You are on page 1of 198

Love is the Way to Ascend

Spiritual Awakening Healing Tools for 2012 and Beyond

Lynne Namka, Ed. D.


Artwork by The Soul Connection Network.

AlsobyLynneNamka
TheDoormatSyndrome TheMadFamilyGetsTheirMadsOut HowtoLetGoofYourMadBaggage AvoidingRelapse:CatchingYourInnerCon AGatheringofGrandmothers:WordsofWisdomfromWomenofSpiritandPower GoodByeOuchiesandGrouchies,HelloHappyFeelings:EFTforKidsofAllAges TeachingEmotionalIntelligencetoChildren:FiftyFunActivitiesforFamilies&Therapists ParentsFight.ParentsMakeUp.TakeGoodCareofYourself! YourQuickAngerMakeoverPlusTwentyCuttingEdgeTechniquestoReleaseAnger!

Forinformationonbooksandcurriculums,gotowww.AngriesOut.com Copyright2011byLynneNamka www.AngriesOut.com www.Tucsonshaman.com

Youmaycopyportionsandexercisesfromthisbookforpostingonyourwebsites andblogsprovidedthatthiswebsitewww.lovetoascend.comisreferenced. Anyformofsellingthisinformationfromthisbookisaviolationofcopyrightlaw. However,thisbookistobesharedfreely;pleaseemailitontointerestedfriendsandfamily.

Publishedby Talk,Trust&FeelTherapeutics, 5398GolderRanchRoad Tucson,Arizona85739 ISBN#780964216779


PermissiongivenforthecoverillustrationRiseoftheRadiantGoddessbyTekaLuttrell, authorofStoriesforTransformationandtheSoulConnectionNetwork.

Saywhatyouthink.Nothingmore.
JuanFlores,SalazarAmazonShaman

Dedication

I will hide myself among you, O ye stars which are imperishable. My brow is the brow of Ra. Let the Eye of Horus come forth from the god and shine outside his mouth. "I shall see the Gods and the Eye of Horus burning with fire before my eyes." The Pyramid Texts

HonorandgratitudegototheElohim,thecreatoraspectsofGod,theGalactic CouncilsofLight,theAngelicRealms,theAscendedMasterstheWhiteBrotherhood, Trothandallforcesoflightandlovethatassistinthedevelopmentofhuman consciousness.Weareindeedfortunatetobeabletoaccessandevokethese Universalconsciousnessenergies.Thereisgreatgratefulnessfortheremembrance ofwhoIamasaspiritualbeingresonatingwithUnityConsciousness.Iamhereto serve,alltime,allspace,AllinOneness. And of this earthly plane, thanks go to two women of high consciousness, Nancy Swain and Donna Gilson who put love and time into corrections of this manuscript. Their loving assistance and support has helped me round out this book. LynneNamka,Ed.D.2010 5398E.GolderRanchRoad Tucson,AZ85739 www.Tucsonshaman.comwww.Angriesout.comlnamka158@earthlink.net Imslightlydyslexicanddontalwaysseetypos.Anyoneouttherewhowantsto emailmecorrections,feelfreeaslongasyouarentaperfectionistinnature! DisclaimerOther than my own books which I sell on line, I have no financial interestinanyproductsofthewebsitesmentionedinthisbook.Sendmeanemail tellingmewhatyouthinkoftheideasinthisbook!

Introduction Chapter1 Chapter2 Chapter3 Chapter4 Chapter5 Chapter6 Chapter7 Chapter8 Chapter9 Chapter10 Chapter11 Chapter12 Chapter13 Chapter14 Chapter15 Chapter16 Chapter17 Chapter18 Chapter19

TableofContents ToAscendistoRaiseyourConsciousness TheTimeoftheDivineMother TheLanguageofLoveandLight HealingattheSoulLevel FearistheNeuroticPatternoftheEgo CoherenceintheHumanBiofield TheProcessofHealing HowHealersDevelopTheirGift FindingtheSmall,StillVoiceWithin TheDarkMustBePlayedThrough AlchemyandtheAwakeningProcess TheHolyBreathasanAlchemicalTool TheBrainEntrained:SoundTechnologytoEnhanceyourBrain BecomingPureofHeart ModernDayEnergyPsychologyApproaches BalancingthePolarOpposites TuningintotheChristConsciousnessHealing IlluminationandtheAscensionProcess ChoosingtheEvolutionaryProcessinTimesofAmbiguity

Thesetimes,theyareacoming.Indeed,theyarehere.Wehumansareshiftingasour entireplanetarysystemisintheprocessofagreatvibrationalchange.Weliveinthe ageofinformationandspeed.Andinstantinformationatthat.Facts,figuresand dataofanythingwemightwantareavailableattheclickontheweb.Youcanaccess thatinformationthatelevatesyourspiritualgrowthtotakepersonalresponsibility forcreatingyourownuniquedestiny.Peoplewhoarereadytofindinformation abouthowtoevolvespirituallywillseekitout;thisistheLawofAttraction. Informationisthereifyouwantit.Websites,books,CDs,music,documentarieson the2012prophesiesandphenomenaarethereatthedropofaGooglehat.And someofthecontentoftheforecastsisnotpretty. Iposethequestion:Whatwouldyoudoiftheworldinfrastructuregoesdown? WhatwouldyoudoifWallStreetandourfinancialinstitutionscrash?Howwould youandyourlovedoneshandlethelightsandwaterdeliverysystemgoingout?If ourgovernmentscouldnolongersupportandprotectyou,howwouldyousurvive? Thesearequestionsworthconsideringandcomingupwithasensibleplanfor emotional,physicalandspiritualsurvival. Mycredentialstowriteabookonspiritualawakeningdespitethedirepredictions regardingthedestructionandwreckagethatspredictedbymanyspiritual traditionsfor2012?ImnoChickenLittlehystericallyrunninginapanicyelling, Theskyisfalling!Theskyisfalling.NoramIaDoomsDaypersonwithproductsor bookstosell.Noagendahereexcepttooffersomenononsenseinformationfrom theancientspiritualtraditionsplusmodernsciencetoprepareforthenearfuture comewhatmay.Andtogiveyousometoolsforbetterpreparingtoliveanddeal withchaos. IvebeenstudyingthesuddenshiftintomysticalstatessinceIwastwentyone.Iwas ayoungmothersittingonthebedholdingmyinfantson.Thesunstreamedthrough thewindow,dustmotesdancedintheairandsuddenlyIwentintoadifferent dimensionofCosmicConsciousness.Ivebeenresearchingthequestions,Whatis thissuddentransportthattakesusintootherrealities?AndHowcanweobtain moreofthischangeofvibrationsthatcompletelyaltershowweperceivereality? Whatisrealityanyway?Whatisthenatureofconsciousness?Whatreallyis behindDoorNumberThreeoristhereevenaDoorNumberThree?Aretheredoors atall?FortheDiamondSutra,oneofthemostancientHindusacredscriptures,tells us,Lifeislikeabubble,adream,areflection,amirage.
i

Introduction

Imapsychologistwhoisscientificallytrainedandamysticwhotakespeopleon shamanicjourneys.ThismeansIhavebothleftbrainedandrightbrainedworking togethertopiercethemysteriesofourgreatUniverse.Andsomeonewhoaccesses boththelogical,rationalleftsideofthebrainandmyintuitive,clairvoyantright side.Imadamn,practicalwomanwithamysticalbent. AndIunderstandthedeepupsettingemotionsthatchaosbrings.Asatoddler,I experiencedhighlydisturbingeventsinbothmygrandparentshomesso understandtraumapersonallyfrominsideandout.Iknowhowtoreleasethese unresolved,storedcentralnervoussystemenergeticsofnotfeelingsafe.Daily,I workwithpeopletoreleaseunproductivebeliefs,feelings,defensemechanisms,and automaticbodyreactionpatternstothreat.Inthepossibilityofworldupheaval,old unconsciousenergiesofnotbeingsafethatyoumightharbormightbereactivated renderingyoulesseffectivetodealwithwhatevercomes.Whentraumawoundsare released,whatisleftiflove. IconsidermyselftobesmallmindedlikeWinniethePoohabearofaverylittle brainbuttooffsetthislackofgreatintelligence,theresabigheartandagreat knowingabouthealing.Imnotanoracleorprophesierbutdolistenandtake directionformywritingfromahigherSourcethatisgroundedintheLoveEnergies. Ivetrainedmyeyetobediscriminativeaboutwhatistrulyimportant.Discernment istheabilitytopickouttherelevantfromtheirrelevanttoseparatethewheat fromthechaff,sotospeak,andthereissooooomuchchaffoutthere.Spiritual discernmentistheabilitytodiscriminatetheanabolic,lifeenhancinginformation fromthecatabolicorthatwhichconsumesanddestroyslife. Longpasttheneedtobeassociatedwithorganizedreligion,Idrawgenuineness frommanyspiritualtraditionsastheyallcarryapieceoftheTruth.Wisdomisthe abilitytodifferentiatethetruefromfalse.ThereisaSacredScienceouttherefor thosewitheyestoseeandearstohear.Asashaman,Iveearnedtheabilitytogo intootherdimensionsthroughworkingondevelopinghumility,clarityofmindand sincerityofpurposeandrightliving.ThroughconnectingwiththeChrist ConsciousnessSpirit,Ihavetheantennaetopullininformationthatsupportslife andpromoteshealing. ContinuingThroughtheIntotheLight Sobacktothequestionofhowtopersonallyhandlethechaosofapossible imminentcollapseofourlocal,nationalandworldsocialstructures.Theanswerit seemstomeistofirstandmostimportantlygetaholdofyouremotions!The
ii

psychologyfieldisinagreementwiththissayingthatemotionalregulationisan importantskilltohandlestress. Wheninternalchaosreigns,terrorisacommonemotion.Weareprogrammedto continuetoexist!Extremeselfishnessisonewayofcopingwithtryingtosurvive.I knowpanicandterror,personallyandfromworkingwithpeoplewhoexperience theseextremelydistressingemotions.Panicequalslackofknowledgeand preparationforwhateveryouarefacingandmakingstupiddecisions.Terroris beingtotallyoverpoweredandfrozeninparalysis.Confusionisanormalemotion thatisexperiencedwhenthereisalackofdataortwoormoresetsofdatagiving differentinformation.Tobestserveyourselfandyourfamily,calmingthe heightenedemotionsisabsolutelynecessarysoyoucanmakerationaldecisions. If2012meansthatthereisatimeofpandemoniumandturmoil,allyourpersonal baseswillneedcovering.Thisbookgivesemotionalandspiritualtoolsforfacing andgettingthroughconfusionintheworstoftimes.Herearetoolsofincreasingthe lovewithinyoufortheeither/orsandtheand/butsorwhateverhappenstoour planet.Thetoolsoflovecoverallthesescenarios: Whatifnothingbiganduntoldhappens,youarestillcoveredfordealingwith thissomewhatmaddeningworldasitisandlifewillgoonasusual. Ifthisisallatestaboutyourmakingyourownrealityatypeofcosmicwhat yougetiswhatyouthinkthencuttingthroughtheegofearsandtheillusions andluresofthematerialworldisyourbestdeal. Thatifthereisabigkaboom!andyousomehowsurvive,likewiseyouwant waystoworkyourmindinclear,rationalwaystodealwithwhatevercomes. ThattheresavibrationalshiftandpeopleareTakenUp,(whateverthat means)andyoufindyourselfbeingoneofthosepeople,thenyouvegotthe spiritualfoundationtocarrytherightvibes. Thatifspacealiensofferyouarideontheirspaceship,youveachievedthe spiritualdepthtojointheirdimensionalloopbutbeingnottooloopyaboutit. Thatiftheresanintergalacticportaltogainentryintowhichtakesyoutoa newdimension,youcanfinditoralternativelyitfindsyou.Thispossibilitygives newmeaningtoCaptainKirksmessage,BeammeupScotty.

iii

Thatwearemultidimensionalbeingswhoexistonlyinpartonthisplanetwe callEarthandthatwecanchoosetomovetooneofourotherdimensions? Itsallthereforyouwiththiscosmicshiftthatshappeninghavingbeenintheworks foreonsandeons.XYouareHere,asthemapinthemallsays,andyouhopefully knowwhereyouwanttogo. Togethomefree.Thatswherewewanttogo.Thatswhatweallwanttobehome free.RememberthechildhoodgameofHideandSeekwhenattheendsomeone wouldcry,Ollly,olly,ox.Allinfree!Whatwelongforisasafepass,togetpastGo withouthavingtogotojailorpaythe$50fine.Weallwantthatsafehomewhereall iswell.Todoso,wewillhavetorememberwhowetrulyare. Regardingthefutureofourworld,manyofusagreewithsciencefictionwriter,H.G. Wellswhosaid,Historyisaracebetweeneducationandcatastrophe.Andifyou areanonbelieverthatbigchangesarenotcoming,wellthatsyourrighttohave yourbeliefstoo.Wedoliveoutourbeliefsalthoughsometimesitsgoodtogeta secondopinion.Youneverknowjustiswhatyoubelieveandwhatisdenial.Keep youroptionsopenandkeepcheckingitout.TheAgnosticProphesy,accordingtothe cartoonNonSequiturinthedailyfunnypapersshowsamancarryingabigsign proclaimingSomethingArmageddonishmightbenear! PhysicalSurvivalinCaseofInfrastructureCollapse Whatthisbookisnot:Otherwritersandwebsitesgivedetailedideasonhowto prepareforthepossibilityofatotalcollapseofoureconomicandfoodsupply system.Physicalsurvivaltacticsarenottheintentofthisbook.Thisinformationis outtheresogetbusyandmakethenecessarypreparationsasdirectedbyyour innerwisdomandcommonsense.Ifitpleasesyou,getaprudentplanforgettingby ifthereisaninfrastructurefailure.Ifspendingsomemoneyandlayingsomewater andnonperishablefoodbyandsecuringyourhomesitegiveyoupeaceofmind,do it. Hereistheshortversionofphysicallysurvivingifthereisdevastation:Thinkself sustainabilityforyouandyourlovedones.Askyourself,howdidGreatGrandma andGrandpadoit?Getbacktoyourfarmingroots.Youcityfolksmayhaveto relocatetogotolandthatcanbefarmed.Tunenotonlyyourpsychicantennabut yourcommonsenseastowhatpracticalskillsandtoolsyouwouldneedtobeself sufficient.Skilltrainingandhowtobooksaregreatinvestmentsforyourmoney.
iv

