopra'lcapode'fratellisuoi:edhaimparatodacoluichecontinuamenteinmensa versanonpersuautilit,mapernostra.Noidunque,chemangiamoallamensapredetta,conformandocicolcibo,facciamoquellomedesimononpernostrautilit, maperonorediDio,eperlasalutedelprossimo."Forafullertranslationofthepassageseebelow,epigraphtochapter8,andseeabove,n.140. 181.ThefundamentalworkonCatherineofGenoaremainsFriedrichvonHgel,TheMysticalElementofReligionasStudiedinSaintCatherineofGenoaand HerFriends,2vols.(London:Dent,1908),althoughvonHgelwasmisledbyhisopinionthatthe1551edition(ofManuscriptAplusadditions)ofthesaint'sworks wasthemosttrustworthytext.FormanuscriptsDandD*,todayconsideredthebestmanuscripts,seeUmileBonzidaGenova,S.CaterinaFieschiAdorno,vol.1: TeologiamisticadeS.CaterinadaGenovaandvol.2:Edizionecriticadeimanoscritticateriniani(Turin:Marietti,19611962).OnCatherine'slifeandonthe controversysurroundingtheauthorshipofherworks,seealsoUmileBonzidaGenova,"L'OpusCatharinianumetsesauteurs.Etudecritiquesurlabiographieetles critsdesainteCatherinedeGnes,"Revued'asctiqueetdemystique16(1935):35180P.Debongnie,"CatherinedeGnes(sainte),"DHGE,vol.11(1949), cols.150615idem,"SainteCatherinedeGnes,vieetdoctrine,d'aprsdestravauxrcents,"Revued'asctiqueetdemystique38(1962):40946UmileBonzi daGenovaandMarcelViller,"CatherinedeGnes(sainte),"DS,vol.2(1953),cols.290325andBenedictGroeschel,introductiontoCatherineofGenoa: PurgationandPurgatory...,trans.SergeHughes(NewYork:PaulistPress,1979),pp.167. 182.ThemostIclaimbelowthereforeisthattheimageofCatherineheldbythoseclosetoherincludedbothextravagantfoodpracticesandtheologicalsayingsin whichmetaphorsoffoodandhungerwereprominent.Theearlyprintedvita,whichIhavecitedinthe1568Florenceedition(seebelow,n.189),differsgreatlyfrom thevariousmanuscripts(seeCatherineofGenoa,ed.UmileBonzi,Edizionecritica)onthecorrelationsandlacunaeofthevariousversions,seevonHgel,Mystical Element,vol.1,pp.38890,44951. 183.Vita,chaps.15,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.10720onherconversion,fasts,andeucharisticdevotion,seevonHgel, MysticalElement,vol.1,pp.1049,11316,13537,andvol.2,pp.2840.SeealsoDebongnie,"SainteCatherine,"pp.42728. 184.ScholarshavedifferedsomewhatonthebeginningandenddatesofthisperiodoffastinganddailycommunionseeGroeschel,intro.,inHughes,Catherineof GenoaPurgation,pp.57Debongnie,"SainteCatherine,"pp.43133vonHgel,MysticalElement,vol.1,pp.10913,13537UmileBonzi,S.Caterina, vol.1:Teologia,pp.3033.Itisimportanttonotethat,whetherCatherinewastwentysixortwentynineattheonsetofthisbehaviorpattern,itwasnotan adolescentdevelopment. 185.Itissignificantthatsheexperiencedspontaneousremissionofherextravagantinedia(i.e.,ofhereffortsatextraordinarycontrolofbody)ataboutthesametime assheacceptedaspiritualdirector(i.e.,spiritualcontrolexercisedbyanotherego).


186.Debongnie,"SainteCatherine,"pp.44041,discusseswhethertheillnesswas"supernatural,"psychosomatic,orsomekindofcancer.Adiagnosisisnotpossible atthisdistance.Contemporarieswere,however,fascinatedbythefactthatshecouldswallowonlytheeucharistseeIlDialogospirituale,inCatherineofGenoa, Edizionecritica,ed.UmileBonzi,pp.43367. 187.InVita,chap.5,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.120,thereislanguagethatsuggeststhatCatherinejoinedwithChrist'sbreastand mouthinavision.Debongnie,"SainteCatherine,"pp.43031,suggeststhatthisisnotCatherine'sspirituality,forsheordinarilyinsistsonbypassingthe"humanity"of Christ,exceptforreceptionoftheeucharist.VanHgel(MysticalElement,vol.2,pp.3940)makesasimilarpointwhenhesuggeststhatCatherinedidnotreceive stigmata,despiteherpsychologicaldispositiontowardparamysticalphenomena,becauseshedidnotdisplaygreatdevotiontothehumanityofChrist. 188.SeeIlDialogosprituale,inCatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.42227trans.Hughes,CatherineofGenoa:Purgation,pp.12932. AndVita,chap.12,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.14041. 189.VitamirabileetdoctrinasantadellabeataCaterinadaGenova...[hereafterVitamirabile](Florence:Giunti,1568repr.1580),chap.41,p.137(this editionreproducesthe1551Genoeseeditionexceptforcorrectingcertaindialectforms).Inreplyherconfessorcriticizedherforworryingaboutpracticesandmotives andurgedhertosurrendercompletelytoGod:"Chiequello,chesiimpaccia,etparladimangiare,ononmangiaresottospeciedistimolotaci,taci,cheticonosco,et nonmipuoiingannare." 190.Vita,chaps.711,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.12240,andIlDialogospirituale,inibid.,pp.400,4023,40611. 191.Vitamirabile,chap.42,p.143. 192.SeeVita,chap.5,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.119,andbelow,n.196. 193.SeeVita,chap.10,CatherineofGenoa,Edizionecritica,p.135,andIlDialogospirituale,inibid.,pp.4023.Onherfamousstatement"inDioilmio essere,ilmioME,"usuallyrendered"MyMeisGod,"seebelow,chap.10n.2. 194.IlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.389. 195.Vitamirabile,chap.3,p.11trans.byMrs.G.Ripley,LifeandDoctrineofSaintCatherineofGenoa(NewYork:CatholicPublicationSociety,1875),p. 31.ButseeVita,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.6263,12122. 196.IlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.432,describingherlastillness("equandoessanonsicommunicava,restava tuttoquelgiornoaffamata,eparevachenonpotesseviveresenzaquestosacramento"),andpp.40611,wherewehaveadescription,indialogueform,ofher responsetothevisionofthebleedingJesus.Hereshestopseating,acquiresafranticneedforcommunion,andbegsGodtotakeawayallfeelings.Butatthereception ofcommunion,herhumanitycriesout:"Horaquestomodoiopotrviver!" 197.TheSpiritualDialogue,pt.2,inHughes,CatherineofGenoa:Purgation,pp.11533.HereCatherine'sdepressionbeforeherconversionisdescribedasa periodinwhichshecouldnoteatafterherconversionsheisdescribedashavingnotastefor


anythingbutloveofGod.Inthisconditionherhumanitycriesoutthatitmusthavefood,butithastroublefindingnourishmentinthatwhichsatisfiesthesoul.The communioncomesasfoodforboth,althoughSoulisworriedabouttheblissthataccompaniesitandasksGodtotake"feelings"away."OSignore,oSignore,io nonvoglioprovaalcunadite,perchnoncercosentimenti,malifuggocomedemonij,perchsonocosemoltoimpeditivealpuroamoreperchl'huomoselepu attachareconlospiritoeconl'humanitasottospeciediperfettione.Eperchl'amoredeveesserenudo,percitiprego,oSignore,anonmidarepisimilcose, perchnonfannoperme"(IlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.411). 198.IlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.42021:"Ecosfufatto,perchlamiseintantapovert,chenonpotcva vivereseDiononlehavesseprovedutoperviadielemosine.Eledisse:Acciochtutipossiesercitare,tulavoreraipervivere....Nonvogliochetumaihabbia propriaelettione,masemprefarailavolutd'altri." 199.SpiritualDialogue,pt.2,inHughes,CatherineofGenoa:Purgation,p.130IlDialogospirituale,CatherineofGenoa,EdizioneCritica,ed.UmileBonzi,p. 424. 200.Seeabove,n.188. 201.OnCatherine'suseofumanit,seeHughes,"Notesonthetranslation,"CatherineofGenoa:Purgation,p.49,andPierreDebongnie,trans.,LaGrande Damedupuramour:SainteCatherinedeGenes.14471510,vieetdoctrine...,LesEtudesCarmlitaines(Paris:DescledeBrouwer,1960),p.xxii.Forher closeassociationoffoodandbody,seeIlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.370,whereshedescribesthecapitulationof BodytoSoulasturningtothefoodofpigsandotheranimals:"esiandavaancoraleipascendodecibideporciebestiali,comeilcorpo." 202.Seeabove,n.196.ItisalsoworthnotingthatintheopeningpagesoftheDialoguefoodisCatherine'sordinarywordforgoal,i.e.,forthatwhichisdesired,and hungerortasteherusualsynonymfordesireIlDialogospirituale,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.35575.See,forexample,p.357 (SoultoBody:"Setrovassemocibochecipascessetuttidue,comefaremo?"AndBodytoSoul:"Masarebbetroppograncosachesitrovassecibochecontentasse duechehavesserogusticontrarij")andp.363(SoultoBody:"perchgustandoquestecoseterrene,dubitochemialenterilgustodellecosespirituali"). 203.Hughes,CatherineofGenoa:Purgation,pp.8182TrattatodelPurgatorio,inCatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.34344: "L'amorediDiocheridondanell'anima(secondocheiovedo),leduncontentochenonsipuesprimeremaquestocontentoaquell'animechesononelPurgatorio, nonlevaunastilladipenamapiprestoquestoamorechesitrovaritardato,quellochelefalapena,tantograndequantolaperfettionediessoamore,delquale Diol'hafattacapace.Schel'animenelPurgatoriohannocontentograndissimoepenagrandissima,el'unononimpediscel'altro." 204.Hughes,CatherineofGenoa:Purgation,pp.8283TrattatodelPurgatorio,inCatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.34445. 205.Hughes,CatherineofGenoa:Purgation,pp.7677TrattatodelPurgatorio,inCatherineofGenoa,Edizionecritica,ed.UmileBonzi,pp.33233. 206.Vitamirabile,chap.32,pp.1067trans.Ripley,LifeandDoctrine,chap.28,pp.