Readbooksandtakecoursesinwaterharvesting,organicgardeningand Permaculturewhichisaphilosophyandtechniqueforbecomingselfsustainableon asmallamountofland.ItsaworldwidemovementthatwasdevelopedinAustralia whichhasachallengingdryclimatetoliveandthrivein.Indeedwecanlearnmuch fromtheHopisandAustralianswhopracticeextremedryclimatefoodgrowing practicesandwaterharvest. Preparetoaddresstheworst,dotheplanandthenletyourfearsaroundwhatmight happengo.Findwebsitesandphysicalsurvivalbookstohelpyoupreparetodeal withwhatevercomes.Useyourcommonsenseintakingguidancefromeachbook. Theinformationisthereinmanyformsandwithdifferentagendasinmind.Avoid usingyourtimeandenergyreadingaboutconspiracytheories.Manyofthe conspiracytheoriesaremerelypropagatedtoconfuseanddistractyoufromfinding yourrealtruth.Findthosesourcesthatdonottrytofrightenyouintoconspiracy theoriesthatcanneverbeprobedandburnupalotofyourenergyorthosethat wantyoutobuytheirproducts.Twobooksthatgivedowntoearth,practical informationareJamesWesleysscary,taketothehillsandarmyourselfbook,How toSurvivetheEndoftheWorldasWeKnowItandCrisisPreparednessHandbook:A ComprehensiveGuidetoHomeStorageandPhysicalSurvivalbyJackSpigarelliwhich isaboutputtingfoodsuppliesby. Decreaseyourdependenceonoutsidesourcessuchasthegovernmentandfinancial institutions.Useyourenergyandresourceswiselytobecomeselfreliant.Makea plan,carryitoutandthenletyourworriesgo.Ifnothingdirehappens,thenallyou willhavelostissometime,energyandcostofcarryingoutyourpreparations.This moneyandenergyexpensemaybesmallindeedcomparetostayinginafrenetic mindset. Watchoutforfalseteacherswhowantyoutogiveupyourpowerandyour resourcesasinTurnyourmoneyovertomeandIwilltakecareofyou. UnfortunatelyweareintheTheTooMuchInformationAge;anAgeof Disinformationwheretherearemanyfalsepathsthatlookenticingbutlead nowhere.Thisimportanttimeisnotthetimetoblindlyplaythechildsgame, FollowtheLeader.Therearethoseindividualsamonguswhosepurposeisto whipothersintoafrenzytodisrupttheforcesoflovethatareworkingforthegood ofmankindandtheentireplanetarysystem. Ignorethefalsevoicesandfollowthelovethatbidsyoutostaysolidwithinyour innerwisdom.Holdontoyourpoweranduseitwell.Findingandfollowingthelove withinisanecessaryskillsetthatcanbelearned!
v

Whymakethisbookfree?IconnectwiththespiritoftheNativeAmerican Giveaways.Givewhatyoucan,whenyoucan.Moneyasanabundant,flowing resourcehascometome.Haveenough.Dontneedmore.Beingsecureandhavinga RightRelationshipwithmoneyandaminimallifestylegivesuchfreedom.My purposehereistogatherandspreadideasaboutlivingacalm,happy,lovinglifeas wecomeintothisgreatadventurewenametheAscension. SpiritualSurvival Ivealwaysbelievedintheproverb,TrustGodandtieyourcamel.Havefaithand loveandbepracticalandgetbusyanddothework.Sointhisbookaremanysweet, lovingandyetpracticaltoolstoreleaseyourdeepestfearsforyourjourneyhome. Isntspiritualsurvivalwhatwetrulyneed?Ifthereistobechaos,thenitisthechaos withinthatweneedtoface.Theseexercisesgivenherecreatehealingtohelpyou openyourheartanddeepenyourlovewithin.Andgoforwardtofacethenewday, thenewmillenniumortheNewAge,theGoldenAgeorwhateveritstobecalled.It behoovesallofustotakeresponsibilityandshareinmakingthebestofthereality thatwecreatetogether.WeareinthisactofCoCreationofwhatcomesnext together. ToascendmeanstobecomeotherworldlyandmovetowardstheOne;toreturnto thatsingleSourceofwhichweareapart.Theascensionprocessisavibrationalshift whereweareledintothatveryrealitythatisconsciousnessitself.TheUltimate Realityisthereallthetimesbutwehavenottheeyestosee,theearstohear. Whateverhappensheretoourplanetandcivilization,thehumanracewillsurvive. EvolutiondictatesthatourhumanDNAwillgoon.Wearesurvivalbeingswithan indomitablespiritwithourheartsbeatinginvibrationwithsacredgeometryand theUniversalIntelligencethatsupportseverything. GregoryDavidRobertsinShantaram,hisrivetingnovelaboutIndiagivesvaluable advicewhenthingsseemoutofcontrolandyettherewearewaitingtoseewhat happensyet: Forthisiswhatwedo.Putonefootforwardandthentheother.Liftoureyes tothesnarlandsmileoftheworldoncemore.Think.Act.Feel.Addourlittle consequencetothetidesofgoodandevilthatfloodanddraintheworld.Drag ourshadowedcrossesintothehopeofanothernight.Putourbraveheartsinto thepromiseofanewday.Withlove;thepassionatesearchforatruthother thanourown.Withlonging:thepureineffableyearningtobesaved.Forso longasfatekeepswaiting,weliveon.Godhelpus.Godforgiveus.Weliveon.
vi

Chapter1 ToAscendistoRaiseyourConsciousness
HealingcanbefoundforALL.Nomanissobroken,sooppressedbyburdensofillhealth,poverty andunhappiness,butthereissomewayoutofhisproblemsinthelastresorttobeit. Thisisso;thismustbeso,becauseallmenexistwithintheUniversalMindwhichhasbroughtthisworldintobeing. PaulBrunton,TheSecretPath

Weliveinexceptionallyinterestingtimes.Thisisatimeofupgradeandrefinement astheintensityoftheenergeticshiftsofourPlanetEarthcontinues.Wearehereat thistimetohealandtoaddtothehealinginflowofenergiesintoourplanetatthis timeofAscension.Wearehereatthismostunusualtimeinhistoryforareason.Of allthetimestobeborn,thisisanexcitingone! Thewordascensionmeanstomoveupward.Itisdefinedasmovingintoagreater stateofconsciousnessasgreatvibratorychangesarehappeningtoPlanetEarth. ThisGreatShift,groundedincyclicchanges,ishappeningandyouareanecessary partofit.Manyspiritualteachersbelievethatatthistimeweareattheendofa humancycleofexistencethatwillevolveintosomethingdifferent.Somebelievethat thehumanraceispreparingforchaoticchangesinourearth.Someseethe2012 experienceasanopportunityforavibrationalportalthatwillopenwhenthetiming isright. Onepredictionisthattherewillbeaneclipseofthegalacticcenterbythe2012 solsticesun,aneventthathappensevery26,000yearswhichcoincidentallyisthe dategivenbytheMayanLongCountCalendar.Somethink12/12/12istheexact date;othersthinkthattheseyearsbeforeandafter2012willbringemotionaland physicalupheaval. Manybelievethatourcurrentcivilizationisundergoingahugetransitionalchange asthetimeforanewearthcycledrawsnear.Therearemanygeophysicaland cosmologicaltheoriesandpredictionsthatworldchangingeventsarehappening. SomesaythatthisisbecomingatimeofinterconnectednesscalledtheGoldenAge wherewehavethepotentialtobreakoutofoldparadigmsofpowerandgreed. SomecallthesetimesanewmillenniumchapteroranecessaryGlobalAwakening. OthershavemoredirepredictionslabelingthistheEndTimes.Somegroupsthat basetheirideasontheBiblecalltheseupcomingtimestheApocalypse,theRapture orArmageddon.
1

Whateverwillhappenishappeningnow.Thiscosmicmysterythatpredictsgreat changehasbeingrecognizedbymanytraditions.Weareinatransformationaltime aspredictedbytheMayanCalendarandpropheticwarningsfrommanytraditions suchastheancientAztecs,Incas,Hopi,Cherokee,Pawnee,Kogi,Egyptians,Greeks, HinduismaswellasfromthebookofRevelationfromtheBible.IntheHindu religion,theApocalypsewhichmeansuncovering,revealingorliftingtheveilis predictedtohappenwhenShivaopenshisThirdEyebringingabouttheendofan era. WrittenpropheciesfromtheDeadSeaScrollsandtheKabalapointtothesame messageofpreparation.MysticssuchasNostradamus,MotherShipton,St.Hildegard ofBingen,RudolphSteiner,EdgarCayceandPadrePiohavesharedtheirprophetic visions.ModerndayteacherssuchasSunBear,JamesHurtah,BenjaminCremeand DrunvaloMelchezidekplusothersgivetheirideasaboutthechangesthatwill happen. Inaddition,therearereferencesfromthemajorreligionsoftheworldaboutthis endofthisage.TheJewishreligioncallsthisthecomingoftheMessiahwhilethe ChristianscallitthesecondcomingofChrist.TheMormonsarepreparingforwhat theycallTheLastDays.MoslemsrefertothistimewhentheImamHahdiwillcome. TheHindusrefertoitasthecomingoftheKalkiAvatar.Buddhistsreferencethis timeastheMaitreyaBuddhaasforetoldbytheGautamaBuddha. Arewe,asJungiantherapistSunnyStrasburgquestioned,justallcaughtupinthe archetypeoftheApocalypse?Weareinturn,possessedandobsessedbythe archetypeswithwhichweidentify.Itsalmostlikewegettovoteforwhatwewant thoughourenergeticframework.Wethrowourweighttonewideas,trendsand fadsmakingthemforrealornot.Bygivingenergytothemassgroupofcollective unconsciousness,throughourthoughts,weprojectaharmoniousordestructive future. Certainlysomethingextraordinaryishappening.Andwehumansarecertainlya partofthisinterchangeofplanetaryconsciousness.TouseJohnWheelersterm,we liveinaparticipatoryuniverse!Somethingiscertainlyintheairvibrationwise.No matterwhatyoubelieve,thisisanexcitingtimeofcocreationforthehumanraceas webirthanewera.Weareengaged,backandforth,betweenhumanconsciousness andthebiggerpicturethatishappeningaroundus.Soitbehoovesus,eachofusthat makesupthecollective,tobecarefulastowherewhatbeliefsandwhatparadigms toputourenergy
2

TheHopiProphesies

IwilldrawfromtheHopitribeinNorthernArizona,oneofmyspiritualtraditions, toillustrateoneoftheseprophesies.FromtheHopis,calledthePeopleofPeace, comestheircreationmythwhichtellsofthebeginningoftheworld.Manyofthe creationstoriesfromtheindigenoustribeshaveasimilarflavorstartingwith NothingoraGreatVoidofwhichourearthandthebeingsweremadebytheCreator withsomeactofintentionandvibration.SomeofthetraditionssaythatLightwas thefirstactoftheCreator.

Genesis1:3.

AndGodsaid,Lettherebelight:andtherewaslight.

FrankWaterswasanotedwesternwriterwholivedwiththeHopiIndians.Hespoke withsomeHopielderstorecordtheirorallegendsinhisBookoftheHopi.He describedtheHopiCreationStorywhichissimilartothosefromotherindigenous cultures:FirsttherewasonlyEndlessSpace.TheCreatorTaiowaformed Sotuknang,hisnephew,whosetaskwastomaketheuniverse.Sotuknangcreated thefirstworldfromthatEndlessSpaceandmadeSpiderWomantoremainonearth andtakecareofit.Sotuknanggavethepeoplespeech,adifferentlanguagetoeach colorwithrespectforeachother'sdifferences.Hegavethemthewisdomandthe powertoreproduceandmultiply.ThenhesaidwithalltheseIhavegivenyouthis


3

worldtoliveonandtobehappy.ThereisonlyonethingIaskofyou.Torespectthe Creatoratalltimes.Wisdom,harmony,andrespectfortheloveoftheCreatorwho madeyou.Mayitgrowandneverbeforgottenamongyouaslongasyoulive.Sothe FirstPeoplewenttheirdirections,werehappy,andbegantomultiply." Butsomeofthepeoplewerenotpureofheart.Hopilegendhasitthattherehave beenfoursuccessiveworlds.Thefirstthreeworldsweredestroyedwhenthepeople becamewickedandfocusedonthingsoftheworldratherthanworshipingthe Creator.Whenthefirstworldofearthwasdestroyed,thepeoplewhohadbeen faithfultotheCreatorescapedtogoontolivewithpureheartsinharmonywith MotherEarth.Theyleftthroughaholeinthegroundcalledasipapuni,whichis calledthe"placeofman'semergencefromtheunderworld."Thesecondworld,the worldofair,waslikewisedestroyedwhenthepeopleturnedawayfromtheir essentialgoodness.ThethirdworldoffirealsounderwentdestructionandtheOne Heartswentforwardtoanewworld. TheHopibelievethatweareinthefourthworldwherewearebeingchallengedto liveanauthenticlifeinharmonywithourearth.Ifthepeopleofthisfourthworld becometooselfcenteredandturnawayfromtheirtruenature,therewillyetbe anothergreatworlddestruction.Thepeopleoflovingheartswillhavethe opportunitytogatheratthesipapunitoescapeintothefifthworld.Themessage fromtheCreatorhasremainedconsistentthroughoutthefourworlds:Takecareof MotherEarthandlivealifeofgoodness,generosityandpurity. AnancientpictoglyphontheHopireservationnearOraibi,ArizonacalledTheHopi LifePlanrecordsman'sjourneythroughoutlife.Thisdrawingetchedinrock representsthesoul'sjourneyinfindingthetruepath.Thispassagewayislongand treacherousandtherearemanyopportunitiestoleavethepath.TheHopis,along withotherindigenouspeople,believethatwhenpeopleliveinaccordancewiththe lawsoftheearthanditsnaturalrhythms,theytreadapathwaywithasurestep. Peoplewholeavethetruepaththroughselfishness,addictions,attachmentsand diversionsoftheworldmaybepulledawayontothefalsepathwhichisseductive andwinding. Thefalsejourneyleadstonowherebutselfdestruction.Therecancomeatimeof crisis,traumaorillnessinthepersonslifethatisrepresentedbytheforkinthe road.Thiscrisistimeisanopportunitytobecomelikeanewinfantandstartagain atthatpointturningbacktothetruepath.Atthattimeanindividualcanmakea choicetocontinueonthepathofdistractionanddiversionortoenteragainthat narrowpathofthetrueself,thePathofLife,whichissolidandleadstowholeness.

Wearebeinggiventhechancetoleavethematerialisticpathtopurifyourselves beforethisfifthworldchangecomesabout.
ProphecyRock

TheancientHopisweregivenaninesignsmessagethatpredictedthatgreatearth changeswerecomingandtheTimeofPurificationwascoming.Thetraditional eldersoftheHopitribehavereleasedtheirNineSignsofHopiProphecyto encourageustoprepareinourhearts.Althoughthereisspeculationfrompeople whoarenotNativeAmericanswhetherthisisahoaxornot,thefollowingmessage comesfromWhiteFeatheroftheBearClan,HopiTribe. TheNineSignsofHopiProphecy ElderWhiteFeather,elderoftheHopitribe,gavethefollowingprophecy: TheFourthWorldshallendsoon,andtheFifthWorldwillbegin.Thisthe elderseverywhereknow.TheSignsovermanyyearshavebeenfulfilled,andso fewareleft. FirstSign:Weweretoldofthecomingofthewhiteskinnedmen,like Pahana,butnotlivinglikePahanamenwhotookthelandthatwasnottheirs andwhostrucktheirenemieswiththunder.(Firearms)
5

SecondSign:Ourlandswillseethecomingofspinningwheelsfilled withvoices.(Coveredwagons,cars,etc.) ThirdSign:Astrangebeastlikeabuffalobutwithgreatlonghornswill overrunthelandinlargenumbers.(Longhorncattle) FourthSign:Thelandwillbecrossedbysnakesofiron.(Railroadtracks, telecommunicationwires) FifthSign:Thelandshallbecrisscrossedbyagiantspider'sweb.(Power andtelephonelinesandchemicaltrailsfromjetplanes) SixthSign:Thelandshallbecrisscrossedwithriversofstonethatmake picturesinthesun.(Concreteroadsandtheirmirageproducingeffects.) SeventhSign:Youwillhearoftheseaturningblack,andmanyliving thingsdyingbecauseofit.(twolargeoilspillsintheGulfofMexicoandSalt LakeCityandothersastechnologybecomesoldandgreedforprofitsis rampant) EighthSign:Youwillseemanyyouth,whoweartheirhairlonglikeour people,comeandjointhetribalnations,tolearnourwaysandwisdom. (Environmentalists,hippiesandspiritualseekerswhovisittheHopimesas) AndthisistheNinthandLastSign:Youwillhearofadwellingplacein theheavens,abovetheearth,thatshallfallwithagreatcrash.Itwillappearas abluestar.Verysoonafterthis,theceremoniesofmypeoplewillcease.(the InternationalspacestationthatwasknockedoutoforbitbyYclassflareor PlanetXpredictedtohittheearthcreatingmassivedestruction) ThesearetheSignsthatgreatdestructioniscoming.Theworldshallrockto andfro.Thewhitemanwillbattleagainstotherpeopleinotherlandswith thosewhopossessedthefirstlightofwisdom.Therewillbemanycolumnsof smokeandfiresuchasWhiteFeatherhasseenthewhitemanmakeinthe desertsnotfarfromhere.Onlythosewhichcomewillcausediseaseanda greatdying. Manyofmypeople,understandingtheprophecies,shallbesafe.Thosewho stayandliveintheplacesofmypeoplealsoshallbesafe.Thentherewillbe muchtorebuild.AndsoonverysoonafterwardPahanawillreturn.He
6

shallbringwithhimthedawnoftheFifthWorld.Heshallplanttheseedsofhis wisdomintheirhearts.Evennowtheseedsarebeingplanted.Theseshall smooththewaytotheEmergenceintotheFifthWorld. "ButWhiteFeathershallnotseeit.Iamoldanddying.Youperhapswillsee it.Intime,intime..." Manyoftheindigenoustribesoftheworldhavegatheredtosharetheirknowledge oftheupcomingearthchangesatthistime.TheHopisfurtherprophesize: Thattimeisnotfaroff.ItwillcomewhentheSaquasohuh(BlueStar)Kachina dancesintheplazaandremoveshismask.Herepresentsabluestar,faroff andyetinvisible,whichwillmakeitsappearancesoon.Thetimeisforetoldby asongsungduringtheWuwuchimceremony.Itwassungin1914justbefore WorldWarI,andagainin1940beforeWorldWarII,describingthedisunity, corruption,andhatredcontaminatingHopirituals,whichwerefollowedby thesameevilsspreadingovertheworld.Thissamesongwassungin1961 duringtheWuwuchimceremony. TheEmergencetothefutureFifthWorldhasbegun.Itisbeingmadebythe humblepeopleoflittlenations,tribes,andracialminorities.Youcanreadthis intheearthitself.Plantformsfrompreviousworldsarebeginningtospring upasseeds.Thiscouldstartanewstudyofbotanyifpeoplewerewiseenough toreadthem.Thesamekindsofseedsarebeingplantedintheskyasstars. Thesamekindsofseedsarebeingplantedinourhearts.Allthesearethe same,dependinghowyoulookatthem.ThatiswhatmakestheEmergenceto thenext,FifthWorld.

Noneofusknowexactlywhatmighthappenduringthistime.However,withthe massiveunrestinthephysicalstructureoftheearthandtheconflictthatis escalatingbetweenpeople,mostpeoplerecognizethatsomethingunusualis happening.Andsowecanprepareourselvesphysicallysothatourbodyis supportedthroughthepredictedearthchanges,butmoreimportant,wecanusethis timewehavelefttoprepareourselvesspiritually.Wecangetreadybybecomingthe bestpersonwecanbeinlivingourlifewithlovingrespectforourselvesandothers. Atthetimeofthiswriting,westillhavetimetobecomethepuretheOneHearts asdescribedbytheHopis.Purityistolivesimplyconnectedtonatureandtobekind toall.Wecanputourpsycheandourlivesinorder,sonomatterifpandemonium happens;wecandodailypracticesthatcreateclarityandcalmness. TheEvolutionaryUrge Alllivingthingsmanifestanevolutionarynaturetosurviveandbecomewhole.All lifeisvibration.Lifeemerges!Fromthebeginningofourplanet,thereisan emergentpropertytolife.Wehumansareevolutionarycreatureswhoarehard wiredtofollowthisevolutionaryimpulseforgrowth.Thisinherentimpulsein humansisongoingaswemoveintoamorecomplexconsciousness.Thedivineplan isforustounifyourbodyandmindandspirittoexpressandrestorewholeness.As wegrowspiritually,webecomemoreintunewiththisforcethatoperatestocreate agreatergoodintheuniverse.Wecanmakethisaconsciousevolutionbytuning intotheforcesoflovethatareavailablesothatourheartsanddecisionsbecome cleanandwholesome.Theconsciouschoiceistolove! Fortunatelywehavebeengivenevolutionarymodelsinourworldforpositive changeandachievingauthenticity.Theselfhelpmovement,therecoverymodelof AlcoholicsAnonymousandtheBuddhistlovingkindnessapproachallencourage takingresponsibilityforourthoughts,attitudesandbehaviorsandmakingloving decisions.Thedecisiontoputourselvesintoastateofloveraisesourvibration. AsDrunvaloMelchezidek,avisionaryguidewhoteachesusaboutgoingintothe sacredspacebehindthehearttopromotetheascensionprocess,remindsus,Love isthewayhome.Raisingyourconsciousnessthroughmovingintothehigher vibratorystateofloveisthebestpreparationforthiseverevolvingprocesswhichis beyondourcontrol.
8

Youarehereatthisplaceandtimetousetheextraordinaryideasofself transformationandhealingtobecomethebestyoucanbe.Youcanhealyourself withlove.Theuniversalityofthelovecanpourintoyourheartsifyouopentoit. WhetheryoucallthisoutpouringofloveGod,Light,Allah,GreatSpirit,theIAm, Source,theIAmPresenceorAllThatIs,thatdoesntmatter.Whatyoucallthishigh vibrationflowthisliaisonofthehearttoopentotheGreaterDivinethatlies withinisyourownpreferenceandmostlikelybasedonyourcultureand understanding.Itsnotthelabelthatmatters;whatsimportantisthatyourecognize andrespondtothiscalling.NurseeducatorandmysticMarciaWhitedescribedthis UniversalTruththatexistspasttimeandspace: Everyculturehasnamedit.Itendureswhenthenamesfalloutoffashion. TheTruthisalwayshere.Thecuriouswillfindit.Itsthereinthattinyspotin theheartthatopensuptoEverythingthatlittlelensthatopensuptotheBig Vista.Thereisneveranythingtofear.Fearisjustconfusion.Confusionis forgettingwhoyouare.Disturbingeventshappentogiveagreatreminder thatthereisaplacewherefearcanplayatthecenterofwhoyouare.The lessonsoftheheartconvergewiththeenergyofconfusionforyouto rememberwhoyouare. Themessageisclear:weareheretorememberandtolearnandgrow!Itistimeto gopastfearandconfusionandreawakentothosememoriesofwhoweareas spiritualbeings.ThisistheageofAscensionwherewehumansareremembering thatwearecocreatorsinthisevolutionaryurge.Thepurposeofthisremembering istodevelopconsciousnessforindividuals,forourcollectiveunconsciousofour planetandfortheentireplanetarysystem. Thetimeisnowtoreturntothehigherstateofconsciousnessweonceknew. Consciousness,whichcannotbeseenormeasured,ispartofalllivingthings.It assistsusinourunderstanding,purposeandfindingmeaningandapurposeful existenceintheuniverse.Consciousnessisthatpartofourbeingthathasthe capacityforselfreflectiontoengageinevolutionarygrowthtoconnectwiththe greaterwhole. Ourconceptualworldviewischangingrapidly.Thisallowsustomovetowardsa moreoptimisticworldviewandinterconnectednesswithall.Atthistimeofgreat opportunityinhistory,wearebeinggiventhecapacitytogobeyondthebeliefs rootedinfearthatkeepuscaughtinthesmallself.Wearebeinggivenmore information,morehelp,moreopportunitiesandnowmoreapproachestohelpus movebeyondjudgmentsandbeliefsthatkeepusseparate.InOneness,literally,we areallOne;wearepartofCreation.Nomatterwhatourage,race,gender,religion,
9

culturalheritageorspiritualpaththatwewalk,weareone;weareBeingsofLight andLove.

10

Chapter2 TheTimeoftheDivineMother
Ifthereistobeafuture,itwillwearthecrownoffemininedesign. SriAurobindo

TheancientphilosopherPlatosawthisworldinwhichweliveasashadowy imitationofagreaterworldthatistherewaitingforus.Heusedthemetaphorof comingoutofadimcavewherewecannotsee,tocomeintothelight.Weareso usedtothedark,theobscurethatweknownotthattherearedifferentrealities waitingthereforus.Weareinthedarknessofcaveundertheveilofenchantment, astheMaitraUpanishadssays,Asofenchantment,theyseetheFalseastheTrue. Sowhatisthisveilthatissupposedtobelifted?FromtheHindutraditionistheidea thatweareinaShaktiTransitionofdestructionwhichistoprepareusforanew existenceanewworldorder.TheShaktienergybringsinchaosfor transformation.Cataclysmispartofthepowerfulforcethattheuniversedestroys andbreaksapartsomeofitsorganizationsothatthenewcanbeformed.The creativeprocessthathasformedouruniverseneedstheenergyofcomingapartso thatwhateverwillbeformedcanhappen. And on a human level, we at times have to come apart to be reformed if we are to be transformed to seek our True self. Something new can come forth so we as a species can move forward. Chaos is needed to provide the energies to give birth to you truly are. So within all is this chaotic Shiva Shakti energy with its vibratory dancea dance of feminine movement which is connected to all of Creation. It is from fertile chaos out of which comes new birth!

11

Shaktithefemaledivineforcetorestorebalance

TheAgeofKaliYugaisthetimeofmakingtheshiftfromthefourthworldintothe next.ThemeaningofthewordsKaliYugaisdifferentfromKalitheGoddess.Kali Yugaistheconsolidatoroftheeraofstrifeanddiscord.Sheisthedarkmother,who decapitatesanddevourswieldingShaktisswordtobringdestructionsothat liberationcanspringforth.KaliYugaasanarchetypebringsaboutapredictederaof moraldescentandspiritualbleakness.Thisbreakdowncycleisnecessarysothat ourworldcanmoveintothenextstage.Whatwillbedestroyedisignorance! Fromhislifelongstudyofthesacredscripturesoftheworld,RobertCoxpredicts thattherewillbeadeclineinpeoplesegosandasthisphenomenareachesacritical mass,thatanewGoldenAge,anewageofTruth,iscloseathand.inaccordanceto universaldivinewillbytheinfluenceoftime.Coxexplainshowthistransformation willtakeplace: WeareinthelastdyingbreathofKaliYugaandthefirstawakeningbreathof anewGoldenAge.whentheforcesofLight,whichrepresenttheinfluenceof theSelf,willgainsuperiorityovertheforcesofDarkness,whichrepresentthe influenceoftheEgo,forthefirsttimeinthousandsofyears.anewGolden Agewillbeginforallmankind. Theveilcanbeliftedfromtheignoranceunderwhichwearelivingbothas individualsandasahumanconsciousness.AustrianvisionaryRudolphSteiner predictedin1925thatOrderwillnotarrivefromthechaosofthetimes;wewake upandchangeourselves.Alongwiththemanyearthchanges,theoldparadigmof individualandworldbasisfearbasedmentalconditioningiscollapsing.Our
12

sleepingconsciousnessthathasbeenseparatedfromtheGodSourceforeonsis reawakening.Manypeoplebelievethatweareconnectingwiththehelpofhigher dimensionalbeingstoradicallytransformourselvesandourplanetfromthe dominanceandpowerpatterntothefemininemodel. OurpsychehasbothamasculineandafemininesideasshowninthisTarotCard picture.TheSunandtheMoonaremetaphorswhichrepresentthetwohalvesofour brain.Theleftsideofthebrainrepresentsthemale,rational,logicalside.Thetwo halvesarelinkedthroughthecorpuscollosumwhichallowsinterchangeand completebrainfunction.

Forcenturies,ourworldhasbeenundertheinfluenceofadominantmasculine energy.Tobeofthefeminineenergyisofknowingness,feelingsandcaring.Itisof yearningofwhatgoodnessmaycome.Itisofwaitingtobeimpregnated.TheDivine Feminineconsistsofthebody,nature,earth,lifeandgrowth.Thisfeminineenergy thatiscominginwillleadourplanetbacktoadifferentencodingsystemandamass consciousnessarising. ThisistheriseoftheRadiantGoddessthoselovingfeminineenergiesthattakeus toournextstageofevolution.Thegreathopeisthatafteraperiodofshakeupfor ourplanet,therewillbeashiftintoaperiodofpeaceandacceptancecalledThe GoldenAge.Visionaryteacherandpoet,AndrewHarveyexplainedtheimportance ofcallinginthefeminineenergiestoourplanet: Unlessweawakentothemysteryofthesacredfeminineassacred,andallow ittoglowinto,irradiate,illumine,andpenetrateeveryareaofouractivityand createinthemallharmony,justice,peace,love,ecstasyandbalance,wewill
13

ThewordShaktiisfromtheSanskritshakwhichmeanstobeable.Shaktialso meansthesacredforceorempowerment.Itistheprimordialcosmicenergywhich representsthedynamicfemininecreativeforcesthatmovethroughtheuniverseto restorebalance.Ithasnobeginningandnoendandalternatesbetweenactionand resttoreestablishorder.IntheHindutradition,ShaktiistheGreatDivineMother whoisresponsibleforallcreationandchange.Shaktihasmanynames.AsDurgaor Kali,sheistheUniversalMotherpromotingchangeaseverchangingcreator, preserveranddestroyer.ByfocusingonthefemininenatureoftheShaktienergy thatflowsthroughourbodywecanrestoreinnerbalance. IntheseventhcenturytantrictraditionofVijananaBhairava,pausesinthebreath canbeusedtocarrydeepawarenessinside.Sotoconnectintothesegentle,yet strongandswiftenergies,heresabreathingapproachfromspiritualteacher HarshadaDavidWagnertoworkwiththesubtledynamicsofthebreathinsteadof merelywatchingit. FocusingoftheDivine:ShaktiBreathingMeditation HarshadaDavidWagner Asthebreathgoesinandout,thereisapauseastheexhalationbecomesthe inhalationandagainbeforetheinhalationbecomestheexhalation.Ifonefocusestheir attentiononthesepauses,thenatureofBhairavawillberevealed.Thisnaturalpause betweenbreathshappensagainandagainthroughoutourdayoverandoveragain. (Mostpeopletakebetween1025,000breathsperday.) Asyoumeditate,putyourattentiononthepausesbetweenthebreathsandfollowthe energeticcurrentsofinhalingandexhaling.Insteadofholdingthebreath,noticehow thebreathattimesnaturallyslowsorbecomesshallowandsubtleasyoubreathein andout.Thinkaboutbeinggentlyrelaxedwhileplacingyourattentionintothe powerfulfeminineenergyofthosesubtlepauses.InthisancientHindutradition,the
14

dieoutandtakenature,oralargepartofitwithinus.Unlesswecometowhat thesacredfemininereallyisitssubtletyandflexibility,butalsoits extraordinarilyruthlessness,radicalpowerofdissolvingallstructuresand dogmas,allprisonsinwhichwehavesoughtsopassionatelytoimprison ourselveswewillbetakeninbypatriarchalprojectionsofit.TheDivine Mother,thefullnessoftherevolutionthatsheispreparingwillbelosttous. Wemustunderstandthatcomprehendingthesacredfeminineisacrucialpart ofsurvivingthenextterriblestageofhumanity.