12930.VonHgelsaysofthischapter:"[it]isnowonelongDiscoursewhichincorporatessomeshortbutimportantauthenticsayings"(VonHgel,Mystical Element,vol.1,p.450).Thelengthydiscourseisnotintheearliestmanuscript.ItisimpossibletoknowhowmuchofitisCatherine'sownlanguage,butthe evidenceoftheTrattatodelPurgatorio(above,nn.203205)suggeststhatthebasicmetaphorisauthentic. 207.Vita,chap.27,CatherineofGenoa,Edizionecritica,ed.UmileBonzi,p.297,andinVitamirabile,chap.43,pp.14647trans.Ripley,LifeandDoctrine, chap.33,pp.14344. 208.Itistrue,asvonHgelsuggests(seeabove,n.187),thatCatherineofGenoashowednospecialdevotiontoChrist'shumanityeitheraneroticattachmenttohis body(likeHadewijch's)orasentimentalidentificationwithhislifestory(likeMargaretofOingt's)butherattachmenttotheeucharistwasadevotiontoGod encounteredthroughphysicality:bodyandblood,breadandwine.AndshewasdeeplydevotedtothesufferingofChrist'searthlybody.Moreover,someofthemost affectiveofwomenmystics(likeHadewijch)sawclearlythedangersofmeresentimentality.ThedarksideofthespiritualityofaHadewijchoraCatherineofGenoa i.e.,itsemphasisonsufferingisinpartanefforttokeeptheapproachtodivinitythroughhumanityfrombecomingmereindulgenceinpleasantfeelings. 209.EvenMargaretPorete,inrejectingthisspirituality,nonethelessdescribesitaccurately.Elaboratinga"freedom"beyondallcategoriesinsanityandwisdom, illnessandhealth,fastandfeast,loveandlossMargaretdescribesasalowerway(thereligiosityofthe"marred")aspiritualityofaffectivityanderoticism,fastingand works,prayersandeucharist.SeeRomanaGuarnieri,"II'Miroirdessimplesmes'diMargheritaPorete,"Archivioitalianoperlastoriadellapiet4(1965):513 635. 210.Formalewritinginwhich"eating"isanimportantimage,seeabove,pp.1,4,6667,74,andn.155,andGuigoIItheCarthusian,Epistoladevita contemplativa(Scalaclaustralium),chap.13,andMeditatio4,inE.ColledgeandJ.Walsh,eds.,Lettresurlaviecontemplative...DouzeMditations,SC 163,Sr.mon.29(1970),pp.11012,14246. 6 FoodAsControlofSelf 1.HildeBruch,EatingDisorders:Obesity,AnorexiaNervosaandthePersonWithin(NewYork:BasicBooks,1973),p.304. 2.SeePeggyReevesSanday,FemalePowerandMaleDominance:OntheOriginsofSexualInequality(Cambridge:CambridgeUniversityPress,1981), passim,esp.pp.7677,andGoody,Cooking,CuisineandClass,p.193. 3.Wheaton,SavoringthePast,p.22. 4.Ibid. 5.Ibid.,pp.95111,124,163,209.OnthispointseealsoPhilippaPullar,ConsumingPassions:BeinganHistoricInquiryintoCertainEnglishAppetites (Boston:Little,Brown,1970),pp.13640.Forcookbooksaddressedtowomenbefore1746,seeWheaton,SavoringthePast,p.299n.49. 6.Duby,TheKnight,theLadyandthePriest,pp.7072,106.


7.Seeibid.andBurchardofWorms,Decretum,bk.20,chap.152,PL140,cols.101213. 8.EliasCanetti,CrowdsandPower,trans.CarolStewart(NewYork:Viking,1962),p.221.Canettigoesontostressthemother'sfeedingaspower,whichhecalls "domination." 9.Wheaton,SavoringthePast,p.2. 10.NicolasdeBonnefous,LeJardinierfranois(1651),suggeststhatwomenareparticularlydrawntofruitseeWheaton,SavoringthePast,p.123.Rousseauin Emilelistsas"tastesproperfor[thefemale]sex"dairyproductsandsweets,especiallydesserts,butnotmeat,wine,orstrongliquorsseeWheaton,Savoringthe Past,p.226. 11.Forthisviewofmeat,seeJohnChrysostom,Homily27onActs,par.2,PG60,col.207(whichwarnswomenagainstwineandmeat)Aquinas,ST,II,IIae,q. 147,art.8,vol.43,pp.11417andabove,chap.2nn.2426andchap.3n.40.Itmayactuallybetruethat,forreasonsofdifferencesinmetabolism,womenneed morecarbohydratesandmenmoreproteinseebelow,n.36. 12.SeeLauraShapiro,PerfectionSalad:WomenandCookingattheTurnoftheCentury(NewYork:Farrar,StrausandGiroux,1986). 13.JoanJacobsBrumberg,"ChloroticGirls,18701920:AHistoricalPerspectiveonFemaleAdolescence,"ChildDevelopment53.6(December1982):146877. 14.Iamingeneralsuspiciousoftheoriesofreligionthatseeitasevolvingthroughvariousstages,butonesuchevolutionaryinterpretation,RobertN.Bellah's "ReligiousEvolution"(AmericanSociologicalReview29[1964]:35874),isusefulinpresentingabriefandclearstatementoftheideathattheMiddleAgeswasthe periodofWesternreligioninwhichworldrejectionasavaluewasatitsheight. 15.MacCullough,"Fasting,"p.763. 16.SeeBarronHolland,comp.,PopularHinduismandHinduMythology:AnAnnotatedBibliography(Westport,Conn.:Greenwood,1979),pp.12021.Iam gratefultoJohnS.HawleyoftheUniversityofWashingtonforthisinformationandreference. 17.Rogers,Fasting,p.77.Goody,Cooking,CuisineandClass,p.118,says,"whereasmen'sfastsaremostlydirectedtowardimprovingorupholdingtheirown purityandspiritualstatus,thefastsofwomenarelargelyaimedatenhancingandmaintainingauspiciousnessfor'thesocialcollective,'thatis,forthefamily." 18.Gougaud,DAP,pp.14758Loomis,WhiteMagic,p.130FredNorrisRobinson,"NotesontheIrishPracticeofFastingasaMeansofDistraint,"Putnam AnniversaryVolume(CedarRapids,Iowa:TorchPress,1909),pp.56783(cataloguedseparatelyinWidenerLibrary).TheIrishtraditionalsoshowscasesof fasting"upon"or"against"bothGodanddevilseeibid.,pp.57880. 19.Rogers,Fasting,passim,esp.pp.7176. 20.Thefastingofthesuffragettes(seeibid.,pp.8388)was,ofcourse,aselfconscioususeofthehungerstrikebywomenforpoliticalgoals.Butbeforethemodern periodorganized,selfconsciousgroupstarvationbywomenseemsnottohavebeenusedasaweapontogainpoweroverothers.Thesources,however,doprovide occasionalsuggestionsofrebellionagainstauthoritiesbyrefusaltoeat.See,forexample,ClareofAssisi'sthreatthatsheandhersisterswillnoteatifthepoperefuses toprovidepreaching(above,chap.3atn.185)andthecaseofCecilyRidgeway,whoin1357fastedand


remainedmuteforfortydaystoavoidpleadinginamurdertrialGerish,introductiontoTheHartfordshireWonder,p.5,andRollins,"NotesonSomeEnglish Accounts,"p.360.AparticularlyinterestingexampleoccursintheLifeofUmilt,chap.2,par.13,AASSMay,vol.5,p.210,whereUmiltimprisonsoneofher nunsfornotdoingherassignedjobproperly,andthewomanrefusestoeat. 21.OnMary,seeBolton,"VitaeMatrum,"pp.25759onClare,seeBrookeandBrooke,"St.Clare,"pp.27587.AndonthispointgenerallyseeBynum, "Women'sStories,Women'sSymbols." 22.LifeofChristinatheAstonishing,chap.2,par.22,AASSJuly,vol.5,p.654. 23.MuchoftheevidencetowhichIshallmakepassingreferenceinchapters6to8hasbeenextensivelyexploredinchapters3to5aboveIhavenotrepeated documentationthathasbeenprovidedelsewhere.Hence,ifnofootnoteisgiven,thereadermayexpecttofindspecificreferencesbyturningtotheearlierdiscussionof thesaintinquestionorbyusingtheindex.OnMargeryKempe,seebelow,chap.7n.1. 24.Schadewaldt,"MedizingeschichtlicheBetrachtungen,"pp.114,esp.p.10.Themodernclinicaldefinitionofanorexianervosawasframedinthenineteenth centuryseeBrumberg,"'FastingGirls.'"SchadewaldtdiscussesearlierGermanliteratureonthehistoryofextendedinediathatisnotreadilyavailableinthiscountry. 25.JohnPutnamDemos,EntertainingSatan:WitchcraftandtheCultureofEarlyNewEngland(NewYork:OxfordUniversityPress,1982),pp.16465,has arguedthatsomewitches'victimsatSalemwereanorectic.Thurston,PP,passim,suggestsmodernpsychiatricdiagnosesofanumberofearlymiraculousabstainers, stigmatics,etc.WeinsteinandBell,SS,p.235,callthesixteenthcenturyFlorentinevisionaryMaryMagdalende'Pazziananorectic. 26.J.HubertLacey,"AnorexiaNervosaandaBeardedFemaleSaint,"BritishMedicalJournal285(1825December1982):181617.SeealsoDelehaye, Legends,pp.10910. 27.Seeabove,chap.3atnn.410.Thurston,whodefendsasatleastpossiblysupernaturallycausedcertainverybizarrephenomena,says(PP,p.365):"JustasI shouldliketohearofastigmaticwhohadnobadfamilyhistoryandhadalwaysherselfbeenathoroughlyhealthysubject,freefromneurosesofanykind,sointhe considerablelistofthoseholypeoplewhoarereportedtohavelivedforlongperiodswithnoothernourishmentbuttheBlessedSacrament,onelooks,butlooksin vain,forthenameofonewhowasfreefromstrangeinhibitionsinthematterofdietandwhomtheneuropathspecialistwouldhavepronouncedtobeperfectlysound andnormal." 28.See,forexample,BenedictJ.Groeschel,introductiontoHughes,CatherineofGenoa:Purgation,p.11,andPetroff,Consolation,p.41.RudolphBell,Holy Anorexia,arguesforananorectictypeoffemalesaintinthelaterMiddleAgesBellusesmodernpsychologicalmodels,althoughheiscarefultopointoutdifferences betweenthelateMiddleAgesandthetwentiethcentury.Seeabove.Prefaceandchap.5n.61. 29.Brumberg,"'FastingGirls,'"andZilboorg,MedicalPsychology. 30.IlzaVeith,Hysteria:TheHistoryofaDisease(Chicago:UniversityofChicagoPress,1965),passim,esp.pp.5675GregoryZilboorg,TheMedicalManand theWitchduringtheRenaissance(Baltimore:JohnsHopkins,1935),p.58ThomasS.Szasz,TheManufactureofMadness:AComparativeStudyofthe InquisitionandtheMentalHealthMovement(NewYork:HarperandRow,1970),pp.68ff.