sweet,gentlerhythmofthebreathcanpaveapathwaytoknowyourtrueDivine nature.ConsciousbreathingmeansrememberingyourintimateconnectionwithGod witheachbreath. Wagnerexplainsfurther,Throughtherelaxationofourbodiesandthedeepening tranquilityofourmind,thebreathbeginstopausespontaneously.Thespaces betweenthebreaths,ontheirown,becomelongerandmoreprofound.Momentto momentwedipdeeperanddeeperintowhatthedharanareferstoasBhairavithe goddess,theShakti,thenatureoftheAbsoluteBhairava.Letgointothatenergy containedinthepauses.WhentheShaktiisretainedoutsideaftertheexhalation andinsideaftertheinhalation,itbecomestranquil.Afterward,asaresultofthis peace,Bhairava,theSupreme,isrevealed. FindingDiscernmentintheMidstofConfusion Nooneknowsforsurewhatwillhappenduringthenextfewyears.Much speculationandsensationalismabounds.Everythingseemsupforgrabsandaswe cannotreadthefuture,itsallconjecture.Humansseemtoneedtoconstruetheir realitytofittheirdeepestbeliefsandconsciousnesslevel.Onepossibilityisthat therewillbenointenseupheavalordestructionofourplanet.Idoknowforsure thatwhetherthereareimmenseearthchangesornot,increasingtheloveinyour lifeisagoodbet.Thisisnotthetimetoengageinthemuckorfearofwhatmight happen.Nomatterwhathappens,youcanchoosetobeabetterperson,groundedin love. Sowhattobelieveinthistimeofmediaandinternetinformationoverload?Howdo youchoosewhentherearenumerousideologiesandtheoriestochoosefrom?Lets gotothewisewordsattributedtotheBuddhawhenapproachedbyhisdisciples abouttheirconfusionofwhichteachingstoaccept.Thispracticaladvicefromthe Buddha,oneofthemajorteachersofourplanet,stillholdstrue. Donotbelieveinanythingsimplybecauseyouhaveheardit.Donotbelievein anythingsimplybecauseitisspokenandrumoredbymany.Donotbelievein anythingsimplybecauseitisfoundwritteninyourreligiousbooks.Donot believeinanythingmerelyontheauthorityofyourteachersandelders.Donot believeintraditionsbecausetheyhavebeenhandeddownformany generations.Butafterobservationandanalysis,whenyoufindthatanything agreeswithreasonanditisconducivetothegoodandbenefitofoneandall, thenacceptitandliveuptoit.
15

Thethingtorememberisthatdoomisnotapermanentcondition.Therehavebeen massiveshakeupsbefore.Humanshavebuiltinmechanismstosurvivetheshort termtempestuoustimes.Theonlythingthatispermanentthatisongoingthrough allagesandtimesislove.Loveisthewaytoassureourpassageintothistime. MysticalwriterKenCareyrelateshisteachingsofturninginwardandtrustingyour abilitytoloveduringthesetransformationaltimes: ThiseventwillbeofgreaterpowerthananytheEarthhaseverseen.More energywillbereleasedinaveryfewmomentsthanistypicallyreleasedupon thesurfaceoftheEarthinmanyyears.Thisenergywilltaketheformof heightenedperceptionanddeepenedemotionalconnection,rejoiningthe individualandGod..Younowhaveallyouneedtoreleasetheconditioningof history,andridetheascendingwaveofconsciousnessbeyondthespellof matterintoanawakenedlife." SeparatingtheTruefromtheFalse Discernmentisnecessarywhenfacedwithnewconceptsandpossibilitiesduring timesofgreatchange.Someoftheinformationbeingpresentednowfromthe doomsdayspeakersisbasedonoldfearmessagesasameanstocontrolthemasses. Someideasareputforthasreligiousdogmathatsaysyouaredoomedifyoudonot followtheirowndictates.Exclusionaryracial,religiousandpoliticalbeliefsdonot enhancethecauseoflove. WhatistheTruthofthisage?Arethesetheendtimesorthebeginningofsomething brandnewandshiny?RalphWaldoEmersonspeakingseveralcenturiesagoput forththisadviceapplicabletoalltimes:Ourlivesareanapprenticeshiptothetruth thataroundeverycircleanothercanbedrawn;thatthereisnoendinnature,but everyendisabeginningthatthereisalwaysanotherdawnrisenonthemidnoon andundereverydeep,alowerdeepopens. Advancementbythesoulisneveraccomplishedthroughfearconditioning;we humanshavehadcenturiesofthatalready.Wemusteachseekoutourowntruth. Herearesomeideastodifferentiatebetweenwhatistrueandgoodwiththeglutof informationthatisoutthere. Whenquestioningsomenewideaortechnique,includethesimpledirective fromGandhiaboutacceptingonlythatwhichsupportslife.Thereisaquote from modern-day spiritual teacher, David Hawkins that inspires hope: the capacity of the human organism to differentiate not only positive from negative
16

stimuli, but also anabolic, meaning life-enhancing, from catabolic, meaning lifeconsuming, and most dramatically, true from false. Addtheheartfeltinstructionaboutwhethertheteachingaddstothelovein yourlife. Asktheimportantquestionofwhethertheideas,teachings,techniqueor healingapproachcomesfromfearorfromloveconsciousness. Doestheapproachincreaseyourinnerstateofwellbeingandwellness? Doesithelpyougetintouchwithamoreprofoundpartofyourselftogivea deeperunderstandingoftheconsciousnesswhichisconnectedtothe Oneness? LooktothelovingnatureandaskasanthropologistCarlosCastanedadoes, Doesthispathhaveaheart?Thistimeofgreatopportunityisembracedby unconditionallove. ThisisaTimeofPreparation

Allhealingisatransmissionoflightandinformation.LightisthelanguageofGod, saidwriterGregoryDavidRoberts,lightmaybethewaythatGodspeakstothe Universeandtous.Thepreparationprocessofthecocreationweareexperiencing nowisaboutlearningtoradiatethemostlovethatyoucan.Informationthatis storedinyourcellsdowntotheatom,protonandDNAlevelscanbeaccessed. Wearehardwiredforhealing.Loveisthebridge.Asthisisatimewithpeople polarizingaroundtheirbeliefs,spiritualwriterontheascensionprocess,Joanna Cherrysuggestsfindingapassionthatfocusesonlove: Ascensionisourreturntothisunlimitedstate.Itisourdivinityfeltand expressed,onthisplaneoralighterone.ItisBEINGwhoweare:joy,love,life, light..Justhowdoyouascend?Firstofall,intendtoascend.Thenfollow yourheart,yourjoy,yourlovethesearedirectlyconnectedwithyourtrue self.Doessomethinginspireyou,exciteyou?Dothat!Youarelovedand supportedindoingit;useyourpracticalwisdomtobridgeyouroldwayswith yournew.Forgiveyourselfforeverythingpast,presentandfuture.Love yourself,youreverythought,feeling,andactionasquicklyaspossible.Loving youranger,forexample,turnsitgraduallyintolove.Healyourrelationships.
17

Embraceeverythingthathappensasfullyasyoucan,knowingyoucreateeach experienceasamirrortolearnfrom.Loveeveryonearoundyoueveryone asmuchasyoucan.Discoverorreinforcehowyouwanttogivetotheworld; thiscanbeanyform,aslongasyourloveisincludedinthegiving. Inpreparationforthistimeofearthchanges,focusonbecomingyourownhealer. Yourchoicetoengageinselfhealingconnectsyoutotheenergiesthatassistthe Ascension.Yourbecomingahealerofyourownmindandbodyandanyunhealthy lifepatternsispartoftheoveralldesignforconsciousness.Wearebeinggivennew practicalwaystosupplementtheancientpracticestopreparefortheshiftin consciousnessofhumanity.Thelowervibratoryenergiesofhumansandthe Universeareshiftingtoahigherandinterdimensionalconsciousness. Thisisatimeforhumanstostepuptotheirindividualcocreationprocesstomove fromfourthdimensionalconsciousnesstofifthdimensionalconsciousness. DrunvaloMelchizedekremindsus, YouareOnewiththeCreatorofthisuniverse,andyoualwayshavebeen. ThereneverhasbeenatimewhenyouwerenotOne,andthereneverwillbea timewhenthisisnottrue.BecauseyouandIareOnewiththeCreator,you andIcanpersonallychangetheworldandbringpeaceandbeautytothis entireplanet.Butyoumustchangeyourselffirst.Yousimplyhaveto rememberwhoyouwerebeforeyoufellintothisverydarkplace. Wearetodoourpartwiththeintentiontobeherefully,tobepresentinthis incarnation.ThemysticpoetJelaludDinRumigaveusinstructionsforawakening severalcenturiesago: Thebreezeatdawnhassecretstotellyou. Dontgobacktosleep. Youmustaskforwhatyoureallywant. Dontgobacktosleep. Peoplearegoingbackandforthacrossthedoorsill wherethetwoworldstouch. Thedoorisroundandopen, Dontgobacktosleep. Sowakey,wakey!Thisisatimeofrecalibration.Loveisthewaytoascend.

18

19

Chapter3 TheLanguageofLoveandLight
Everythingultimatelyisjustpatternsoflightandinformation. RichardBartlett

Healingisanexchangeofvibrationsandenergytoachieveselftransformation. Everythingintheuniversehasacharacteristicresonanceorfrequencyconsistingof lightandinformation.Resonancemeansthenaturalfrequencyatwhichanobject vibrateswhichgivesthebasisforhealing.Theconceptofhumanresonanceisbased ontheideathatlikeattractslikeandpeopletuneintothesamewavelengthand vibetogetherinunison.Humanshaveabuiltinresonancedetectorsforgoodorill. Wefallundertheinfluenceofthosewearearoundandcanbecaughtupintheir energeticresonance.Wealsoresonatewithcalm,soothingenvironmentsorharsh, discordantones.Resonanceiswhyspiritualpeopleenjoyspendingtimeincalm, lovingsettings. Indeedthedifferentsystemsofourbodiesreverberateinresonance.Soundhealer, JonathanGoldmanexplainshowourbodiesandtheveryorgans,tissuesandcells aremadeupoftheirownfrequencies, Togethertheymakeupacompositefrequency,aharmonicthatisyourown personalvibratoryrate.Youhaveyouruniquevibratorysignatureandeachof theorgansandsystemsofyourbodyhasavibratorysignature.Through resonance,itispossibleforthevibrationsofonevibratingbodytoreachout andsetanotherbodyinmotion.Justasitispossibletosetanobjectintoits ownnaturalmotionthroughresonance,soitispossibletorestorethenatural vibratoryfrequenciesofanobjectthatmaybeoutoftuneorharmony.When anorganoranotherportionofthebodyisvibratingoutoftune,wecallthis disease. Theenergiesofthephysicalorgansgooutofbalanceduringatraumaexperience whenthereishighemotion.TraditionalChineseEnergyMedicinegivestheneeded informationonhowtobringthebody,mindandspiritbackintobalance.Allhealing isselfhealing;itisaresponsetoadeep,innerneedthatcallsoutforinformation. Emotionscarryvibrationsandinformationalpatterns.Distortedthinkingpatterns anduncomfortableemotionscreateenergeticinterferencesandcongestionthatare notconsistentwithsupportinghealthandlife.Assymptoms,theycomeforthtobe recognized.Symptomsseekrestorationtothestateofhealth.
1

Emotionalsymptomsaremarkersthatsomethinginyouthatisrequestingattention andchange.Theyareanindicatorthattheenergiesinyourbodyareoutofbalance andyouhavesomeerrorinthinkingtochallenge.Thisisthewarningfunctionof fearortheyoohoo,lookhereforsomethingthatwantschanging.Feeling overwhelmedandoutofcontrolandhavelimitingbeliefsandexcessesofnegative feelingsaresignalsfromTheWhateverinYourLifeThatisNotWorking! Uncomfortablefeelingsaremerelysymptomsthatsomethingneedstobeexamined. Soseeyoursymptomsasanopportunityforrelease.Peter Levine, author of Walking the Tiger, Healing Trauma, says, Trauma is a fact of life. It does not, however, have to be a life sentence. Not only can trauma be healed, but with appropriate guidance and support, it can be transformative. Levine gives a set of techniques called Somatic Experiencing (not given in this book) for releasing residue tension held in the body after highly upsetting events. Thegoalofhealingistogetallcells,tissuesandorgansinresonancewiththe universalhealingresonanceoflove.Besideshavingyourowncomplexvibratory signature,youareaninformationalsystem.Thewordinformationcomesfromthe Latinwordinformarewhichmeansshapeorform.Informationistransmittedby frequencyresonancestobringthesystemtoorder.Youandalleverythingaround youarevibratorypatternsoflightandinformationthatcanreceivethenecessary intelligenceandknowledgetoheal.Yourbody,mindandspiritcandrawthose necessarylightandinformationpatternstoshiftlowervibrationalenergies.This languageofloveandlightcanmoveusthroughthedissonanceoftheoldwaysof doingthings.Itistherefortheasking. AcceleratedAssistanceApproachestoClearEnergyBlockagesforthisTime Manyofthesetechniqueshaverecentlycomeintoourplanettohelppeopleclear theirconstrictionsofenergysothatitcanflowfreelythroughtheirentirebody.We arefortunatethatthisseedingofnewconceptsandtechniquesarebeinggiventous atthistimetoallowtheneededenergyshifts.Ofcoursethesetechniquesarereally notnewbuttheyappearnewtousaswearerememberingthemfromothertimes. TheHigherForcesofLoveareassistinguswiththisinformationsothatwecan morefullyincarnateintoourphysicalbeing. Thenewparadigmshiftweareinnowgivesmanyoldandnewvariedhealing techniquestohelpyoutransformtoyourfullestpotential.Ivegatheredsomeofthe bestavailablehealingtoolsandtechniquesfrommanypsychologicalandspiritual traditionstohelpyouraiseyourawarenesstoassistyourconsciousevolution.
2

Theseprotocolscreateselfinducedgoodfeelingsanddischargeimportant neurotransmittersthathavebeenprovenbyresearchersfrommanydifferent approachestocorrespondwithbettermentalandphysicalhealth. Healingtoolspracticedregularlyreducestrongemotionsaboutyourtroublesand providerestorationofemotionalbalance.Negativeemotionscarryelectromagnetic energiesthatcreateenergeticimbalancesinthebody/mind/spirit.Emotionalissues thatarenotaddressedcauseacontractionoftheenergyflowwhichrestrictsthe overallvibrationalleveloftheperson. Learningtheskillsofemotionalregulationhelpscalmyourmindtocounteractthe frenzyofmodernsociety.Theseenergysystemrebalancingexercisesgiveninthis bookbreakintotheseenergeticinterferences.Theyhelpyouletgoofassumptions, judgments,worry,anger,fears,selfdestructivebehaviors,andolddysfunctional familymessages.Theyhelpbalanceyourbrain,calmyouremotionsanddischarge erroneousbeliefsandwillbringmoreharmonyandjoyintoyourlife. ThePathtoEnlightenmentisAlwaysunderConstruction Thehealingritualsaidyourlifebydrawingfromtheunifiedconsciousnessto releaseenergeticblockageswhichinterruptthenaturalflowtocomplexity. Approachesbasedonincreasingthelovewithinkeepyoufocusedonwhatistruly importantinyourlife.Theybecomecatalysts,activatorsandacceleratorstoprepare yourbody/mind/spiritforthisongoingevolutionalprocess.Thetechniques presentedhereareinformationalmodelsthattransmitdatatohelpaddressany unrestandconfusionaboutwhoyouare.
__FocusingoftheDivine:ShaktiBreathingMeditation __ExpansionBeyondEgo __AccessingtheSmall,StillVoiceWithin __AlternateNostrilBreathing __The4:1Breath __ConnectingHeavenandEarth __PurificationBreaths __TheSADSTechnique __TheSeaofTranquility __TappingtoReleaseFamilyThemes __ClearingSoulContracts __InnerFocus:Spaciousness_ __HeartMathCoherence __SteppingBackBehindYourMind
3