31.Seebelow,Epilogue. 32.TheoppositekindofcaseispresentedinthevitaeofLutgardofAywiresandJulianaofCornillon,wherethesaintscurewomenwhocannotfastseeThomasof Cantimpr,LifeofLutgard,bk.2,chap.2,pars.1920,25,AASSJune,vol.4,pp.200201LifeofJuliana,bk.2,chap.9,AASSApril,vol.1,p.475. 33.Seeabove,chap.4nn.135,160. 34.Seeabove,chap.3atnn.12527.Browe,DieWunder,p.54n.23,describesawomaninthedioceseofMetzinthemidthirteenthcenturywhoclaimed stigmataandmiraculousinediaandwasunmaskedasafraud. 35.SeeHarrisonG.PopeandJamesHudson,NewHopeforBingeEaters:AdvancesintheUnderstandingandTreatmentofBulimia(NewYork:Harperand Row,1984).Foragoodsummaryofthevarioustheories,seeElissaEly,"RxforBulimia,"HarvardMagazine(NovemberDecember1983):53ff.Recentpopular booksonanorexianervosaincludeKimChernin,TheObsession:ReflectionsontheTyrannyofSlenderness(NewYork:HarperandRow,1981)Janice Cauwels,Bulimia:TheBingePurgeCompulsion(GardenCity,N.Y.:Doubleday,1983)MarleneBoskindWhiteandWilliamC.White,Jr.,Bulimarexia:The BingePurgeCycle(NewYork:Norton,1983)R.L.Palmer,AnorexiaNervosa(NewYork:Pelican,1981)andSusieOrbach,FatIsaFeministIssue(New York:Berkley,1980). 36.See"AppendixB:SexDifferencesinDeath,DiseaseandDiet,"inKatharineB.HoyengaandK.T.Hoyenga,TheQuestionofSexDifferences:Psychological, CulturalandBiologicalIssues(Boston:Little,Brown,1979),pp.37290,andAnneScottBeller,FatandThin:ANaturalHistoryofObesity(NewYork: Farrar,StrausandGiroux,1977).Alreadyinthetwelfthcentury,Heloisearguedthat"Natureherselfhasprotectedoursexwithagreaterpowerofsobriety.Itis indeedknownthatwomencanbesustainedwithlessnourishment,andatmuchlessexpense,thanmen."SeeDronke,WW,p.132. 37.AnneWaltneroftheUniversityofUtah,inherunpublishedpaper"T'anYangtzu:AMingDynastyAvataroftheQueenMotheroftheWest,"hasuncovered importantevidenceofanorexialikebehaviorinsixteenthcenturyChina.AndpresentdayIndiapresentsparallelcasesseebelow,n.101.Isuspectthatasmore workisdoneonfemalepietyinvariousreligioustraditions,crossculturalevidenceforthegreaterpropensityofwomenforselfstarvationwillgrow.Suchevidence strengthensthecaseforsomephysiologicalbasistoeatingbehaviorbutdoesnotproveit,becausecertainpredisposingculturalfactorsarealsopresentinthesocieties inquestion,especiallytheassumptionthatwomanisfoodpreparerandnurturer. 38.Onthespreadofanorexia,seeA.H.Crispetal."HowCommonIsAnorexiaNervosa?APrevalenceStudy,"BritishJournalofPsychiatry128(1976):549 54MayDuddle,"AnIncreaseinAnorexiaNervosaintheUniversityPopulation,"BritishJournalofPsychiatry123(1973):71112HildeBruch,"Anorexia Nervosa:TherapyandTheory,"AmericanJournalofPsychiatry139.12(December1982):153138.Recentjournalisticaccountsinclude"Anorexia:TheStarving DiseaseEpidemic,"U.S.NewsandWorldReport(August30,1982):4748and"ADeadlyFeastandFamine,''Newsweek(March7,1983):59ff.Seealsobelow, Epilogue,n.5.Forfurtherdiscussion,seeBrumberg,"'FastingGirls.'" 39.TheculturalinterpretationpresentedbyrecentauthorssuchasCherninand


Orbach(seeabove,n.35)is,however,muchtoolimited,focusingasitdoesalmostexclusivelyonmessagesprovidedbythemediaandonculturalnotionsof femalethinnessasbeautyratherthanonbroadervaluessuchasnotionsofwomen'sroleandoffamily.Seebelow,n.51. 40.Seeabove,chap.3atnn.128133. 41.WeinsteinandBell,SS,pp.23435Benz,DieVision,pp.1734. 42.LifeofSerafinaorFinaofSanGimignano,AASSMarch,vol.2(Paris,1865),pp.23238seealsoAdoneTerziariol,"FinadiSanGimignano,"BS,vol.5,cols. 81011. 43.LifeofVillana,AASSAugust,vol.5,chap.1,pars.1112,pp.86667VitaBeatricis,passim,esp.p.64LifeofMargaretofYpres,inMeersseman,"Frres prcheurs,"pp.12526.OnGertrude,seeBynum,JM,pp.192,253n.295.SeealsoLifeofMaryofOignies,bk.1,chap.4,par.40,AASSJune,vol.5,p.556, andbelow,n.72.ForMargaretofOingt'soffertobecomealeperifGodsowilled,seebelow,chap.8n.31.Onthepatientbearingofillnessbymaleandfemale saintsinthefourteenthcentury,seeKieckhefer,UnS,pp.5758. 44.Processofcanonization,art.33,inJacquesCambell,ed.,EnqutepourleprocsdecanonisationdeDauphinedePuimichel,comtessed'Ariano (&dagger26XI1360)(Turin:Erasmo,1978),p.52:"aceciamdicebat,etdicereconsuevit,quodsigenteshuiusmundiconsiderarentquantumcorporalesinfirmitates suntutilesetquantumseparantanimumabamoreterrenorum,ipsasinfirmitatescorporeas,siessetpossibile,inforoemerentsicutemuntresaliasnecessariasad vivendum."OnDauphine,seealsoJacquesCambell,ed.,ViesoccitanesdesaintAuziasetdesainteDauphine,avectraductionfranaise,introductionetnotes (Rome:PontificiumAthenaeumAntonianum,1963)andKieckhefer,UnS. 45.Julian,longtext,chaps.24,BookofShowings,ed.ColledgeandWalsh,vol.2,pp.28598trans.ColledgeandWalsh,JulianofNorwich:Showings,p. 181. 46.Seebelowatnn.8190. 47.Thurston,PP,pp.69,9599,123. 48.Ibid.,pp.13539,202,22232.Onmyroblytes,seebelow,n.85,andchap.9n.75. 49.Fortheemergenceofanorexianervosaasadiagnosisinthenineteenthcentury,seeBrumberg,"'FastingGirls.'"Forasophisticateddiscussionofdisease categoriesasculturalconstructs,seeCherylRitenbaugh,"ObesityasaCultureBoundSyndrome,"Culture,MedicineandPsychiatry6(1982):2336,esp.27. 50.Foranorexianervosaasthe"relentlesspursuitofthinness,"seeHildeBruch,"ThePsychiatricDifferentialDiagnosisofAnorexiaNervosa,"inMeyerand Feldmann,eds.,Anorexianervosa,pp.70,75,andBruch,EatingDisorders,pp.238,267. 51.Thinnessandpalenessweresometimesvaluedassignsofasceticpractice(seeVauchez,LaSaintet,p.226,andabove,chap.3n.67),althoughhagiographers werealsosometimesconcernedtodemonstratethatthebodiesofsaintswerenotemaciatedbecausetheyweretrulyfedbytheeucharist(seeabove,chap.4atn. 108).Inanycase,suchreferencestobodysizeandskincolorhadnothingtodowithnormsofbeauty.See,forexample,RobertofAuxerre'sdescriptionofAlpasof Cudotinhischronicleaccountfortheyear1180,whichsaysthatherbodywas"witheredandthin""butshewasstillfatandbeautifulinherface"(AASSNovember, vol.2,pt.1[Brussels,1894],p.167).ThusSchadewaldt,"MedizingeschichtlicheBetrachtungen,"p.11,seemstooversimplifywhenhesuggeststhatlatemedieval peopledesiredtobethinasasignofsanctity.


52.Bruch,"DifferentialDiagnosis,"p.70. 53.MaraSelviniPalazzoli,SelfStarvation:FromIndividualtoFamilyTherapyintheTreatmentofAnorexiaNervosa,trans.A.Pomerans(NewYork: Aronson,1978),p.86.SeealsoBruch,EatingDisorders,p.267.ForamoreFreudianapproach,seeHelmutThom,AnorexiaNervosa,trans.G.Brydone(New York:InternationalUniversitiesPress,1967). 54.SeePalazzoli,SelfStarvationBruch,EatingDisordersidem,TheGoldenCage:TheEnigmaofAnorexiaNervosa(Cambridge,Mass.:HarvardUniversity Press,1978)SalvadorMinuchin,BerniceL.Rosman,andLesterBaker,PsychosomaticFamilies:AnorexiaNervosainContext(Cambridge,Mass.:Harvard UniversityPress,1978).Bruchsays,forexample:"Thoughanorexicpatientsmaydiefromtheircondition,itisnotdeaththeyareafterbuttheurgentneedtobein controloftheirownlivesandhaveasenseofidentity"(EatingDisorders,p.269). 55.Veith,Hysteria,esp.p.viiiandWenShingTsengandJohnF.McDermott,Jr.,Culture,MindandTherapy:AnIntroductiontoCulturalPsychiatry(New York:Brunner/Mazel,1981),pp.23,276. 56.Seeabove,chap.4atn.102,chap.5atn.50.OnLukardisofOberweimar,seechap.4atn.115.TheeditorofBeatriceofNazareth'slifepointsouttheparallel (VitaBeatricis,p.154).ThemodernfastinggirlSarahJacobsexperiencedsimilarsensationsseeFowler,WelshFastingGirl,p.32. 57.Thurston,PP,pp.12425Rogers,Fasting,p.15Fowler,WelshFastingGirl,pp.56. 58.Seebelow,chap.8nn.47,48. 59.LifeofIdaofLouvain,bk.2,chap.6,AASSApril,vol.2,p.178.Inbk.2,chap.2,p.172,thehagiographerreportsanoccasiononwhichshegrabbedthehand ofapriestholdingthehostandcovereditwithkisses.Thepriest,saysthehagiographer,fearedshewasinsane,butheacquiesced.IdaofLaushowedsimilar eucharisticmadnesssee,forexample,hervita,chap.4,par.31,AASSOctober,vol.13,pp.11617.Herhagiographercallsherbehaviorinsanityseechap.3,par. 24,p.114.LudolfofSaxony,VitaJesuChristi...,ed.L.M.Rigollot,4vols.(Paris:Palm,1870),pt.2,chap.58,par.1,vol.4,p.456,tellsofanunwhofellto thegroundwheneversheheardthePassionstory.PhilipofClairvauxcallsElizabethofSpalbeek'secstasiesimbecillitasLifeofElizabeth, Bruxellensis,vol.1,pt.1,p.364. 60.Weshouldnote,however,thatthesewomen,likethetwentiethcenturymysticandanorecticSimoneWeil,oftendevelopedmovingandsophisticatedtheoriesthat gofarbeyondthefoodrelatedandselfabsorbedcasuistryofmodern"patients."MaryofOignies,LutgardofAywires,Hadewijch,BeatriceofNazareth,Angelaof Foligno,MechtildofMagdeburg,CatherineofSiena,andCatherineofGenoaseemtohaveelaboratedoutoftheirownselfdoubtandhungerbothacomplex theologyofsubstitutioninwhichtheirsufferingsredeemedtheevilofaworldforwhichtheyfeltresponsibleandamysticaldoctrineofannihilationofselfintheblinding loveofGod. 61.ThisdiagnosisofDorothy'spersistentsoresissuggestedbyKieckhefer,UnS,p.27n.14,afterconsultationwithDr.AnnJohnston,M.D. 62.OntheCarnegieInstitutetests,seeRogers,Fasting,pp.12532.JoanJacobsBrumberginherunpublishedpaper"NineteenthCenturyMedicineandthePublic Debateover'Anorexia,'"deliveredattheSixthBerkshireConferenceontheHistoryof


Women,June13,1984,pointedoutthedifficultyofdistinguishing,inearlycasereports,betweenthesecondaryresultsofstarvationorofdiseaseandadisease entityitself. 63.ConsiderationssuchasthesehaveledBrumbergtoargueagainsttheuseofthetermanorexianervosabeforethelatenineteenthcentury,whendoctorsdefinedit asadiagnosticcategory.Shesuggeststhatthemostthehistorianisentitledtospeakofbeforethatdateis"anorexialike"behavior.See"'FastingGirls.'" 64.Individualisticexplanationscan,however,bemisleadingiftheyobscuretheextenttowhichaparticularbehavioriscopiedorlearnedfromothersaspartof appropriateconductratherthanwellingupfrominnerspringsoftrauma.Forexample,HopeWeissman'srecentefforttocharacterizeMargeryKempe'sweepingas "hysteria"seemslessconvincingwhenonerealizeshowverycommon,inthebehaviorofbothmenandwomen,suchweepingwasinthefourteenthcentury"Margery KempeinJerusalem:HysteriaCompassiointheLateMiddleAges,"inM.J.CarruthersandE.D.Kirk,eds.,ActsofInterpretation:TheTextinItsContext, 7001600,Essays...inHonorofE.TalbotDonaldson(Norman,Okla.:Pilgrim,1982),pp.20117.Seealsoabove,chap.5n.121. 65.Seeabove,epigraph. 66.Itishardtothinkofamajorrecentworkthattakeswomen'sexperienceseriouslythatdoesnotassumethis.See,forexample,Vauchez,LaSaintetWeinstein andBell,SS,andDuby,TheKnight,theLadyandthePriest.ReneWatkinsin"TwoWomenVisionariesandDeath:CatherineofSienaandJulianofNorwich," Numen30.2(1983):17498,says,"Itisdisturbingtonoticethat,incontent,thelineofdevelopmenttowhichwomencontributedwasevenmoredualisticandanti intellectualthanmedievalChristianityingeneral"(p.183).Butseebelow,Epiloguen.11. 67.Forexample,suchajudgmentaltonetowardwomen'sspiritualitymarsthefineintroductioninJulian,BookofShowings,ed.ColledgeandWalsh.Even Kieckhefer,UnS,sometimesfeelsimpelledto'judge'hissubjectsasbalancedorunbalanced. 68.Seetheworkscitedinn.30above,esp.Szasz,Manufacture. 69.See,forexample,Koch,FrauenfrageSheilaDelany,"SexualEconomics,Chaucer'sWifeofBath,andTheBookofMargeryKempe,"MinnesotaReviewn.s. 5(Fall1975):10415andabove,chap.2n.72. 70.Forthelattertendency,seeLeclercq,"MedievalFeminineMonasticism,"pp.6566E.McLaughlin,"'ChristMyMother'"andidem,"Women,Powerandthe PursuitofHolinessinMedievalChristianity,"inWomenofSpirit:FemaleLeadershipintheJewishandChristianTraditions,ed.RosemaryRuetherandEleanor McLaughlin(NewYork:SimonandSchuster,1979),pp.10030. 71.Itisnot,ofcourse,merelywomen'sasceticismthathasbeenseenasmasochism.Forexample,CarlMounter("Guilt,Martyrdom,"p.145)claimsthatmartyrsand asceticsgenerallyexhibit"atavisticformsofaggression,exhibitionismandselfhatred." 72.See,forexample,Tss,pp.37,5051.Oneofthesisterscomposedapoemthatsaid:"Iesiecherdubist,ielieberdumirbist"(p.37). 73.Forinsanity,seeabove,n.59.Forselfmutilationseechap.4atnn.35,119,andseebelow,n.77. 74.Onwomen'sasceticismasmorevirulentthanmen's,seeWeinsteinandBell,SS,pp.23335. 75.LifeofAlda,chap.2,AASSApril,vol.3,pp.47374.


76.JohnMarienwerder,Vitalatina,ed.Westpfahl,bk.2,chap.5,pp.6871seeKieckhefer,UnS,p.26. 77.LifeofJaneMaryofMaill,chap.5,par.34,AASSMarch,vol.3,p.741.ClareofRimini(d.1346)hadherselfboundtoapillarandbeatenonHolyThursday seeVauchez,LaSaintet,p.231.ChristinaofSpoleto(d.1458)perforatedherfootwithanailseeLifeofChristinaofSpoleto,chap.1,par.1415,AASS February,vol.2(Paris,1864),p.801.FortheextremeasceticismandimitatiocrucisofHedwigofSilesia,seeVauchez,LaSaintet,pp.43233. 78.MechtildofHackeborn,Liberspecialisgratiae,bk.5,chap.30,pp.36566. 79.LifeofChristinatheAstonishing,AASSJuly,vol.5,pp.63760andseeBolton,"VitaeMatrum,"p.263. 80.LifeofLukardis,AB18,p.312. 81."Unterlinden,"pp.34042. 82.IdaofLouvain,Lukardis,GertrudevanOosten,andElsbetAchler,forexample,supposedlyreceivedstigmatawhichappearedanddisappearedperiodically.Rita ofCasciareceivedarunningsoreonherforehead(supposedlyimitatingChrist'swoundfromthecrownofthorns)whichhealedwhenshewishedtotraveltoRome andreappearedonherreturn.JaneMaryofMaill'sselfinflictedthornwoundhealedafterlongdurationandleftnoscar.Theseparticularwomenarediscussed above.Onstigmata,seeThurston,PP,passimImbertGourbeyre,StigmatisationDebongnie,"Stigmatisations"andAmann,"Stigmatisation."Thurston,Amann,and DebongniehavebeenverycriticalofImbertGourbeyre,whostandsconvictedofinaccuracyandcredulitybutIammoreinterestedinthetypesofstoriesmedieval peoplewerewillingtotell(towhichImbertGourbeyreisagoodguide)thaninthephysicalorhistoricalbasisofthestory.ThisdoesnotmeanIwishtoignorethe distinction,raisedbyscholarssuchasThurston,betweencaseswelldocumentedenoughtosuggestthatphysicalmarksactuallyappearedandcasesofinterior(or virtuallyundocumented)"stigmata"nordoIignorethedistinctionbetweenthecasesforwhichwecan,atthepresentmoment,suggestaphysicaloremotionalcause (i.e.,selfinducedwoundsorhysteria)andcasesforwhichwecannot.Insomeinstances,however,itseemstomethatscholarshaveintroducedanachronistic categoriesinworryingaboutthedistinctionbetweennaturalandsupernaturalcausation.WhenDebongnie,forexample,expressesscornatDorothyofMontau's stigmatabecauseshewasafflictedwithadiseasethatproducedsoresonherbody,heignoresthefactthatstigmatameantwoundormark.Seeaboveatnn.7481 andseen.61. 83.AredcirclewitharedlozengeinthecenterappearedanddisappearedonthefingerofCatherinedeRicci(d.1589).CatherineofGenoa'sarmwasmiraculously lengthened,andDoucelineofMarseillesfloatedmanyfeetoffthegroundinecstasy.SeeThurston,PP,passim,esp.pp.139,200. 84.OnGertrude,seeBynum,JM,p.192onClare,seebelow,chap.8n.50.Threepreciousstones,withimagesoftheHolyFamilyonthem,weresupposedly foundintheheartofMargaretofCittdiCastelloafterautopsyseeabove,chap.4n.212.AccordingtoWeinsteinandBell,SS,p.229,womenprovide27percent ofwonderworkingrelicsfromthemedievalperiod,althoughonly18percentofthesaintswerefemale. 85.Forlistsofmyroblytes,seeThurston,PP,pp.26870Jones,SaintNicolasofMyra,pp.14453Huysmans,Lydwine,pp.28891(which,however,provides nodocu


mentation)andNicoleHermannMascard,LesReliquesdessaints:Formationcoutumired'undroit,Socitd'HistoireduDroit:collectiond'histoire institutionnelleetsociale6(Paris:EditionsKlincksieck,1975),pp.6869.(IhavebeenunabletoconsultthelistinM.D.Marchand,"Aspectsconomiquesdu cultedesreliquesduXIeauXIIIesicle,"MmoiredematrisedposlaSorbonneen1969,p.18.)Femalesaintsfrombefore1600whowerebelievedto exudeoilorcuringliquidinlifeorafterdeathare:CatherineofAlexandria,Walburga,LutgardofAywires,ChristinatheAstonishing,HedwigofSilesia,Elizabeth ofHungary,AgnesofMontepulciano,MargaretofCittdiCastello,RoseofViterbo,MatthiaofNazarei(d.1300?),andEustochiaofPadua(d.1469).Male myroblytesare:theapostleAndrew,NicholasofMyra,JohntheAlmoner(d.612),Bercharius(d.685),Willibrord(d.739),Wunebald(d.761),KingRichard (d.722),Gundechar(d.1075),BishopHughofLincoln,WilliamofYork(d.1154),JohnofBeverly(d.721)andRobertGrosseteste.ThetombofLambertof Vence(d.1154)supposedlyexudedcuringwaterseeAASSMay,vol.6(Paris,1866),p.455.AlthoughIcanclaimnocompletenessforthislist,itisinteresting thatwomenarealmost50percent,althoughofcoursewehaveinformationaboutfewerholywomenthanholymen.Itisalsoworthnotingthatmanyofthemale myroblytescomefromanearlyperiod,inwhichvirtuallyallsaintsweremale.Insomecases(forexample,thoseofCatherineofAlexandria,NicolasofMyra,John ofBeverly),theprodigyisreportedforthefirsttimehundredsofyearsafterthedeathdate. 86.SeeThurston,PP,pp.22232.Itappears,however,thatthereisnopreponderanceoffemalesamongsaintswhosebodiesdisplaybloodprodigiesafterdeath: pp.28393.Seealsoabove,n.84.Theinterestoflatemedievalhagiographersinincorruptibilityasasignofsaintlinesswascertainlyheightenedbytheplague pandemicofthefourteenthandfifteenthcenturies.Periodicoutburstsofplague(betweenfiveandtwelveyearsapart)meantthateverygenerationexperiencedtimes whenthesmellandsightofrottingcorpseswereubiquitous.Peoplethereforeneededtobeabletogivesomereligioussignificancetothefactofputrefaction,butthey didthisincomplexways.SeeGottfried,BlackDeath,pp.9192,andmybriefdiscussionin"DiseaseandDeathintheMiddleAges,"Culture,Medicineand Psychiatry8(1985):97102. 87.Thelargenumberofcuressupposedlyeffectedbythewashwaterofsaintsisaphenomenoncloselyrelatedtotheseholyexudings.Waterinwhichalivingholy personorasaint'srelicshadbeenwashedwasoftenbothusedasamedicineandheldinawealmostasifitwerearelicitselfseeHermannMascard,LesReliques, p.274n.21.InacaselikethatofMargaretofHungary(seeabove,chap.4n.147),thefactthatthesaint'sskin,dandruff,andlicefloatedinthewatermayhavebeen seenasincreasingitsefficacythiswouldsuggestthatthewaterwasviewedasanextensionofthebody. 88.Seeabove,chap.4n.231. 89.Rollins,"NotesonSomeEnglishAccounts,"pp.36364. 90.LifeofLukardis,chaps.712,27,AB18,pp.31417,353. 91.Seeabove,nn.82,84,85,87. 92.SeeBridgett,HistoryoftheHolyEucharist,vol.1,pp.18182.InGaul,fromtheearlyMiddleAgeson,womenwereprohibitedfromreceivingthehostwith barehandsseeJosephA.Jungmann,TheMassoftheRomanRite:ItsOriginsandDevelopment