__AskandReceive __ThymusThumpwithLaughter __InnerChildWork:EnergyFragments __BreathingforSurvival __BreathRhythmstoFacilitateLettingGo __BreathingEarthandSky __TheEmotionalFreedomTechnique __SpinalReleaseTechnique __ChallengingUnsavoryCoreBeliefs __ReleasingThemesOtherDimensions __HighFrequencyDownload __TuningintotheChristConsciousness __HeartMathFreezeFrame

Ofcoursetherearemany,manyotherhighlyeffectivetechniquesandapproaches outthereforyoutotryandexperience.IvechosenonesIknowthatareeasily interpretablethroughthewrittenword.Findthetechniquesthatworkforyou. Learnmultiplewaysofreleasinganxiety,depressionandangerthatinterruptyour calmsenseofself.Settheintentionthattheverybestoftechniquesandpeoplewho canassistyouwithhealingwillcometoyou. JustDoDontGointoOverwhelm! Whichofthemanytechniquesgivenhereshouldyouuse?Doesntmatter,theyall work.Trytheonesthatyouareintuitivelydrawntowards.Ifyoufeeloverwhelmed bythesheernumberofexerciseshere,thentakefeelingoverwhelmedasyourfirst emotionandissuetowork.Tellyourself,EventhoughIfeeloverwhelmedbythe amountofworktodo,feelingoverwhelmedisjustanotherfeelingtobeworked through.ThatremindsmeofwhenIfirstfeltoverwhelmedwhen_____andstart fromthereusinganyofthetechniques.IdsuggestyoustartwithTheEmotional FreedomTechniqueduetoitseaseoflearningandusing. Firstthingsfirst!Feelingsarejustmeanttobenamed,feltandthenworkedand released!GiveyourselfabiggiftaNoOverwhelmedPolicy!Thispolicybidsyou todosomethingwithyourfeelingsinsteadofjuststewinginthem.Ittakesyouout offeelinghelplessnessandmovesyouintoaction.Thissimplepolicyisthefirststep todealingwithwhateverchaosmaycomeregardingearthchanges. Helpisthereforyou!Youcancallonyourangels,spiritualguidesandfromallthat youbelievetoassistyouinmakinghighervibrationalchoicestorecalibrateyour energiestomoveyoufromthefourthdimensiontofifthdimensionconsciousness. Bringingyourselfdailytothehighervibratorystateoflovehelpsyoualignwith thoseenergiesthatbringorderoutofchaos.Themoreyoukeepyourmindinthe vibratorystateoflove,themorepreparedyouwillbeforwhatevercomesyourway duringtheseexcitingtimes.Clearingofbeliefsthatdonotsupportlifeandemotional blockagesequalstherisingofvibrations. Thisisamajortimeinhistoryandyouplayabigpartinassistingwithwhatisto come.Youareakeyplayerinthisascensionprocess.Youcanmakethechoicetobe proactiveinchoosinghealingtoshapeyourowndestinyandindoingso,put yourselfintunewiththegreatforcesofchange.

Manyofthesetoolsgiveninthisbookarenoveltreatmentsthataffectthecortical andlimbicbrainareastoassistwithemotionalregulation.Bychoosingtoaddress lifesstressorsandnegativethoughts,youbecomeanactiveparticipantin developingyournewidentity.Bysettinganintentionforconnectionwiththe highestgood,youcanconnectyoursubconsciousmindwithlightandinformation fromUniversalconsciousness.Donerepeatedly,thesetoolsofferaprocesstoalign andattunewithOneness.Consciousnessrisesbydeterminationandbydesignby makingthechoicestotakeyourhealingseriously. Ifyouareasensitive,feelingtypeofpersonwhoregularlyexperiencesfear,anxiety, depressionoranger,thesemindcalmingexercisesaretailormadeforyou.They workontheprincipleofdesensitizationtoreducedistressandcalmtheheartand mind.Theycorrecterrorsofthinkingandthefearbasedthoughtsthatfuel depression,anxietyandanger.Theyhelpyouselfregulateyouremotionstobring youbacktoacalmplace. TheIntelligenceBehindtheStrangeTerrorandBeautyofyourFeelings Yourfeelingsarebrilliantteachers.Focusonthesensitivityofyourfeelingsasbeing yourteacherswhoshowyouwhatyouneedtolearn.Followthelabyrinthofyour feelingsasyougodeepertotheinnermostplace.Callthemoutandgivethema name!Observewhatyoudotointerruptdistressingfeelingsandthoughts;theyare defensivecopingpatternstoavoidthemorevulnerablefeelingsthataskfor recognitionandrelease. Philosopherandresidentmysticofourplanet,KenWilberremindsusthatwecant escapefromuncomfortablefeelings:Thus,ultimatelytotrytoescapeadistress merelyperpetuatesthatdistress.Whatissoupsettingisnotthedistressitself,but ourattachmenttothatdistress.Weidentifywithitandthataloneisthereal difficulty.ThisconceptiscommonlyexpressedinWhatyouresist,persists! Manypeopledonotknowthattheycanreleaseuncomfortablefeelingsthroughthe useofpsychologicaltechniquesthatareeasytolearnanddo.YoucanUSEthese quietingtoolstoworkyouremotionsinsteadofmuddlingthroughlifeandexpecting peaceofmindtofindyou.Foroptimumchangedoseveralofthesetechniquesevery day.Severaltimesadayisevenbetter!Mixandmatchavarietyofthemfromthe differentspiritualandpsychologicaltraditions. Youmightwonder,dothesetechniqueswork?Allapproachesworksomeofthe timesomeoftheissuesforsomeofthepeople.Sometechniquesworkbetterthan
5

others.Someworkbetterforcertaintypesofissues.Someworkbetteratcertain timesofyourlifewhenyouareopenandripeforchange.Thesetechniquesalldo work,butonlyifyouworkthem.Andrepeatthemenoughsothatyougettothe bottomofyoursymptomorissue.Themainthingistodosomethingtoreleaseyour unpleasantemotionsanddistortedbeliefssothatyoucangetbacktotheloving personyouarethathidesundertheintensityofyourproblems! Startwithonetoolgivenhereandifthatdoesntchangehowyouviewyour problem,repeatitasecondorthirdtime.Thenifyoudontfeelbetter,goontothe nexttechnique.Thinkofthisashavingmanyhandytoolsinyourtoolkityou wouldnttrytosawaboardwithahammer.Soifoneapproachdoesnottakecareof yourproblem,goontothenextandthenthenext.Trythemall.Someareeasier thanothers,somearequickeranddeeper.Theyareallvalid.Youwillfindsome techniquesthatyoulikebetterandsomethatfitmorewithyourorientationor interests. Skipthetoolsiftheyhaveconceptsyoudontbelieveinoralternately,givethema tryjusttoseewhathappens.AsGaryCraigsaysofhisEmotionalFreedom Technique,Canthurt,mighthelp!Stayopentolettingnewinformationcometo youasyougrowinyourspiritualprocess.Learnandpracticehealingtoolsregularly. Allyouhavetoloseissometime.Andperhapsyourissues. PlayItForward!FuturePacing FuturePacingfromNeurolinguisticPsychologyisvisualizinghowyouwouldliketo actandbeinthefuture.Aftercompletingeachexercise,thinkofhowyouwouldlike tobe.Gooutofthepresentjustforamomentandseeyourselfdifferentlyinthe future.Afterfinishingaprocedure,spendoneminutevisualizingpositivechange throughrehearsinghowyouwanttobeinthefuture.Visuallyrehearsingawanted behavioranchorspositiveresources,opensupnewsynapsesandinstallsnew neuralpathwaysinthebrain.FuturePacinganchorstheenergeticimageinyour body,mindandspirit. Manyofushavespentalifetimeputtingnegativepicturesinourminds.The antidotetonegativityistocreatepositivevisualizationsofhowwewantourlifeto be.Youcanusethepowerofyourimaginationtoseethechangethatyouwishto achieveforyourself.Therearemanypossibleoutcomesofanysituation.Create consciouspicturesofchangeandyouwilldrawthatoutcometoyou.

Theseheartinfused,emotionalregulationtechniqueswork,butonlyifyoudothem! Youaretheonlyonewhocanliftyourselffromcontinualthoughtsofdepression, anxietyorirritability.Youaretheonlyonewhocangiveyourselfpeaceofmind. Giveyourselfthebestadvantagepossiblethroughdoingdailyhealingpracticesto createaharmonious,lovinglife. PracticeMakesPermanent! Healingisbothascienceandanartthatcanbestudiedandunderstoodand,likeany otherskill,requiresincreasedpracticeforproficiency.Repeateachnewtooluntil youhaveitdownpat.Makeyourfavoriteproceduresahabitthatcomesup automaticallywhenyouarefeelingcrushedoroverwhelmedorbesetwithfearful, sadorangryfeelings.Practice,practice,practicetheseapproachesuntiltheyare overlearnedandcomeupanytimeyouhaveanoutofsortsfeeling. Createadailyritualtostartyourdayinpeaceandharmony.Practicingpositive ritualsforchangearepartofbecomingaloving,calmperson.Youcansetyourself freefromunwantedbeliefsandemotionsifyouarewillingtotakethetimetodothe work.Whenyouareupsetorcaughtinanunproductivemood,dooneormoreof thesereleasetechniques,thenspendsomequiettimecenteringwithawareness. Learntodancewiththechaosandthenslipthroughitbacktoyourpeaceofmind. Theresnovalidexcusefornottakingcareofnegativethoughtsandemotionsas theyariseduringyourday.Nothavingtimeisnotanexcuse.Thesetoolsfor spiritualawakeningonlytakeafewminutestocomplete.Addingoneortwotoyour dailyscheduleperhapsinthemorningandeveningwillgiveyouagreatreturnon yourinvestmentoftime.Thebusiestpeoplemaketimeforstressandanger managementandspiritualenhancementtools.Theyactuallygainmoretimeasthey dontfrittertheirtimeandenergyawaybycavingintostress.Theycommitto spendingalittletimetogaininnerpeace.Practicedregularly,thesehealing approacheswilltransformyourlifeanddestiny.

Chapter4 HealingattheSoulLevel
Thesepreparationtimesareabouthealing. Healingisyourjob,yourresponsibilityandyourbirthright. Anonymous

Youcanshapeyourdestinyduringthesetimesofindividualandplanetary ascension.Thepurposeofallhealingandalltechniquesistoaccessthelovethatis within.Youcanlightenyourheavyemotionalloadtopromotedesiredchange.With yourrequestedintentionforbringinginthehighestconsciousnesspossible,youcan drawfromthelightandloveofUniversalConsciousness. ItslikeplayingpingpongwiththeUniverse;youhavetotakeaimandmakethat firstservebeforegoodthingscomebacktoyou. Healingispossiblenowforyourbody,mindandspiritwhenyoubringforthenergy fromthehighestlevelsofCreation.Ittakesenergytochangeconsciousnessandthis energyisavailabletoyounow.Allyouhavetodoisavailyourselfofthegreatinflux oflightandinformationthatisbeingprovidedforusfromSpirit. InMatthew7:78,theBiblequotesJesusassaying,Ask,anditwillbegiventoyou; search,andyouwillfind;knock,andthedoorwillbeopenedforyou.Foreveryone whoasksreceives,andeveryonewhosearchesfinds,andforeveryonewhoknocks, thedoorwillbeopened.Higherstatesofourconsciousnessalwayshaveanswers; theyalwayshaveabiggerpictureandcanincorporateahigherperspective.Andyou canalwaysaskforwhatyouwant. Ifyouknowtoaskthequestion,theansweriswithin.Sometimesyoudonthave accesstothisstoredawayinformationorarenotreadytoaccepttheanswer.We alreadyknoweverythingweneedtoknowaboutanyproblem;onsomelevelthe answeristhere.Sometimesweneedtoturnissuesovertothedeeperaspectsof ourselvesthatarenotcaughtupinresistance.

HereisashortenedversionofalovelytechniquecalledAskandReceivedeveloped bypsychotherapistsSandiRadomskiandThomasAltaffer.(Iaddedtheselfdoubt statementafterexperiencinghesitancyinsomeclientsabouttheirsubconscious mindsabilitytogetanswers.)Thecompletemanual,whichfeaturesmuscletesting, explainshowtoaddresspasttraumaswhichmayinterferewithyourreceiving informationcanbepurchasedfromwww.askandreceive.org/.Thisgentleapproach putsyouintouchwiththeHigherStatesofyourbeingandyoursubconsciousmind tobringawarenessthatyouhavealltheanswersyouneedisinsideyou. Thistechniquebringsyoursubconsciousmindonboardtoassistyouinfindingthe solutiononcetheanxietyaroundtheproblemisquieted.Itcangiveyouthe knowledgethatyoudohavetheabilitywithinyourselfandthattheanswerwill presentitself.Thefeltsenseisthattotalbody,mindandspiritconfirmationthat comesfromdeepwithin.Listenforthesensationsaroundthatdeepknowingwithin thatsignalsthattheansweryougetiscorrectforyou.Bestill,listenandknow. Doingthisquickprocedureempowersyoubyremindingyouthatallthatyouneed reallyisinsideyourself.Hereisashortenedversionoftheirprocedure. AskandReceive SandiRadomskiandThomasAltaffer Thinkofanissuethatconcernsyou.Determinelevelofintensityoftheproblemfrom onetotenwithtenbeingthemostdistressandonebeingasmallamount.Youcando muscletestingonyourself(thisprocedureisbeyondthescopeofthisbook.) Or,youcangetaninneranswerasyoufeelashiftinyourbodyasitrelaxeswhenyou getayesanswerwhichsignifiesagreementwithastatement.Youwillfeelyourself resonatingwithwhatyouhavejustsaidasifitisreal.Youmayevenfeelrelief.Youcan hearorsensethewordsYesorNo. 1.Sayoutloud,Mybody/mind/spiritknowshowtohealthisissue.Takeadeep breathandletitoutslowlyandlistenforananswer. Yes/No a. Ifananswerdoesnotcomeforth,yourselfdoubtorhesitancybecomestheissue. SayMybody/mind/spiritknowshowtohealtheconfusion/doubtorhesitancyabout whetherIknowtheanswer. Yes/NoGobacktostepl. b. Ask,Isthereanunderlyingtraumathatneedstobeworkedbeforegainingthe answer?Ifso,thistraumabecomestheissuethatasksforhealing.UseAskand
9