(MissarumSollemnia),trans.BrunnerandRiepe,onevol.abridgeded.(NewYork:Benziger,1959),p.510. 93.Vauchez,LaSaintet,p.406.AndseeWeinsteinandBell,SS,pp.3336. 94.ThomasofCantimpr,LifeofLutgard,bk.1,chap.2,par.21,pp.19495,andbk.1,chap.1,par.12,p.193. 95.See,forexample,ViedeDouceline,chap.9,pars.910,p.76. 96.Inaveryperceptivearticle,ClaudeCarozzi,"Doucelineetlesautres,"LaReligionpopulaireenLanguedocduXIIIesiclelamoitiduXIVesicle,Cahiers deFanjeaux11(Toulouse:Privat,1976),pp.25167,haspointedoutthatpopularpietyandDouceline'sownpsychologytendedbothtomakeherintoabody(i.e., ahealingrelic)whilestillaliveandtoinduceinheranextraordinaryfearofbodiliness. 97.ViedeDouceline,chap.1,par.6,pp.68.Thetextmakesitquiteclearthathismalenessistheproblem:"Elemalautzrequeslipergrannecessitatqueliera,li meneslamanperlascostas.Eilliadoncscanthoauzi,enferezitotadegranvergonhaedegranhonestat,eestetensidelueinh,pensansihofaria:carerahoms." 98.Ibid.,chap.6,pars.45,p.50. 99.McDonnell,Beguines,pp.35455. 100.ItishardlysurprisingthatLutgard,avictimofattemptedrape,shouldfeelanesthetizedwhenkissed,overherprotests,byaman(evenifhewereanabbot).Nor isitsurprisingthatthe"mouth"and"breast"ofChristshouldfigurecentrallyinhervisions,providingpartialhealingforherpainfulexperiencesofthemouthsofmen.On touchinLutgard'sLifeseeCawley,"LifeandJournalofLutgard,"pp.2048.Carozzi,''Douceline,"pointsouthowtouchingChristtransformedDouceline'sfearof bodilycontactintoalmostobsessiveconcernforhealingthesick,towhichactivitysheaggressively(andsometimesrepressively)forcedherfollowers.Foranexample of"erotic"contactwithChristsubstitutingforandcuringordinarylust,seethepassagefromtheLifeofChristinaofMarkyatecitedbelow,chap.8n.7.Columbaof Rieti,likeLutgard,experiencedattemptedrapeandherbodywentrigidinresponseseeLifeofColumba,chap.8,AASSMay,vol.5,pp.169*170*.Shelater experiencedbothtrancesinwhichherbodybecamerigidandacutesexualtemptationseeabove,chap.4n.224,andBell,HolyAnorexia,chap.6. 101.See,forexample,theaccountofthecontemporaryholywoman"SatiMata"byGabrieleVenzky,"WennIndiensFrauenSatimachen,"DieZeit,October29, 1982,p.64. 102.Seeabove,chap.3n.123. 103.ThomasofCantimpr,LifeofLutgard,bk.2,chap.2,par.21,p.200PeterofVaux,LifeofColetteofCorbie,chap.9,par.61,AASSMarch,vol.1,pp. 55455LifeofColumbaofRieti,chap.13,par.122,p.188*.SeealsoPhilipofClairvaux'scommentsonElizabethofSpalbeek,above,chap.4n.55. 104.SeeWood,"Doctors'Dilemma,"pp.71027.Andseebelow,chap.7atnn.6971. 105.AlberttheGreat,DeanimalibuslibriXXVInachderClnerUrschrift,vol.1,BeitrgezurGeschichtederPhilosophiedesMittelalters:Texteund Untersuchungen15(Mnster:Aschendorff,1916),bk.9,tract.1,chap.2,p.682.HildegardofBingen,


Hildegardiscausaeetcurae,ed.P.Kaiser,BibliothecascriptorumgraecorumetromanorumTeubneriana(Leipzig:Teubner,1903),bk.2,pp.1023, commentsthatthemenstrualflowofvirginsislessthanthatofnonvirgins.Shedoesnotrelatethistodietitmay,however,havebeenanempiricallysound observationbecauseoftheeffectsofrestrictedfoodintakeonthenunssheobserved. 106.Seeabove,chap.2atnn.2126,chap.3atnn.4042,andbelowatnn.11620. 107.LifeofAlda,chap.2,pars.1014,pp.47374. 108.WeinsteinandBell,SS,pp.23436. 109.See,forexample,theSpeculumvirginumdiscussedinMatthusBernards,SpeculumVirginum,p.129. 110.Seeabove,introductionatnn.10,12,andchap.4atn.185. 111.SeeWeinsteinandBell,SS,pp.2425. 112.Vauchez,LaSaintet,p.445,arguesthattheattitudeofhagiographersandprelatestowardmarriagebecamemorenegativeafterthethirteenthcentury. 113.WeinsteinandBell,SS,pp.9394. 114.Ibid.,pp.3940,8889Vauchez,LaSaintet,p.445n.506. 115.WhenClare'ssisterAgnestriedtofleeherfamily,shewasbadlybeatenbyherkinsmen:ThomasofCelano,LifeofClareofAssisi,pars.2426,inPennacchi, Legenda,pp.3337.Theauthorofthenuns'bookofUnterlindentellsanevenmoregruesomestoryofawomantorturedbyherhusband:"Unterlinden,"pp.37475. 116.JohnClimacus,Scalaparadisi,gradus14,PG88,col.869(seealsocols.87172). 117.Seeabove,chap.2n.23. 118.ApophthegmataPatrum,SayingsofDaniel,par.4(95),PG65,col.155bquotedandtrans.Musurillo,"AsceticalFasting,"p.31. 119.JohnChrysostom,Homily27onActs,par.2,PG60,col.207.Andseeabove,n.11. 120.PeterDamian,Opusculum32:DeQuadragesimaetQuadragintaduabusHebraeorummansionibus,PL145,cols.54344PetertheChanter,Verbum abbreviatum,chap.134,PL205,col.329. 121.SeeKariElisabethBrresen,SubordinationandEquivalence:TheNatureandRoleofWomeninAugustineandThomasAquinas,trans.CharlesH. Talbot(Washington,D.C.:UniversityPressofAmerica,1981)JuliaO'FaolainandLauroMartines,eds.,NotinGod'sImage(NewYork:HarperandRow,1973), whichsometimesmisleadsbyquotingoutofcontextBullough,"MedicalandScientificViews"RosemaryRuether,"MisogynyandVirginalFeminism"McLaughlin, ''EqualityofSouls"JoAnnMcNamara,"SexualEqualityandtheCultofVirginityinEarlyChristianThought,"FeministStudies3.3/4(1976):14558M.Th. d'Alverny,"Commentlesthologiens...voientlafemme." 122.SeeDuby,TheKnight,theLadyandthePriest,pp.2329P.Brown,VirginityandSocietyseealsoF.ForresterChurch,"SexandSalvationinTertullian," HarvardTheologicalReview68.2(1975):83101. 123.SeeCardman,"WomenandOrders,"esp.p.596,andBynum,JM,pp.921,14245. 124.SeeNatalieZ.Davis,SocietyandCultureinEarlyModernFrance(Stanford:StanfordUniversityPress,1975),pp.12431.


7 FoodAsControlofCircumstance 1.MeechandAllen,BookofMargeryKempe,chap.11,pp.2325trans.ButlerBowdon,TheBookofMargeryKempe,1436(London:Cape,1936),pp.48 49.OnMargery,seeAnthonyGoodman,"ThePietyofJohnBrunham'sDaughter,ofLynn,"inBaker,MW,pp.34758ClarissaW.Atkinson,MysticandPilgrim: The"Book"andtheWorldofMargeryKempe(Ithaca:CornellUniversityPress,1983)Kieckhefer,UnS,passim,esp.18290andSusanDickman,"TheDevout Imagination:JulianofNorwichandMargeryKempe,"unpublishedmanuscript. 2.Asinchapter6above,sointhischapterIprovidefootnotesonlytothoseincidentsthathavenotbeenreferredtobefore. 3.LifeofMargaretofCortona,chap.2,pars.1617,AASSFebruary,vol.3,p.307.Margaretwascriticizedfornottalkingwithherson"utnihileicoquerevellet, netempusimpedireturorandi."Shesaidtohim:"Filimi,cumadcellamredieras,sicutcibumcruduminveneris,itasume,tenendosilentiumquiatempusdivinislaudibus impendendum,intenullarationedistribuam."SeealsoCuthbert,TuscanPenitent,pp.2223,9395. 4.Processofcanonization,Monumenta...vesprimiensis,ed.Frakni,pp.214,220. 5.ForChristina,seeTalbot,LifeofChristinaofMarkyate,andHoldsworth,"ChristinaofMarkyate." 6.SeePlacidoTommasoLugano,ed.,IProcessiineditiperFrancescaBussadeiPonziani(SantaFrancescaRomana)14401453(VaticanCity:Biblioteca ApostolicaVaticana,1945),andJohnMattiotti'saccountofherlife,visions,andconflictswithdemonsinAASSMarch,vol.2(Paris,1865),pp.93178.Andsee above,chap.6atn.114. 7.WeinsteinandBell,SS,p.46. 8.Seeabove,chap.1atnn.5053,andbelow,chap.10atnn.5153. 9.DavidHerlihy,"AlienationinMedievalCultureandSociety,"reprintedinSocialHistoryofItalyidem,"TheMakingoftheMedievalFamily:Symmetry,Structure andSentiment,"JournalofFamilyHistory8.2(1983):pp.11630MichaelGoodich,"ChildhoodandAdolescenceamongtheThirteenthCenturySaints,"History ofChildhoodQuarterly1(1974):285309DianeOwenHughes,"FromBridepricetoDowryinMediterraneanEurope,"JournalofFamilyHistory3(1978): 26296WeinsteinandBell,SS,passim,esp.pp.6772andGoodich,VP,pp.82,100123,208. 10.SeeHerlihy,"MakingofMedievalFamily,"p.116. 11.Asceticrenunciationoffamilycouldalsobearejectionofchildrenseeabove,n.3.SeealsothecaseofAngelaofFolignowhosays,attheopeningofherBook, thatsheprayedtoGodthathermother,husband,andchildrenwoulddie,andtookgreatconsolationwhentheydidshesays,however,laterintheBookthattheloss ofhermotherandchildrenwasaterriblesorrow(AngelaofFoligno,ed.FerrandBaudry,par.12,pp.1012par.35,p.54).Notethatthesecondreferencedoes notmentionherhusband.ItseemspermissibletoseesomeofAngela'sgriefforherchildrenappearing,transmuted,bothinherloveforherspiritualsons,thefriars, andinheryearningforthebabyJesus(seepar.154,pp.33436). 12.RaymondofCapua,LifeofCatherineofSiena,pt.1,chap.2,pars.3334,AASSApril,vol.3,pp.87071.


13.SeeSchmidt,"LebenderheiligenElisabeth,"pp.1,5AnceletHustache,Elisabeth,pp.3942andAigrain,L'Hagiographie,p.205.Weowethestorytoan anonymousTuscanFranciscanofthethirteenthcentury.Later,whenElizabethjoinedaconvent,herconfessorforbadehertogiveawaymorethanmorselsofbread andhadherbeatenforurginghersisterstocharityseeAnceletHustache,Elisabeth,pp.31516.ThestoryofbreadandrosesistoldofRoseofViterboand ElizabethofPortugal(seeAnceletHustache,Elisabeth,pp.3942n.1),MargaretofFontana(d.1513)(seeLifeofMargaretofFontana,chap.2,par.9,AASS September,vol.4[Paris,1868],p.137),andFloraofBeaulieu(seeClovisBrunel,"VidadeFlor,"AB64,p.8n.4).Seealsoplates8and9. 14.TheclassicstatementisPhilippeAris,CenturiesofChildhood:ASocialHistoryofFamilyLife,trans.RobertBaldick(NewYork:Knopf,1962)seealso LawrenceStone,TheFamily,SexandMarriageinEngland,15001800,abridgeded.(NewYork:HarperandRow,1977),andPeterLaslett,TheWorldWe HaveLost(London:Methuen,1965),chap.4. 15.Medievalchildhoodhasrecentlybeenthesubjectofmuchresearch,whichhastendedradicallytomodifyAris'spicture.AmongthebestworkisM.M. McLaughlin,"SurvivorsandSurrogates"PierreRich,Del'ducationantiquel'ducationchevaleresque,Questionsd'histoire3(Paris:Flammarion,1968),pp. 3039andDavidHerlihy,"MedievalChildren,"inRichardE.Sullivanetal.,EssaysonMedievalCivilization:TheWalterPrescottWebbMemorialLectures,ed. BedeK.LacknerandKennethR.Philp(Austin:UniversityofTexasPress,1978),pp.10941. 16.SeeHerlihy,"MakingofMedievalFamily,"pp.12530WeinsteinandBell,SS,pp.4647andGoodich,VP,passim,esp.p.207. 17.SeeHerlihy,"MakingofMedievalFamily,"andHughes,"BridepricetoDowry."TheworkofGeorgesDubyhasalsocontributedfundamentallytoourchanging conceptionofthemedievalfamily.SeeDuby,TheChivalrousSociety,trans.CynthiaPostan(London:Arnold,1977),chaps.1,3,6,9,10idem,Medieval Marriage:TwoModelsfromTwelfthCenturyFrance,trans.E.Forster(Baltimore:JohnsHopkins,1978)andidem,TheKnight,theLadyandthePriest. 18.SeeDavidHerlihy,"LifeExpectanciesforWomeninMedievalSociety,"p.16,reprintedinSocialHistoryofItaly.Seealsoidem,"TheGenerationinMedieval History,"alsoreprintedinSocialHistoryofItaly,andJ.Hajnal,"EuropeanMarriagePatternsinPerspective,"inD.V.GlassandD.E.C.Eversley,eds., PopulationinHistory:EssaysinHistoricalDemography(London:Arnold,1965),pp.10143. 19.Onthispoint,seeM.M.McLaughlin,"SurvivorsandSurrogates,"pp.12439Hentsch,LittraturedidactiquePhilippeDelhaye,"LeDossierantimatrimonial del'AdversusJovinianumetsoninfluencesurquelquescritslatinsduXIIesicle,"MedievalStudies13(1951):6586Bullough,"MedicalandScientificViews," pp.485501. 20.SeeLittle,ReligiousPovertyandGoodich,VP,passim,esp.pp.123,208. 21.Religiouslifeandreligiouscommunitywerealsoveryimportantsubstitutesforfamily.Petroff,Consolation,pp.6162,pointsthisout,givingasanexamplethe visionsoftheHolyFamilyreceivedbyUmilianadeiCerchi,whoserelationswithherownfamilywereunhappy.(OnUmiliana,seealsoWeinsteinandBell,SS,pp. 5253.)Manyotherexamplescouldbecited.MargeryKempe(seebelow,chap.8nn.4,8)wasexplicitaboutsubstitutingChristforherunsatisfactoryhusband. GertrudevanOosten,who


yearnedwithadeeplovetowardchildren,inavisionreceivedJesusatherflowingbreasts(seeabove,chap.4n.61).ThehandicappedMargaretofCittdi Castello,abandonedasababybyherparents,wasespeciallyfondofchildrenandsawvisionsoftheHolyFamily,includingJoseph,attheelevationofthehost. AfterdeathshewasfoundtohavethreepreciousstonesinherheartandononeofthemsheandJosephwereetched(seeabove,chap.4nn.174,212).When JaneMaryofMaillwassixyearsoldandwatchingbythebodyofherdeadmother,shereceivedavisionofMaryProcessofcanonization,chap.5,par.56, AASSMarch,vol.3(Paris,1865),p.755.(ItisimportanttonotethatthewitnesssaysnotthatthesaintwashenceforthdevotedtoMarybutthatshewas henceforthdevotedtothePassionofChrist.)Jesuswassometimesachildforthechildless,agoodlovertotheunmarriedortheunhappilymarried.TheHoly Familywassometimesfamilytothoseabandonedorpersecutedbytheirownparents.Seealsoabove,chap.4n.28. 22.ThisisapointIhavediscussedinJM,chapter5,andin"WomenMystics,"pp.19296.Inmyemphasisonthecombinationofservingandasceticisminthelives ofholywomen,IdifferfromBell,whoarguesinhisHolyAnorexiathattheprominenceof"holyanorexia"inwomen'sbehaviorresultedinpartfromtheabsenceof opportunitiesforservice.IalsodifferfromVauchez,LaSaintet,Kieckhefer,UnS,andWeinsteinandBell,SS,allofwhichargueforasharperdichotomybetween contemplativeandactive(serving)rolesthanIfeeltheevidencewarrants. 23.Seeabove,chap.3atn.124. 24.Inaninterestingvariationonthethemeofdetectingimmoralitybytaste,ChristinaofMarkyatewasabletotellbytastingthatasaladhadbeenmadefrom ingredientscollectedfromaforbiddengarden.(Itisworthnotingthatsheprohibitedherservantsfromusingthegardenbecausethemanwhoownedithaddeniedher asprigofgreens.)SeeTalbot,LifeofChristinaofMarkyate,pp.19091. 25.Seeabove,chap.4nn.178,170LifeofMaryofOignies,chap.9,par.86,AASSJune,vol.5,p.566andLifeofIdaofLouvain,chap.6,par.28,AASS April,vol.2,pp.17879.AndseenBrowe,DieWunder,pp.3149.Women'seucharisticmiraclesalsoinvolvedknowingwhethertheconsecratedhostwaspresent inthetabernacle,oridentifyingtheexactmomentoftheconsecrationseeViedeDouceline,pp.13335LifeofJuliana,chap.5,par.22,AASSApril,vol.1,p. 450andLifeofIdaofLouvain,chap.2,par.9,p.173. 26.Browe,DieWunder,p.42. 27.SeeJohnCoakley,"TheRepresentationofSanctityinLateMedievalHagiography:EvidencefromLivesofSaintsoftheDominicanOrder,"Ph.D.diss.,Harvard, 1980,whofinds,infifteenthcenturysaints'lives,thispatternofwomenviewedasinspirationandrefugeformales. 28.SeeVictorTurner,Dramas,FieldsandMetaphors:SymbolicActioninHumanSociety(Ithaca:CornellUniversityPress,1974)idem,"SocialDramasand StoriesaboutThem,"inW.J.T.Mitchell,ed.,OnNarrative(Chicago:UniversityofChicagoPress,1981),pp.13764VictorandEdithTurner,Imageand PilgrimageinChristianCulture:AnthropologicalPerspectives(Oxford:Blackwell,1978)andBynum,"Women'sStories,Women'sSymbols." 29.Forexample,ThomasofCantimpr,inhisLifeofLutgard,bk.3,chaps.316,


AASSJune,vol.4,pp.2048,callsLutgard"motherandnurseofthewholeorderofpreachers"(p.205),describesafriarrelatingtoher"astohisown mother"(p.207),andsaysthathisorderisleft"orphaned"byherdeath(p.208).Hecallsher"mother,"however,onlyinherrelationshipstomales,althoughmany ofhermiraclesareforwomen.(Seeabove,chap.4n.65,andbelow,chap.10n.16.)JamesofVitry,intheLifeofMaryofOignies,bk.2,chap.7,AASSJune, vol.5,pp.56263,seesMaryastheinspirationofpreachersandsaysthat''withtears,prayersandfaststoGod,"sheprayedthat"themeritandofficeof preachingwhichshecouldnotexerciseinherself"wouldbelodgedinothersandthatGodwouldgivetoherapreacher"asagreatgift."ButJamesiscarefulto underlineheracceptanceoflimitation,forhereportsinthesamechapterthatthedeviltemptedherbyappearingtoherasapastorbutshereplied:"Nooneisa pastorsaveourmasterwhopreachesthewordofGodandfeedsoursouls." 30.StephenE.Wessley,"TheThirteenthCenturyGuglielmites:SalvationthroughWomen,"inBaker,MW,pp.289303McDonnell,Beguines,pp.49296 MarjorieReeves,TheInfluenceofProphecyintheLaterMiddleAges:AStudyinJoachimism(Oxford:ClarendonPress,1969),pp.24850WilliamHarold May,"TheConfessionsofProusBoneta,HereticandHeresiarch,"inJ.H.Mundyetal.,eds.,EssaysinMedievalLifeandThoughtPresentedinHonorofAustin PattersonEvans(NewYork:ColumbiaUniversityPress,1955),pp.330. 31.SeeBynum,JM,pp.24042,245. 32.SeeMarkReuelSilk,"ScientiaRerum:ThePlaceofExampleinLaterMedievalThought,"Ph.D.diss.,Harvard,1982,pp.21342I.M.Lewis,Ecstatic Religion:AnAnthropologicalStudyofSpiritPossessionandShamanism(Harmondsworth:Penguin,1971),pp.8599. 33.SeeDuhr,"Communionfrquente,"andabove,pp.5759. 34.LifeofAlice,chap.2,par.15,AASSJune,vol.2,p.474. 35.ThomasofCantimpr,LifeofLutgard,bk.2,chap.1,par.14,p.199:"ProhibitaestpiaLutgardisaDominaAgnete...sumereomnidieDominico sacramenta....Necmora:invindictamfacti,intantumaDominoperintolerabileminfirmitatemafflictaest,quodecclesiamingredinonvaleretneccessavitdolorper momentaconcrescens,donecreatumindiscretionisagnosceret,etprohibitioneminpiaLutgardepoenitensrelaxaret." 36.Browe,DieWunder,pp.2728. 37.LifeofIdaofLau,chaps.23,AASSOctober,vol.13,pp.11215.AndseeLifeofJuliana,chap.2,AASSApril,vol.1,pp.44546. 38.LifeofIdaofLouvain,bk.3,chap.1,andbk.2,chap.2,pp.18284and17273.ForthemiraculouscommunionsofColetteandColumba,seeabove,chap.4 nn.170,226. 39.Tss,pp.3233.Forotherexamplessee"Unterlinden,"pp.44244. 40.JamesofVitry,Historiaoccidentalis,ed.Hinnebusch,p.88. 41.SeeBynum,JM,pp.2039,andBrowe,DieWunder,pp.2030,ondistributionmiracles. 42.Gertrude,Legatus,bk.4,chap.7,pp.31921.SeealsoBynum,JM,pp.196209. 43.Gertrude,Oeuvres,vol.3:LeHraut,bk.3,chap.60,pp.24446. 44.Gertrude,Legatus,bk.4,chap.32,pp.39495thispassageandtheonecitedinn.45belowaretranslatedatlengthinBynum,JM,pp.2056.