ReceiveorTheEmotionalFreedomTechniquegivenlaterinthisbooktoclearold stuckemotionsandbeliefsaroundthistrauma. 2.Ifyes,trytoaccessthefeeling.Trytofindtheplaceinyourbodywheretheproblem residesbylookingforatensionpattern. 3.Therearepartsofmybeingthatalreadyknowhowtohealthisissuewithgraceand ease. Yes/No 4.ThesepartsofmybeingareWILLINGtoinformtherestofmenow. Yes/No 5.Mymind/body/spiritisreceivingthisinformationnow. Yes/No 6.Thisinformationtransferisnowformulatingandis/willbewholeandcomplete.Yes/No 7.Say,Iamthankfulforthishealing. Determinewhatlevelofstressyouhavenow.Repeatexerciseseveraltimesif necessary. Whenyouareintouchwiththatdeepinnerknowingofthecorrectactiontotake, yourenergyisenhanced.Yourunconsciousmindhasgreatgiftsforyou;itcanshow youwhatyouneedtoheal. TheSoulConnection WecanconnectwithoursoultointensifythereminderthatweareDivineandareat onewitheverything.AliceBaileyquotingtheTibetanMastersaid,Nothingunder heavencanarresttheprogressofthehumansoulonitslongpilgrimagefrom darknesstolight,fromtheunrealtothereal,fromdeathtoimmortality,andfrom ignorancetowisdom.InEsotericHealing,Baileywrote,"Alldiseaseistheresultof inhibitedsoullife.Thisistrueofallformsinallkingdoms.Theartofthehealer consistsinreleasingthesoulsothatitslifecanflowthroughtheaggregateof organismswhichconstituteanyparticularform. Thechoicetotakeourhealingseriouslyallowsustobecomeresonantwiththe knowingaspectsofourselvesandthatofthegreaterUniverse.Wehavebeentoo longseparated.Thisisatimeofintegrationrightandlefthemisphereintegration, consciousandsubconsciousmindintegration,chakrasandenergyfieldintegration andbody,mindandspiritintegration.Thisisamostmagnificenttimeofevolution
10

asweadvancetowardsUnity.Withpracticeandintention,youcanbecomeahealer foryourselfandyourfellowhumanbeings.Thisisthetimeofconsciousnessby design,consciousnessbydestiny.Yourselftransformationatthesoullevelisapart oftheoveralldesignfortheshiftofconsciousnessforourplanet. Continuousdismantlingoftheegoisoneoftheclarifyingapproachesforjourneyers onthespiritualpath.Thefeargeneratedbytheegotokeepyouseparatefromthe GreaterAllistheplaceofthesmallself.Youaremorethantheproblemsofthesmall selfthatcontractsinfear.Youcanlearntogobeyondyoursmallegoicsenseofself tothatwhichisinterconnectedtoall.Theego,asdescribedbycurrentspiritual teachers,isthatlower,rebelliouspartofthehumanpersonalitycomplexthat constantlygeneratesfearthoughtsandreactions.HereisatoolcalledExpansion beyondEgothatwillhelpyougobeyondyoursmallsenseofselftogettheBigger Picture. ExpansionbeyondEgo Closeyoureyesandmoveintoaplaceofquietinyourmindwhereyousitobserving yourself.Seeyourbodyandmakeanoteofwhateverbelieforproblemyourmindis obsessingover.Breathedeeplyandobserveanyuncomfortablefeelingsyouare experiencingasyourerunthebelieforprobleminyourmind.Dontgointoyour problemandyourfeelings,justobservethemwithoutjudgment. Tellyourself,Fearcontractsmeintomyproblemsandmyfeelingsaroundthose problems.Fearisoftheego.Selflimitingthoughtsarejustmyegothoughtsaboutmy beliefs,problemsandmyuncomfortablefeelingsofanxiety,fear,anger,resentment, etc.Icanchooseselfliberatingthoughtsoverselflimitingones. Firstimagineajourneytotheplacebeyondyourmind.Pictureyourselfgoinginward andslippingbeyondyourmind.Thisisaplaceofnothought,justbeing.Breathefrom thisplaceofdisconnectionfromtheproblemsofyourbody/mind.Pictureyour body/mindthatobservesthosesensationsoffear. Nowmoveyourconsciousnessoutaninchawayfromyourbody.Makeacirclearound yourbodyandmoveyourawarenessseveralinchesoutintothiscircle.Becomeaware ofallthatsurroundsyouintheroomandmoveoutofyourbody/mindintothe awarenessofwhatishappeningaroundyou.Expandyourawarenessintothesounds, temperatureandatmosphereofyourenvironment.Ifyougobackintothoughts, dismissthemandreturntoexpandedconsciousness.
11

Expandthespaceslowlystayingwithawarenessnotingtheenergiesofyourroom. Allowthecircleofyourawarenesstogrowfurtheroutfromyourbody/mindandtake intheentireroom.Mindfullyexpandyourconsciousnesstotakeintheentirebuilding. Keepyourfocusmovingoutwardtoenlargeyourspecialawareness.Expanditintothe blockandthenintoseveralblocksstayingwiththenonjudgmentstateofmerelybeing watchful.Notetherhythmofyourheartthatbeatsstronglywiththerhythmofthe GreaterSelf. Growyourawarenessfurthertotakeinyourentiretown,stateandcountry.Observe andstaywithmindfulawarenessasyoufurtherexpandyourconsciousnessintoour beautifulplanet.Lettherhythmofyourheartexpandintotherhythmofourplanet. Movethecircleofyourawarenesspastourlittleplanetintospace.Keepmovingyour consciousnessoutwardintothatexpansivecirclethatcontinuestoencompass everything. ConnecttherhythmofyourheartbeatwiththerhythmoftheUniverse.Allowthe vibrationofyourconsciousnesstobeinharmonywiththespaceofAllThatIs.Letyour consciousnessdissolveintoAllness.YouarethatAllness.Letyourconsciousness dissolveintoInfinity.YouarethatInfinity.Feelthevastnessofyourconsciousnessthat takesineverythingwithoutjudgment. Thisistheplaceofnothoughts,theplaceofnofear;theplaceofnoego.Thisisthe placeofnoproblemsandnofeelings.Thisistheplacewherethereisnorightorwrong. Thisistheplaceofallowingeverythingtobejustasitis.Thisistheplaceofemptiness. ThisisyourTrueSelf,yourAuthenticSelfthatisconnectedtoeverything;toall. ThisexpandedstateofconsciousnessistheAuthenticSelfthatiswhoyoutrulyare. YouAREtheAuthenticSelfwhichresonateswitheverything.StaywiththisAuthentic Selfthatalwayshasbeenandalwayswillbe.Remaininthisplaceofconnectionwith AllThatIsandtakeapeekdowntothepersonthatyouarethathasabody/mindwith anegothatworriesandobsessesoverproblems.Seethefollyofthefearsoftheego fromthisexpandedplaceofawarenessoftheAuthenticSelf. AllisImpermanentsavetheAuthenticSelf Theegoworries,desiresandattachmentsareboundtothetemporalworld. Obsessingoveruncomfortablefeelingstatesisgeneratedbyfearsgeneratedbythe ego.Undesirablefeelingsandthefearthoughtsfromtheegothatcreatethemcome andgo,keepingyoufromtheAuthenticSelfwhichencompassesall.
12

Wehaveforgottenthatourtruenatureisnondual,whole,completeand invulnerableandthisrememberingisthejourneyhome.Thisprocessofhealing returnsustotheTruthortoourDivineandHolySelfwhichisconnectedtothe Oneness.UnionwiththeDivineistheendgoalofmanyreligionsandforthosewho espouseagenericspirituality.MysticMartinBuberdescribedthesearchfor Onenessinhisclassicbook,IandThou.Bubersaysweforgotatbirththatweare essentiallyonewithall.Healingistoreturntothoseknowing,thatsenseofOneness. AllowingtheexperiencesalongthewayallowstheForceofSpirittotweakyourego againandagaintocreateanopeningforabiggerbreakthrough. Evolutionisawareness!Yoursoulandinnerwisdomarealwaysthereforyou biddingyoutoenterintoappreciationandgratitude.Utteringanintentiontoreturn tothenaturalorderofthingsreleasesenergybothwithinyourselfandwiththe greaterUniverse.HealinghappenswhenyousettheintentionforLoveforthebest andhighestforallconcerned. Thesoulistheessenceorthedeepestlevelofyourexistenceofwhoyouarewhich carriesonthroughmanylifetimes.Thejourneytowholenessiscenteredinthe recognitionthatthereisonlyOneMindandTruththatiscenteredinDivineLove thatalllivingbeingsshare.Thereisonlyoneenergywhichencompassesallandwe areapartofthislovingenergythatresideswithinus.Itisavailableforproviding Truthwheneverwecallforit.ThereisonlyOneMindandthatMindisLove.

13

Theevolutionaryimpulseforallbeingsandforouruniverseflowstowardincreased integrationandcomplexity.Theevolutionaryimpulsethrobspokingandprobing ourhealingjourneyfromfragmentationtowholeness.Thatisitsnature.The tendencytowardscomplexityandintegrationishowtheuniverseworks.The movementfromsimpletotheelaborateiscalledthetendencytocomplexitywhich movestowardsincreasedorderandconsciousness.Wecallthisultimate,integrating complexitytheDivine,OnenessorGod. Healingispartandprocessofyourbirthright.Beingborntherightofbecoming intoanewstateofenergyasahumanbeinggivesyouthisrighttoevolve.The energetictemplateforyourhealingliesdeeplyembeddedinyourpsychewaitingto beactivated.Andyouarenotalonefortheevolutionaryprocessofexpanding consciousnessisthereforyouwithradiantlightcomingforthfromtheUniversal Energies. Youhavecomehereonearthtohealandbepartofthehealingofourplanet.You canuseyourenergiestoactoutyourdesires,intentionsandreadinessforchange andreturntobalanceandharmonythenaturalorderofthings.Thisisthestuffof healingtheconsciousandmindfulprocessthatencompassesmanysmallactsof intentionandthedecisiontobecomewhole. ThewordhealisaderivativeoftheEnglishwordhalemeaningtomakewhole,that whichhassurvived,keepingtheoriginalsenseaccordingtoWebstersNewWorld Dictionary.AnothermeaningofthewordhealcomesfromtheLatinword intenderetoattend,design,planthatguidestheactionforrestorationorregaining healthorsoundness.Healingisaprocessofjoining,connectingandreconciliation tocometowholeness.
14

"Whencoherentinformationreachesanunbalancedsysteminanyofitslevels,theinducedtendencyis alwaystheautoreconfigurationtowardsmoreharmoniouspatterns." Dr.GiampieroCungi

Chapter5 HealingisYourBirthright

PsychotherapistJohnFreedomsays,Healingis: Bringingdarknesstolight Bringingfalsehoodtotruth Bringingillusiontoreality Bringingthatwhichisfragmentedtowholeness Bringingangertoacceptance Bringingignorancetounderstanding Bringingsintoforgiveness Bringingfeartolove BringingselftoGod. ACourseInMiraclestellsus,Tohealistomakewhole.Andwhatiswholecanhave nomissingpartsthathavebeenleftoutside.Healingisdefinedasanyritual, substance,nutrient,ormindalteringexperiencethatbringsinformationofahigher vibratorystateintoachaoticinterferencepattern.Duringhealing,thatwhichhas beenfragmentedmovestowardwholenessandgreatercomplexity.Thepersonmay changeatmanyemotional,physicalandspirituallevels. Onthebody,mindandspiritlevels,healingisafluidprocessoftuningintogatherto allowvibrationalshiftsin: Chistagnationandblockage Energiesofthemeridians,chakrasandaura Heartandbrainrhythms Unwantedemotionsoffear,anger,anxietydecrease Biochemicalprocessesaffectingthebiochemistryand neurotransmitters Egobeliefs,defensesandperceptionsofthreat Energiesthatneedtoberealignedandintegrated Subtleenergyfieldsthatsurroundthebody Understandingthedivinepurposeofyourbeing Individualconsciousnessthatisconnectedtothegreater Consciousness. Thepurposeofhealingistoopenthepersonuptothelovethatresideswithin.Love isthesupremegift.ThequestfortheTrueSelfisadevelopmental,ongoingprocess continuingalongrepeatingitselfalongwithlows,plateausandthehigherstatesof consciousnessthatassisttheinformationalchanges.Itactivateswhatisalready presentinthehumanpsyche.Itisanongoingprogression,notaonetime,done
15

deal.Itisareawakeningprocessthathelpsusrememberwhoweareasspiritual beingsresidinginaphysicalbody. Thebodyenergeticallyholdsthewisdomofwhatneedstobehealed.Itcarriesthe energeticimprintsoftraumainthenervoussystemandmuscles.Itreconnectsus withtheTruththatisalreadypresentwithin.Fearbeliefsdissipatewiththedeep feltrecognitionthatmysticSt.HildegardofBingendescribed:Alliswell,alliswell, allmannerofthingsisvery,verywell. HealingisCreatingCoherenceintheSystem CoherencecomesfromtheLatinwordcoharerewhichmeanstobeconnected naturallyandsticktogetheraspartsinamass.Throughcoherence,asystem becomeslogicallyconnectedinaunified,interconnectedfashiontobringorder.In physics,coherenceistheforcethroughwhichthemoleculesareheldtogetherto formadhesion.Wehumanbeingsconstituteanindividualizedsystemthatlivesina greatersystemaspartofbeinginterplanetarybeings.Systemsareorganized energeticallyandcarryintelligence.Gatheringandprocessingdataandinformation intelligentlyensuresthatthesystemwillsurvive. TheInstituteofHeartMathisaresearchlabthatstudiestheeffectoflovingemotions ontheworkingsoftheheartandbrain.ItsDirectorofResearch,RollinMcCraty describescoherenceas: theharmoniousflowofinformation,cooperation,andorderamongthe subsystemsofalargersystemthatallowsfortheemergenceofmorecomplex functionsItistherhythmoftheheartthatsetsthebeatfortheentiresystem. Theheartsrhythmicbeatinfluencesbrainprocessesthatcontrolthe autonomicnervoussystem,cognitivefunction,andemotions,thusleadingus toproposethatitistheprimaryconductorinthesystem.Bychangingthe rhythmoftheheart,systemwidedynamicscanbequicklyanddramatically changed. SystemstheoristBruceForcieasaid,Theessenceofthevitalforceisinformation.At thecoreofallhealingsystemsisthetransferofinformation.Coherentemotions suchasgratitude,love,appreciation,acceptanceandpeaceofmindtransferneeded informationthatpromoteshealingofthebody,mindandspirit.Imagingstudies showthatthefrontalcortex,temporal,occipitalandparietalareasofthebrainare influencedwhenpositiveinformationcomesinandtheheartandbrainshiftintoa coherentstate.
16