45.Gertrude,Oeuvres,vol.2:LeHraut,bk.1,chap.14,pp.19698. 46.OnthisprohibitionseeBynum,JM,pp.1516,13536. 47.ForJulianaandLukardis,seeabove,chap.4nn.64,1.ForMechtild,seeMechtildofHackeborn,Liberspecialisgratiae,bk.1,chap.1,pp.710.For Angela,seeAngelaofFoligno,ed.FerrandBaudry,par.151,p.326(cf.AASS,par.113,p.204). 48.LifeofIdaofLouvain,bk.3,chap.1,pp.18284LifeofBenevenutaofBojano,chap.6,par.51,AASSOctober,vol.13(Paris,1883),pp.163Mechtildof Hackeborn,Liberspecialisgratiae,bk.1,chap.27,p.96.FortheiconographicmotifofMaryaspriest,seebelow,chap.9n.41.Itisimportanttonotethatthe themeisnotaclaimtopriestlyofficeforwomenbutasymboloftheparallelismoftheconsecrationandtheIncarnation.ThethemeofthepriesthoodofMaryisan extrapolation,notareversal,ofthenotionofwomanashumanity. 49.OnCatherine'sperceivingofthehostasblood,seeabove,chap.5atn.163.Foravisionreceivedbyaman(indeed,byapriest)inwhichthehostandtheblood areassimilatedtooneanother,seetheLifeofJohnofAlverna(d.1322),inAF,vol.3(1897),p.445.InastrikingparalleltotheiconographicmotifofthemassofSt. Gregory,John,whilecelebratingmass,sawawoundedChristappearandbleedintothechalice.Whentheapparitionfaded,Johnsawtheformofthebread.Seealso ActaandActaalia,inAASSAugust,vol.2(Paris,1867),pp.46667,46974,esp.Acta,chap.4,par.36,p.466. 50.Seeabove,nn.30,48. 51.Seeabove,chap.4atnn.15,24,45. 52.SeeJungmann,MassoftheRomanRite,vol.2,pp.36465andabove,chap.2atn.104. 53.Seeabove,chap.2atn.141. 54.Foreconomicimageryinmalewriting,seeBarbaraH.RosenweinandLesterK.Little,"SocialMeaningintheMonasticandMendicantSpiritualities,"Pastand Present63(May1974):2032andLittle,ReligiousPoverty.Myargumentthatpurgatoryismoreapoolofsufferingthanaplacetakespartialexceptiontothe importantrecentbookbyJacquesLeGoff,LaNaissanceduPurgatoire(Paris:Gallimard,1981).Mypositionimpliesthatthekeyquestiontoconsiderinexplaining theevolutionofthenotionofpurgatoryisnottheoppositionofheavenandhellbut,rather,theroleofsufferinginChristianity. 55.Vision5,Hart,Hadewijch:Works,pp.27677Mommaers,DeVisioenen,supplement,vision5,ll.2745. 56.SeeLifeofJuliana,bk.2,chap.2,pp.45758.OnMechtild,seeBynum,JM,pp.23545,whereIpointoutthatMechtildseesthefemalewhoissubmissive, humble,lowly,andwithoutpowerandlearningasthecomplementtomalepriesthoodandauthority. 57.Gertrude,Oeuvres,vol.3:LeHraut,bk.3,chap.36,p.176.OntherespectforthepriesthoodfeltbyGertrude,MechtildofHackeborn,andMechtildof Magdeburg,seeBynum,JM,p.256n.298. 58.HildegardofBingen,Scivias,ed.AdelgundisFhrktterandAngelaCarlevaris,Corpuschristianorum:continuatiomedievalis43,2vols.(Turnhout:Brepols, 1978),vol.1,pp.1921,14748,29091.IfindtheemphasisinBernhardW.Scholz,"HildegardvonBingenontheNatureofWoman,"AmericanBenedictine Review31(1980):36183,somewhatmisleading.


59.LifeofGherardesca,chap.4,par.36,AASSMay,vol.7,p.169trans.Petroff,Consolation,p.103. 60.Seebelow,chap.9n.16. 61.Seeabove,chap.2atnn.22,29.Foratypicalmiracleinwhichawholeconventreceives,see"Unterlinden,"p.442. 62.Seeabove,chap.1atn.35,andVauchez,LaSaintet,pp.249,31718,41927.Inasimilarargument,Rothkrug,"PopularReligion,"pp.7079,pointsout that,innorthGermany,womenbecamethemajorrepresentativesoflaypiety. 63.SeeBrowe,DieWunder,pp.2030. 64.LifeofJuliana,chap.5,par.33,p.453Browe,DieWunder,p.34. 65.Ihavediscussedthistrendinmyarticle,"DidtheTwelfthCenturyDiscovertheIndividual?"JournalofEcclesiasticalHistory31(1980):117,whichis reprintedinanexpandedversionaschap.3ofJM,pp.82109.SeealsoYvesCongar,"LesLacsetl'ecclsiologiedes'ordines'chezlesthologiensdesXIeetXIIe sicles,"ILaicinella"societaschristiana''deisecoliXIeXII:AttidellaterzaSettimanaInternazionalediStudio:Mendola,2127agosto1965,Pubblicazioni dell'UniversitCattolicadelSacroCuore3.5,MiscellaneadelCentrodiStudiMedioevali5(Milan,1968),pp.83117GilesConstable,introductiontoConstable andB.Smith,eds.,Libellusdediversisordinibusetprofessionibusquisuntinaecclesia(Oxford:OxfordUniversityPress,1972),pp.xixxviiandGiles Constable,"RenewalandReforminReligiousLife:ConceptsandRealities,"inRobertL.BensonandGilesConstable,eds.,RenaissanceandRenewalinthe TwelfthCentury(Cambridge,Mass.:HarvardUniversityPress,1982),pp.3767. 66.Libellusdediversisordinibus,ed.ConstableandSmith,pp.1517.Theremarkconcernstypesofhermits. 67.JamesofVitry,Historiaoccidentalis,ed.Hinnebusch,chap.34,pp.16566.SeealsoAnselmofHavelberg,Dialogues,ed.GastonSalet,SC118,Sr.mon. 18(1966),bk.1,chaps.12,pp.3435. 68.SeeBynum,JM,pp.9395andAlanE.Bernstein,"PoliticalAnatomy,"UniversityPublishing(Winter1978):pp.89. 69.See,forexample,Vauchez,LaSpiritualitdumoyenge. 70.Duby,TheKnight,theLadyandthePriest,esp.pp.18690.SeealsoPennyS.Gold,"TheMarriageofMaryandJosephintheTwelfthCenturyIdeologyof Marriage,"inVernL.BulloughandJamesBrundage,eds.,SexualPracticesandtheMedievalChurch(Buffalo:PrometheusBooks,1982),pp.10217and Herlihy,"MakingofMedievalFamily,"pp.12628. 71.Wood,"Doctors'Dilemma." 72.Seeabove,chap.2atn.64. 73.Letter28,PL157,col.170.Foranotherexample,seeAdamofEynsham,LifeofHughofLincoln,bk.5,chap.16,vol.2,pp.19597. 74.Seeabove,chap.3atnn.84,85.AgoodexampleofthedoublebindinwhichthisattitudeplacedwomenisdiscussedbyDuby,TheKnight,theLadyandthe Priest,p.161.AcertainErmengarde,repudiatedbyonehusbandanddesiringtohavehersecondmarriageannulled,wastoldbythereformerRobertofArbrisselto beobedientinmarriage.Roberturgedhertopracticemuchalmsgivingbutnottoomuchprayerormortification,sinceherbodyshouldbekepthealthyformarriage.


75.Duby,TheKnight,theLadyandthePriest,esp.chap.6. 76.Seeabove,chap.3nn.87,88. 77.Seeabove,chap.3atn.256. 78.Onwomenmysticswhowerecondemnedforquietismorantinomianismseetheworkscitedabove,chap.1n.18,andDronke,WW,pp.20228.Seealso below,chap.8n.28. 79.Vision1,Hart,Hadewijch:Works,p.270Mommaers,DeVisioenen,supplement,vision1ll.32733.Godgoesontosaythatsherefusedexteriorgiftsand miracles. 80.Vision14,Hart,Hadewijch:Works,p.305Mommaers,DeVisioenen,supplement,vision14,ll.15057:"dienietenbekindemetghearbeiderminnenende metgheanxenderhoeicgodendemenschebenEndewantducoene.duscoenebestendedusnietnebughessoeheetticoenste.endesoeeestrechtdattumitevollen kins." 81.ImmoderatetooisMechtildofMagdeburg'sconfidencethathersufferingwithChristsaves70,000soulsfrompurgatory.SeeMechtildofMagdeburg,Licht,bk. 2,chap.8,p.35,andbk.3,chap.15,pp.7678.Moreover,HildegardofBingen,despitedisclaimers,sometimesallegesthatsheknowsthefutureorthecondition ofdepartedsoulsseeDronke,WW,pp.19293. 82.Seeabove,chap.2n.113. 83.MechtildofMagdeburg,Licht,bk.3,chaps.10,2122,andbk.5,chap.8,pp.72,8587,13536.Inbk.1,chap.5,p.7,sheofferstogotohellifitwillbring Godpraise.ItisoutofthiskindofanguishthatJulianofNorwichforgesherorganicsensethatallofexistenceisgivenmeaningbyGodseebelow,chap.10nn.37, 40,49. 84.Vision14,Hart,Hadewijch:Works,pp.3023Mommaers,DeVisioenen,supplement,vision14,ll.3237.ForAngelaofFoligno'ssenseofbeingspecialto Christ,seeAngelaofFoligno,ed.FerrandBaudry,par.45,pp.7880. 85.Vision5,Hart,Hadewijch:Works,pp.27677Mommaers,DeVisioenen,supplement,ll.2745. 86.Tauler,Sermon9forSecondSundayinLent,inTauler,DiePredigten,pp.4546trans.ColledgeandM.Jane,SpiritualConferences,pp.8687. 87.OnthispointseeGrundmann,BewegungenE.McLaughlin,"FreeSpirit"andR.Lerner,HeresyoftheFreeSpirit. 88.Tosaythisisnottodenythat,asVauchezhaspointedout(LaSaintet,p.446),hagiographersandpreachersinthefourteenthandfifteenthcenturiescame increasinglytoencouragethoseaspectsofwomen'sspiritualitythatseemtothetwentiethcenturyreadermostpsychologicallydisturbed.Watkins,"TwoWomen Visionaries,"p.187,makesthesamepoint. 8 TheMeaningofFood: FoodAsPhysicality 1.Seeabove,chap.5n.180. 2.Seeabove,pp.15152andbelow,Epilogue.Forotherrecentwriterswhopointoutthatsuchspiritualityis,initsauthors'ownterms,not"morbidsentimentality" but,


rather,delightinGod'slove,seeMadigan,"PassioDomini"Theme,p.100,andKieckhefer,UnS,chap.4,esp.p.104. 3.Onwomen'sdevotiontothehumanityofChrist,seeKieckhefer,UnS,esp.chap.4,andBynum,"WomenMystics."Paincomesincreasinglytobeemphasizedover pleasureinfourteenthandfifteenthcenturypiety.IconographicevidenceisparticularlyimportantforshowingtheincreasingdevotiontoChrist'spaininthePassion. SeegenerallySchiller,Iconography,vol.2:ThePassionofJesusChristandMarrow,PassionIconography.Browe,DieWunder,pt.2,chaps.13,discusses thefactthatvisionsoftheChristchildintheeucharistaremostcommoninthetwelfthandthirteenthcenturies,withvisionsofthebleedingandtorturedmangaining steadilyinthefourteenthandfifteenthcenturies. 4.SeeMeechandAllen,BookofMargeryKempe,passim,esp.chap.35,pp.8689. 5.SeeLifeofMargaretofFaenza,chap.2,par.7(xi),AASSAugust,vol.5(Paris,1868),p.849,andPetroff,Consolation,p.62.Forotherexamples,see Gertrude,Oeuvres,vol.2:LeHraut,bk.2,chaps.6,16,pp.25658,290300idem,Legatus,bk.4,chap.3,pp.300301AngelaofFoligno,ed.Ferrand Baudry,par.154,pp.33234(seealsoPulignaniandHumanied.,par.245,pp.38688,andAASSJanuary,vol.1,pp.2056)andseeFerrandBaudryed., par.41,p.64LifeofMaryofOignies,passim,esp.bk.2,chap.7,par.72,chap.10,par.91,AASSJune,vol.5,pp.563,567MargaretofOingt,LifeofBeatrice ofOrnacieux,inOeuvresdeMarguerite,pp.11921Tss,pp.36,3839,45,47,8788andEngelthal,pp.2627,31,36,39.TheLifeofIdaofLouvain,bk. 2,chap.5,pars.2223,AASSApril,vol.2,p.177,describesavision,whichlastedfromthereadingoftheEpistleuntilthemomentofelevation,inwhichIdabathes theChristchild(withthehelpofElizabeth,motherofJohntheBaptist),hugshimtoherbreast,andatfirstrefusestoreturnhimtoMary. 6.ThomasofCantimpr,LifeofLutgard,bk.1,chap.1,par.2,AASSJune,vol.4,pp.19192(Christshowsthewoundinhissidetowooherawayfromasuitor) LifeofMargaretofYpres,ed.Meersseman,"Frresprcheurs,"pp.1079,11718,120andMargaretofOingt,Speculum,inOeuvresdeMarguerite,pp.98 99.SeealsoLifeofLukardisofOberweimar,AB18,p.324(Christ,asabeautifulyouth,breathesintohermouth)LifeofIdaofLouvain,bk.2,chap.3,par.11, AASSApril,vol.2,pp.17374(IdadrinksasavingdrinkfromChrist'snakedchest)and"Unterlinden,"pp.44244. 7.Talbot,LifeofChristinaofMarkyate,pp.11619. 8.MeechandAllen,BookofMargeryKempe,chap.36,p.90trans.ButlerBowdon,BookofMargeryKempe,pp.35455. 9.AngelaofFoligno,ed.FerrandBaudry,par.11,pp.810:"Setinistacognitionecrucisdabaturmichitantusignis,quodstandojuxtacrucemex[s]poliavime omniavestimentamea,ettotammeoptuliei."(Cf.PulignaniandHumanied.,par.12,p.12,whichtreatsthenuditymoreasametaphorforrenunciationoftheworld.) 10.AngelaofFoligno,ed.FerrandBaudry,par.75,pp.15658(cf.PulignaniandHumanied.,par.75,pp.13234,andAASSJanuary,vol.1,p.196)discussed byPetroff,Consolation,p.68(butonthebasisofaninadequatetext).Notethatthedesireisdescribedashunger.OthereroticpassagesinAngelainclude(Ferr andBaudryed.)par.36,pp.5456(Christgiveshertheringoflove)par.41,pp.6466andpar.45,pp.7880.


11.Umilt,Analecta,chap.1,par.7,AASSMay,vol.5(Paris,1866),p.216,trans.Petroff,Consolation,p.143,andseealsopp.6682. 12.Petroff(Consolation,pp.6675)makesthispointnicely. 13.Browe,DieWunder,pp.11011.Onthequestionofwomen'sattitudestowardbody,seetheperceptivediscussionofHildegardofBingeninDronke,WW,pp. 17677.Idonotquiteagreethat"Manichean"isthemostusefuldescriptionofHildegard'sdiscussionofsexuality,althoughsheismorenegativeaboutbodythan manywomenwriters.(Herdescriptionofsexualintercourseasthemalepoundingthefemalelikeathreshingfloorandherclearsenseofvirginityasprotectionand evenliberationsuggesttomethatshewaslessconcernedwithbodyastaintingandmoreconcernedwithmalecontrolasworldlycontrolthanDronkesuggests.)I agree,however,withDronkeinseeingmanyofHildegard'sattitudestowardbodyas"naturalistic." 14.LifeofAlice,chap.2,pars.910,AASSJune,vol.2,pp.47374. 15.LifeofJuliana,bk.1,chap.4,par.18,AASSApril,vol.1,p.449. 16.MargaretofOingt,Letters,inOeuvresdeMarguerite,p.139. 17.Ibid.,p.147. 18.Ibid.,pp.14951. 19.Seethediscussionofherpietyinibid.,pp.16466.Foranunfortunatelyjudgmentaltoneonthewholeaffectivetradition,seeColledgeandWalsh,introductionto Julian,BookofShowings,vol.1,pp.153,159,169,172,174,185. 20.AlthoughitislateinthedaytojoinbattlewithaninterpretationasoldasHuizinga'sandungracioustoquarrelwithoneofthegreatbooksofthetwentiethcentury, IshouldpointoutthatmyinterpretationrunscountertothatpresentedinJohanHuizinga,Waning,whereHuizingaseessomethingdecadentaboutthefourteenthand fifteenthcenturyproliferationofsymbolsandallegoriesandholdsthatincreasinglythecategoriessimplygeneratedothercategorieswithoutmuchregardfortheir referentsin"reality."Iseethispietyasdeeplyexperiential. 21.ItshouldhardlybenecessarytopointoutthatinrejectinganachronisticcategorizationsofsuchpietyIamneitheradvocatingareturntomedievalreligiositynor denyingthatsomeelementsofthisspiritualityaredeeplyoffensivetomodernsensibilities(seebelow,Epilogue).Weshould,however,notethatmodernreactions, basedinpostFreudianassumptionsthat"normal"sexualityisgenitalandorientedtowardahuman,adult,heterosexualobject,makeamorepolymorphoussensuality orientedtowardthedivinebydefinition"abnormal."SimoneWeil,inamoderndefenseofsuch"abnormal"sensibility,haswritten:''Toreproachmysticswithloving Godbymeansofthefacultyofsexualloveisasthoughoneweretoreproachapainterwithmakingpicturesbymeansofcolorscomposedofmaterialsubstances.We haven'tanythingelsewithwhichtolove...."(TheNotebooksofSimoneWeil,2vols.,trans.ArthurWills[London:RoutledgeandKeganPaul,1956repr.1976], vol.2,p.472).Andseeabove,chap.5n.208. 22.Foraparticularlyeroticuseofeatingmetaphorsseeabove,chap.4n.107. 23.McDonnell,Beguines,p.310. 24.Ibid.,pp.310,315,330,415Bolton,"VitaeMatrum,"pp.26768Moore,EuropeanDissent,pp.16869.Heresyasthecontextwithinwhichthirteenth centuryideasofsanctitymustbeunderstoodisoneofthethemesofGoodich,VP.


25.See,forexample,JamesofVitry,LifeofMaryofOignies,prologueandbk.2,chaps.7and9,pp.54750,56263,56566. 26.LifeofJuliana,bk.2,chap.3,pp.46162. 27.Seeabove,chap.2n.138. 28.Somewomenwere,afterall,attractedtotheCatharsandtoantinomianorquietistmysticism,inpartforreasonsIcharacterizedaboveas"therejectionof moderation."AndoneisstruckbythecoincidencethatthefeastofCorpusChristi,forwhichseveraldevoutwomenworkedlongyearswithoutsuccess,wassuddenly promulgatedandpreachedwithgreatenthusiasminexactlythoseyearsaround1317inwhichwomen'squasireligiouscommunitiesandantinomianmysticism(the "FreeSpirit")werecondemned. 29.ThebibliographyonThomasAquinas'sphilosophyismammoth.Onhistheoryoftheperson,thenonspecialistcanconsultFrederickC.Copleston,Aquinas (Harmondsworth:Penguin,1955),orAnthonyJ.P.Kenny,Aquinas(NewYork:HillandWang,1980),twoverydifferentapproaches.Ontheincreasinglypositive senseofbodyinthelaterMiddleAges,seeBernstein,"PoliticalAnatomy."OnthesenseofbodyinFrancisofAssisiseetheexcellentdiscussionbyJaroslavPelikanin JesusthroughtheCenturies:HisPlaceintheHistoryofCulture(NewHaven:YaleUniversityPress,1985),pp.13344,esp.13839. 30."Unterlinden,"p.352. 31.OnthelifeofBeatrice,probablybyMargaret,seeabove,chap.4nn.101,102.InMargaret'sPaginameditationum,pars.5658,inOeuvresdeMarguerite, p.81,shesayssheisreadytosufferanypainorpersecutionforChristhanging,burning,becomingaleper,etc.(Seealsopp.2627.)FortheremarkaboutChrist's humanity,seeMargaret,Speculum,inOeuvresdeMarguerite,p.101.Forasimilarsenseofthegloryofmatter,seeGherardescaofPisa,whoworshipedGod's majestyinapieceofstraw:LifeofGherardesca,chap.7,par.69,AASSMay,vol.7,pp.17576. 32.MechtildofHackeborn,Liberspecialisgratiae,bk.4,chap.3,p.260.Inanothervision,JohntheEvangelisttoldMechtildthatthosewhoaremarriedandown propertyarenofurtherfromChristthanthosewhorenouncesuchthings"becausetheWordismadeflesh"(