Thereisavastintelligenceinthebody,mindandspiritwhichseekshomeostasis andwholeness.ThisintelligencecanbeaccessedinHigherStatesofConsciousness. Healingpracticesinterrupttheautonomicnervoussystemdysfunctionthat contributestomanyphysicalailmentssuchashighbloodpressure,strokes,heart attacksandcongestiveheartfailure.Coherentinformationoperatesatvibratory frequenciesthatsupportlifeandgrowth.Itreturnstheautonomicnervoussystem andtheorgansofthebodytobalanceandharmony. Inacoherentsystem,thereisorder,structure,congruenceandalignmentwithinthe systemanditssubsystems.Actsofcreatingcoherencyincreasesynchronizationof thebrainhemispheresallowingthesystemtoaccessgreateramountsof informationinformofintelligenceorwaveforms.Suddenbreakthroughsand insightscanhappenwhenyourbrainhemispheresintegrate,yourheartandbrain operateincongruenceandyouslipintothetruenatureofconsciousnessitself!Each actofhealingconstitutesaquantumleapintocreativeconsciousness. Thecongruentbodyhastheabilitytofostercooperationamongitsorgans,glands andbrainwithgreatercooperationwithexternalsystemsaswell.Thispromotesthe emergencetowardscomplexityandcoherenceofconsciousness.DavidServan Schreiber,M.D.,PhD.Callsthistheinstincttoheal.AspartofthegreaterUniversal Planetarysystem,wearenaturalresonatorsofthatenergy.Whencoherenceis restoredtotheindividualsenergyfield,vibratoryfrequenciesofgraceflowintothe person.Thepersonreverberatesorvibratesatthesamefrequenciesofthe UniversalEnergies. CongruenceisAlignmentwiththePrinciplesofSacredGeometry SacredgeometryisbehindthecreationofouruniverseaccordingtoDrunvalo Melchizedekandotherswhostudythis sacredscience.Alloflifeappearsas geometryanditsexquisiteratioswhich supportthelifeprocess.Sacredgeometry isexpressedinthesupremebeautyand ongoingevolutionarygrowthofour universewhichisbasedonnumerical, idealratiosandproportions.
17

Healingiscoherentinnaturedrawingfromtheconnectivefieldsofinformationheld intheheart.Alchemist,astrologer,physicianandwriterontheartofhealing, Paracelsussaid,Theartofmedicinehasitsrootsintheheart.Ifyourheartisfalse, thenalsothedoctorinyouisfalse.Ifitisfair,thenalsothedoctorisfair. GregoryHoag,visionaryartistandcreatorofpatternsofsacredgeometry,clarified thisconceptofcoherence.Acoherentenvironmentsupportsfocusandtheability tomaintainintentinordertomanifest.Congruenceallowsresonancewithagreater power,sosynchronicityandbeingintherightplaceattherighttimecanoccur.The feelingofconnectionisenhancedbyasenseofrelationship,whichcancreate relevanceandrespectinallactions.Conversely,negativeemotionssuchasanger, stress,anxietyandrevengecreateincoherentpatterns.Actsofhealingbringthe personbackintoconnectionwiththeHigherIntelligencepresentinouruniverse. TheDynamic,Reciprocal,FreeFlowingEnergyFieldofHealing Healerscreatearesonantentrainmentwiththefieldoftheirclientbygoingintoa nonordinaryorassomecallit,anonlocalstateofconsciousness.Entrainmentis theprocessofsynchronizationwiththevibrationsofonepersoncausingtheother toresonateatthesamerate(orifdonewithtuningforks,crystalbowlsorwith speciallydesignedCDstospecificsoundfrequencies). TheuniversalLawofSympatheticResonancesaysthatduringtheheightenedstate ofhealing,clientandhealerconnectintoaresonantbondingwithahertzlevelthat supportshealing.Theclientsharesorentrainsintothisfieldofcoherence.Inan alteredstateofcompassion,healerscanbecometotallyclientcentered,heart centered,bodycentered,andspiritcentered.TheresonantenergiesoftheUniverse danceintojoinintocreateacoherent,cohesivefield. InQuantumPhysics,theuniverseisseenasenergyparticlesandwaveswheremind, intelligenceandconsciousnessareallintertwined.QuantumPhysicssaysthatwe humansaremadeofsubatomicparticlesandenergyfields.Humanfieldsare interactiveandcarrypsychicinformationwhichcanbeaccessedandtransferred. TheHeartMathresearchshowsthatwhentwopeopleareconnected,onepersons EKGrhythmsarereflectedintheotherperson.Thisoccurswhentheyarephysically togetherbutalsooccursinnonlineartimeandnonlocalspaceasinremotehealing. Theelectromagneticimprinttransferswiththeindividualsintentions.

18

Discussingsoundasmedicine,Dr.JefferyThompsontiesquantumphysicswith vibrationalhealing. ahostofresearchprojectshaveshownthatbrainelectricalactivityand neurochemicalhormonefunctionareinvolvedinaccessingdeepermemory responseandexpandedbrainfunction.Fromthestandpointofquantum physics,asweexamineeversmallerparticlesofmatterpeoplemadeofcells, madeofmolecules,madeofatoms,madeofprotons/electrons,madeofquarks, etc.weeventuallyreachastateofrealitywherethesmallestparticlesof matter,whenbrokenfurther,donotyieldsmallerparticleswhichwecanput nameson,butratherauniversalenergymatrixofrelationshipsofvibration patterns.Inactualitythereisnothingsolidintheuniverseatall.Consciousness itselfisavibrationpattern. Healingoccurswherethereisacceptanceandconsiderationflowingforthinthe energeticfieldwhichfostersbrainwaveentrainmentthatchangestheheart rhythms,brainwavesandtheneuralnetworksinthebrain.Bilateralsymmetry withinthebrainoccurs.Electricalactivityandenergyflow!Communication betweentherightandlefthemispheresofthebrainbecomesenhanced. Loveallowstheshiftfromeverydaybetastatesofconsciousnessintoalpha,theta andthenpossiblygammabrainwavesassociatedwithvibrationalshiftsinto consciousnessstateswhereinsightispossible.Time,spaceandformcanbecome distorted.Thehealingstateisbidirectionalandreciprocalinnatureflowing betweenthepeopleinvolvedandtheuniversalenergies. Two Healing Formulas Healing is a function of (Focused Attention + Connection + Intention + Love and Forgiveness to receive Information and Vibrational Frequencies.) Healing is forgiveness of self, understanding things from a higher spiritual level and drawing from Higher Resources to empower the self. Thetransferofneededinformationisbroughtforthforthepersonisintheformof higherfrequencies,vibrationalshiftsandadifferentunderstanding.Inthiscoherent state,youfeelacceptance,peace,graceandharmonious.Trainingtoachieve coherencehelpsdealwithnegativeemotionsandkeepsemotionalstressdown. Peoplewhomeditateorpracticehealingenterintopositivementalstatesmore easilyandtheirECGpatternsindicatecongruence.
19

TheFalseSelfisoftheEgo Wehumanshaveanegothathelpsusinourdailyplanninganddecisionmaking.We needenoughhealthyegostrengthtogetthroughourday.Thesenseofbeing separatewehumanshasbeencalledbymoderndayspiritualteachersastheFalse Selfortheegodefenses.Theegostructureconsistsoftwoparts:thehealthy preparationforlifebutalsothefearprogrammingoftheconditionedmindthathas beenexposedtothreatandtrauma.Itcontainsfearbeliefs,destructiveemotions, addictiveneedsanddefensemechanisms.RobertCoxsaysthatTheegohas usurpedtheplaceofourTrueSelf.itisthenonselftheabsenceofself.Theegos purposeistoseparateanditchoosesconflictasitseesthingsthroughthelensof lack,competitionanddefensiveness.Ourtaskasspiritualbeingsistomovepastthis fearthinkingandreturntoourhealthyegofunctioning. Forpracticalpurposes,thewordegowillbeusedtodescribetheegoicaspectofthe humanpsychewhichisthephantomofthemindthatbugsuscontinuallyabout whatsgoingwrong.Theegocreatesanoveridentificationwithownershipofthe body,feelings,experiencesandthoughts.Ithasahugelistofjudgmentalshoulds andshouldnots(mustsandmustnots).Thisshouldnotbehappening.Icantstand this.Idemandthisstoprightnow.Theegowhichrunsonfearisalwaysthere twentyfour/sevenwithitsrelentlessdemandsandhassles. Theegoisoneofthoseseparatedaspectsfocusingonmyfeelings,myideas,my perceptions,mylosses,mybetrayalsandmybodyissues.Throughtheconstant focusonangstandunfairness,theegokeepsusrecognizingthedesireforunionof theseparatedaspectsofourself. Theegotakesusoutofthismostpreciousmomentbyinsistingthingsarebadand unfair.Itdevelopsendlesslyloopingtapesthatreruninyourmindtoconvinceyou thatunfortunatethingsthathappenareintolerable.Theegobelievesitselftobe importantsoitmustruntheshowfueledbyfear.Itinsiststhatthingsmustalways befavorabletoyouandthatothersmustgoalongwithhowyouwantthingstobe. Manyreligionsaddresstheegoeventhoughtheydonotcallitoutbyname.Greek OrthodoxpriestArchimandriteDionysioscallsouttheegodirectlytochallengeit, Therealenemyistheego.Itistheenemybecauseitisagainstlove.Whatis ego?ItisthemeansbywhichIprotectmyselfasifIwereinabattle,asif everyotherpersonismyenemy,andtheonlythingIcareaboutiswinningthe victory.
20

LoveCarriestheFrequenciestoBalancetheEgo

Abandonmentandfearareatthecoreofthesenseofseparationthattheego experiences.WhenwefeelseparatefromourTrueSelfwefeelunlovableand experienceguiltandfearandjudgeourselves.Thenegativeemotionsarisefroma senseoffeelingseparateandunworthy.Fearisexpressedinthenegativefeelingsof envy,shame,rage,embarrassment,disgust,anxiety,sadness,etc.Ifyouarenotin thelovecategoryaboutasituation,thenyouareinfear.TheBibleverseofJohn4:18 remindsus,Thereisnotfearinlove,butperfectlovecastsoutfear. Inhisbook,HealingWithLove,healerandphysicianLeonardLaskowgivesan exquisiteexplanationofhowlovecompletesthehealingprocesstobringthe individualbackintowholeness. .weutilizelove,whichistheuniversalharmonic,tohelpourselvesor othersreleaseenergypatternsofseparationandmoveintoenergypatternsof wholeness.Theessenceofloveisrelatednesstoaperson,aplace,anobject, afood,one'sself,theuniverse,orGodoranundefinedHigherOrder.Wecan lookatrelatednessinaveryliteralsense:torelatemeans"tocarryback togetherlovebringsbacktogetherwhatwasonceonebutseemingly becameseparate.Itisacominghome.Wecanbecomeawareofthis nonseparation,orrelatedness,foritalwaysexists.Wecanexperienceitasa senseofwholeness,completion,peace,andtheimpulsetowardunity.Andwe canexpressandmanifestitthroughouractions. Atthistimeinhistory,wearegiveninformationintheformofmanyuniquehealing practicestoaddresstheegofearsanddefenses.ACourseInMiraclesremindsus,All healingisessentiallythereleasefromfear.Youletgoofyourego'sneedforthe powertomakethingshappenthemoreyoutrustthatthegreaterpossibilitiesfor changecanhappen.Newinformationcanflowinwhenyouholdyourselfsteadyin thehealingpoweroflove.AsTheBeatlesssongsays,Letitbe.Letitbe.Inthe longrun,itsnotaboutyouanywaybutabouttheoveralldesignofunfolding evolutionofwhichyouareasmallpart,butitaveryimportant,necessarypartin assistingplanetaryconsciousness.LeonardLaskowcontinuesthisconcept: Whenwerelatefullytowhatisso,lovebecomesknownasTruthorPure Consciousness;perceiverandperceivedbecomeone.Lovecreatesanenergy fieldthataffectsallthatentersit.ItissaidthatthelovingfieldsofChristand Buddhaweresopowerfulthatpeoplewerehealedintheirpresence.Bothof thesegreatavatarstaughtthatlovingenergyistheenergyofoneness,
21

Weareheretodismantlethatpartofouregostructurewhichconsistsof programmedliesanddefensivewaysofreacting.Whenthishappens,weareleft withthehealthieraspectsofouregofunctioning.Wearetheonlyspeciesthathas beengiventheabilitytothinkandcanuseourfreewilltoaccomplishthisgreattask. Thisfreewillispartofourevolutionarynatureusingthepursuitofnoveltyto greaterconsciousness.Andwearenotalone.WehavetheLifeForceoftheUniverse toassistustomoveoutofspiritualignoranceduringthistimeoftheGreatShift.We humanscanchoosetoawakentheforcesoflovethatarewithinustotakeourpart intheawakeningofconsciousnessforourplanetduringthiscycleoftime.

harmony,balance,andpeace.Inthepresenceofapowerfullovingfield,if thereistheintentionandwillingnessforhealingtooccur,thebody'sinherent selfhealingcapabilitieswillbestimulatedandaugmented.

22

Chapter6 FearistheNeuroticPatternoftheEgo

Underthegripoftheego,wearenarcissistic.Empoweringyouregomeansgivingintothoseurgesf oraddictions,obsessions,perceptionsofunfairness,excessesofundesirablefeelingsandgivinginto abusesofpride.Allofthesemakeyouloseyourcapacitytolistentothetruththatresideswithinyou.. Theydenythetrueessenceofwhoyouare. CheriHuber

ACourseinMiraclestellsus,"Theegoalwaysspeaksfirst.Itsvoiceisalwaysthe loudest,anditisalwayswrong.Theegotakesusawayfromourtrueselfandthe Oneness.JohnFreedomdescribesitthus:Therearetwogreatforceswithineach oneofus:Ego,whichistheforce/movementtowardsgreaterdivision,conflictand separationthuscreatingourseparateselvesandIntegration,whichisthe force/movementtowardswholeness,connection(somecallthisSpiritorGod)and therecognitionthatwearepartofthisGreatOneness. Neuroticismisconsideredtobeoneofthefivebasicpersonalityattributesin psychology.Itsunfortunatethatthewordneuroticwhichhasanegative connotationwaschosentodescribepeoplewhoessentiallycanfeeltheirfeelings,as opposedtothosewhodonot.Neuroticismmanifeststhosepeoplewhoregularly experienceanxiety,angeranddepressionasopposedtothosewhodonottypically experiencemuchemotion.Peoplewithhighneurotictendenciestendtoascribe morenegativeemotionalreactivitytouncomfortableevents.Andyetwithoutthe abilitytofeelwewouldbenomorethanrobots.Soasahumantrait,itsbetterto havefeelingsthannot!Andyettohavetoomanyfeelingsaswellasnoneatallisa foilofthedefensiveaspectoftheego. Fearisthewithholdingoflovefromasituationoutofignorance.Duringthestateof fearyoudonotallowlovetoflowtoyourselfortoothers.Theegoconstantlythrows upfearthoughts.Feartakesusintodefensivenessandactingoutwhateverwehave learnedearlierinlifeasaprotectivedevice.Theintentofthefearbasedegoisto protectandrunawayfromanythingthatmakesituncomfortable,especially uncomfortableemotions.Addictivebehaviors,defensesandmishandledangerare thedevicesoftheego.Anytimeyouhaveabeliefthatyouarebetterthanothers,you areinthegripsofego.Youareinegomodeanytimeyoubecomeangrywhen someonedoesntagreewithyou.
23

Theegorearsitsheadpreventingusfromfindingconnectiontoothers.Itkeepsus separatefromourmostconnectedsenseofourlovingselves,separatefromothers andseparatefromhoweverwelanguagethatforcethatisgreaterthanweare.A trickoftheegoistoblameotherstoprojectyourproblemsonanoutsidesource. Anythingyouexperienceinyourlifeisamirrorofwhatsgoingoninsideyourself. WeCannotHelpbutActOutOurUnresolvedDefenses Weliveinrelationshipanditisinrelationshipsthatwearetraumatized.Most traumaiscausedbyrelationaltraumacausedbyparents,familymembers,peersor teachers.Achildisborninnocentandprecious.Thechildsvibrationallevelsofhis organsandmeridiansgooutofbalancewhenheorshefeelsoutofcontroland overwhelmed.Ofcourseafewtraumashappenasaresultoflivinginthenatural worldcaraccidentsordogbites,etc.butmostofthefrighteningexperiencesthata childundergoesareatfrompeoplewhoactindysfunctional,hurtfulways. Themotoricdefensereactionsaccompaniedbystrongemotionsarebornoftrauma anddevastatingemotions.Thechildssenseofselfisimpactedatacorelevelwhen thereisovertorcovertabuse,neglectorlackofvalidation.Thechildwantstobe heardandvalidatedbutthereisnoonewhocanacknowledgehimatthedeepest level.Feelingaloneandunabletoaskforhelp,thebetrayedchildfeelsshameandis changed.Orperhapsthewrongkindofhelpisgivenandthechildfeelsmore helpless.Trustshutsdown.Theshamecorebuildsunconsciously.Resistanceand avoidanceofaddressingthebadfeelingsbuild.Theformulaforresistanceis resistanceequalsthenumberandstrengthorthedefensesandtheleveloffearand shame.Wallsdevelopanddefensivewaysofprotectingoneselfaresetinplace. Whatisnotresolvedisactedoutinthelife. Thewordseparatemeansthatthingsthatwerepreviouslyjoinedaredisengaged andsevered.WhenwefeelseparatefromourTrueSelfweprojectthese perceptions/feelingsoutsideourselves.Thissenseofseparationprojectedbythe egomakesusfeelunworthy,incompleteandvulnerable.FromtheFalseself,we defendourselvesfromtheprojectedguiltwhichgivesrisefortheneedtoperceive attacktojustifytheprojection.Theidentitybecomesorganizedarounddefense mechanismsthatprotecttheneedtoavoidfeelingvulnerable. AndsotheDivineChildbecomestheDefendedChild.Hardened,neurotic,reactiveor helplessinsteadoffree,openandspontaneous.Shieldedagainstotherpeoplewho aredeemednotsafe.Andofcourse,theirparentsreactwiththeirowndefense
24

mechanismsandarentabletogivethechildwhatheneeds.Sothechildgrowsup tryingtosurviveinadefensivesystem.Hebecomesmistrustful,armoredandkeeps himselfapartfromknowingtrueintimacy.Thisbehaviorpatternthatthechilduses ashelearnstosurvivewillreactlaterwithpartners.Orperhaps,hewontbeableto committorelationships.Hebecomestoughenedandreinforcedagainstknowingthe truebeautyandfreedomwithinhimself.Caughtinshameandthinkingtoowellor toolittleabouthimself,hebecomesdefendedagainsthisfeelings,otherpeopleand againstrememberinghistruelovingnature. LearnedMuscularTensionCopingPatternstoDefendAgainstThreat Therearecommondefensereactionpatternsofthebodyandmindthatpeople typicallygointowhentheyfeelthreatened.Thesearewaysofmovingthebodyto trytodefendagainstathreat.Thesemovementsincludemuscular,breathingand evenhormonalreactionsandmovementsthatthebodygoesintoautomatically.One waytolookatdefensecopingpatternistowatchhowyourenergymoveswhenyou senseathreat. Whatdoyoudowhenyouarefrightenedorstressedbysomeoneorsomeone?If youarentsure,starttoobservewhatyoudowhensomeoneiscrosswithyouor challengesyou.Youmayhaveseveralofthesemostcommondefensivemovements thatareautomaticreactionstoavoidfeelingshamewhichisaprofoundsenseof unworthinessandothervulnerableemotions.Turningtoalcohol,drugs,gambling andotheraddictionsareotherwaystomediatethepainandgriefreceivedearlierin life.Notewhichdefensesyouhave;weallhaveseveralofthesewaysofdefending ourselves.Whichisyourmajordefenseandwhatotheronesdoyouhave? _____Withdraw,contract,tightenmusclestoprotectvulnerableareas _____Moveforward,blame,project,bully,aggresstowards,tightenfists _____Braceagainsthit,tightenmuscles,tightenshoulders,jaw,neck,stomach _____Freeze,blocktraumatriggers,dissociate,spaceout,fragmentenergy _____Pullback,deny,ignore,minimizeproblem,pullaway _____Becomeagitated,anxious,frenzied,scattered,nervousenergy _____Becomeoverwhelmed,devastated,numbandshutdown _____Distract,deflect,joke,changethesubject _____Agreetodosomethingthendontfollowthrough(passiveaggressive behavior) Thesearelearnedpatternswhereyoucompartmentalizeyourenergythatwere developedoutoftraumawounding.Withineachautomaticpatternarebeliefs,
25

feelings,bodysensations,hormonalpatternsandmuscularpatternsincludingthe internalorgans.Thedefensemechanismshappenwhenyoufeeloutofcontroljust likeyoudidearlierinyourlifewhensomethingbadhappened.Youcantrackthese patternsandchallengethemtellingyourself,Ichoosetobepresentanddealwith thisthreatinsteadofreactingasifIwasahelplesschildoryoungerperson. BesselvanderKolk,traumaresearchersays, Unresolvedperceivedlifethreatsareathreattotheverysurvivalofthe individualThemorefeelingsneededtobeavoided,themoreenergyis spentonkeepingthematbayenergythatshouldhavebeenusedforfeeling aliveandopentonewexperiences.Whatisfeltremainsunchangedorgains ininwardpressure,whichforcespeopletostepuptheirmethodsof avoidance.Thisisthesortofviciouscyclethattraumacreates.Abandoned feelingscalloutforattentionfromthegrowingshadowofexistence. Treatmentmustaimatputtingthesedisjointedsensationstogether.Doing thisinvolvescoaxingthemtobegintofeelandtoleratethesensationsthat overwhelmedthem. Theexercisesinthisbookwillhelpyougettothebottomofthesepatternsof checkingoutofthepresentmomentandhelpreleasethem.Youwillbecomeamore creativeandlovingpersononceyoureleaseyourdefensemechanisms.Youcan learntoseeyourunproductivedefensesasjustsomethingthatyoulearnedwhen youwereyounger.Andthenacceptthatyouweredoingthebestthatyoucouldat thetimeandfeelcompassionforthatinnocentchildoryouryoungerselfthat becamedefensivetoprotectyourselfandsurvive.Thefirstconnectionistoself compassion. Healingyourdestructiveegoicpatternswillenableyoutostaypresentinthehere andnow.Sohereisthehealthyalternativetodefensivereactions: _____Staypresent,breatheanddealwiththreatinastraight,directway!AsRam Dasssaid,Beherenow! Webecomereactiveanddefensivewhenweforgetwhoweareasachildofthe Universe.Seeninthislight,thereisonlyoneproblemwhichisfeelingseparatefrom theDivineLoveandthesolutiontothatproblemisalwaysLove.Love,acceptance, forgivenessandcompassionaretheanswerstoeveryquestion,everyproblemand everydefense.

26

Chapter 7 Coherence in the Human Biofield


"The light of the body is the eye: therefore when thine eye is single (full of light), thy whole body is also full of light; but when thy eye is evil (dark), thy body also is full of darkness." Luke 11:34

Our entire universe is mathematical in nature. Everything is energy of a vibrational nature and all follows the laws of mathematics and energy. We live in this unified field of energy and information taking in energy from the sun, earth and solar system. All is in evolution seeking wholeness and balance. Conscious co-creation in healing consists of becoming one with the needed information and resonating with it so it can be gathered and applied as needed. Likewise, artists, musicians and writers as well as psychics and intuitive are gleaners of the information that is already there in the Field. What is needed is to just tune in to make contact with that information and allow it to come forward. When you put your everyday mindyour Thinkeron hold and tune into your heart and higher states of your consciousness, the solution comes. You alter your consciousness to go into that vast storage place then tune into the vibrational band width and just go in and pick it up. Drawing from the work of Rudolf Steiner, Albert Einstein and German physicist Max Plank, Hungarian systems expert Ervin Laszlo theorizes that there is an all encompassing energy field called the Zero Point Field (so described because even at the absolute zero point, energy can still be measured) where time and space do not exist as all is happening all at once. This field is a vacuum which is a carrier of information. Laszlo stated, This quantum vacuum is the origin of mind and matter a blueprint of the universe. Even our own memories are not stored in our brains, but are stockpiled like holographic information in the field. Our brains are mainly receivers and processors of this information. When they resonate with certain mathematical frequencies they gain access to specific information. In the physics quantum world, subatomic particles--protons, electrons and neurons-become connected when they collide. If they move apart, the connection remains. This is the concept of entanglement. In the people world, organisms, moments in time, ideas, and energies become entangled. And so do intentions. Entanglement constitutes the strange,
27

wonderful world of healing. Entangled minds with the intention to heal resonate with those Universal energies. The ancient philosopher Pythagoras described the Zero Point Field and entanglement when he said, There is One Universal Soul, diffused through all things, eternal, invisible, unchangeable; in essence like truth, in substance resembling light. In 1981, the U.S. Congressional Research Service looked at the evidence from thousands of studies on telepathy, clairvoyance, remote viewing and precognition and concluded that Recent experiments in remote viewing and other studies in parapsychology suggest that there exists an interconnectiveness of the human mind with other minds and with matter. This interconnectiveness would appear to be functional in nature and amplified by intent and emotion. Its all there waiting for us to go in and pick up the information that we need. Lynne McTaggart agreed, Researchers discovered that the Zero Point Field contains the blueprint for our existence. Everything and everyone is connected with one another through this field in which all information from all time is said to be stored. Ultimately, everything from man to matter can be traced back to a collection of electric charges that are continually in contact with this endless sea of energy. Our interaction with this field determines who we are, will become and have been. The field is the alpha and omega of our existence. The concept of the Zero Point Field posits a radically new science which incorporates spirituality and an all-inclusive view of our world. The Zero Point Field offers an explanation for the many unexplained mysteries around healing, human minds influencing random number generators, ESP, remote viewing, intuition, clairvoyance, and premonitions. In the field, there is no difference between what has happened before and what is happening now. The implication of the Zero Point Field is that you can create your own reality. The mind has a strange ability to influence itself as noted in hypnosis and other techniques which use the creative imagination to create change. The capacity of the human brain is profound; there is no difference between past and present experiences. The subconscious mind cant distinguish between what is real and what is suggested. Thats why hypnosis works; the subconscious acts as if something is real if it hears a suggestion. You can create your own body and mind according to the perceptions that you hold. The world is not as it is, but as you experience and perceive it. You are influenced and influence matter both around you and in remote areas with our perceptions. We conjunctively create our world experience. You have your personal dynamic bioenergetic field that is an accessible collection of information. Our entanglement is with the planetary changes that are happening. We live
28

in an interconnected universe that is energy vibrating at different frequencies and we are entrained with the harmonious energies that are taking us to where we need to be. The information is stored not only in our subconscious mind but in our cells down to the tiniest atoms, protons and DNA. The Subtle Forces that Vitalize the Physical Body Within this biofield are the chakras; the word chakra means wheel in Sanskrit. The chakras, as described by the ancient Hindu traditions, are the whirling vortexes of the etheric counterpoints of the physical body. These chakras or vortexes of energy are centered on the seven endocrine glands. Each chakra stimulates the hormones produced by that associated gland. The root chakra corresponds to glands in the sexual organs, the second chakra to the pancreas, the solar plexus chakra to the Adrenals, the heart chakra to the Thymus gland, the throat chakra to the Thyroid and the brow and crown chakras correspond with the pituitary and pineal glands. These centers of energy become harmonically connected as a unified field as the person awakens to the Great Mystery and rises in consciousness. The complete understanding of how to work with the chakras is beyond the scope of this book. For a complete review of this information, see Zachary Lansdownes comprehensive book, The Chakras and Esoteric Healing. Here is a short version of how chakras work.

Chakras Spiraling Wheels or Cones of Energy A grounded, healthy persons chakras revolve at the same rate of high speed. Their chakras extend outward from the front and back of the physical body allowing their energy field to connect and flow freely from the universe and earth. There is a harmonious flow within their energetic field through the chakras and subtle energy bodies.

29

During times of great stress or in unhealthy individuals, the energies within the chakras move too fast or too slow, interrupting the vital energy flow. A trauma event creates discordant emotions which carry resonant vibrationsenergetic interference patterns that are in synch with the original event. These energetic interference patterns carry unresolved excess emotions that interrupt the flow of the meridians and the integration of the left and right brain hemispheres. The pathways can become blocked with stale or stagnant energy that prevents the free exchange of vital energy throughout the system, and illness, stress and accidents bring imbalance and illness. In addition, human bioenergy fields of different people interact with each other also bringing energetic imbalance or discomfort. The Healing Field The Tibetan Master Djwhal Khul as given through Alice Bailey taught that all disease begins in the outer layers of the energy field where irrational thinking patterns, fears, stresses, and unfounded core beliefs over time can leave energy imprints. If these issues are not healthfully processed or if the will of the personality is not in alignment with the will of the soul, the body can experience disease. There is a semi-permeable energetic membrane surrounding the body which allows energy flow transmission and information from others. This three-dimensional energetic boundary around our physical body is connected to our consciousness. Our energetic boundaries insulate us and allow us to relate to all other organisms through connecting and interpreting their energetic fields. Beliefs of limitation and not being safe reside within this membrane. When we think negative thoughts, this field shrinks close to the body to conserve energy and protect ourselves. Later the field over-extends as a constant vigilant coping barrier. Deficient or blocked energy is one result of unresolved unhealed emotional wounds. Ongoing fear beliefs shrink the energy field around the physical body. Healer and intuitive Yuliya Cohen relates, Trauma and illness can strip away the energetic membrane and leave an organism diminished and vulnerable. It also will alter and distort perceptions of reality and leave one plunged in the strange world of voices, hallucinations and greatly exaggerated forms. These are the telltale symptoms that a clients energy field and membrane have been compromised due to their inability to regulate energy information flow. Distressing symptoms provide the greatest opportunity for healing, as Rumi said, The wounds are where light enters. Positive emotions, which are information, can expand the field out from the body. They provide the neurological rewards in your brain giving you that boost of positive neurotransmitters. Gregg Braden, in his book The Divine Matrix, explains that the
30

language of emotion is at the crux of how we create and sustain life. Healers use the language of emotion to work with the power and intelligence that resides within the human field by repairing it and its energetic membrane and then assisting the person to reframe their perception of their experiences in positive, empowering ways. Healing as a Ritual with the Potential for Change We are programmed to be receptive to healing rituals to repattern ourselves for the greater good. Rituals, ceremonies and intentions flagged with emotion are most potent in bringing vibrational patterns of coherence into a chaotic field. Rituals can create trance or altered states in their participants making information from the subconscious mind more accessible. Trance is the real perception state of humankind, said Holger Kalweit, author of Shamans, Healers, and Medicine Men. Trance is from Latin "transre" which means to cross, pass over a threshold as a conduit or portal into something different. In induced trance states there is intense focused attention and suggestibility for healing is enhanced. Often words spoken by or through the healer carry information and a resonant vibration. Words can heal and those words that come from a different dimension spoken by the healer can send you into a brain wave state that fosters moving through the limited fear beliefs to see things from a higher perspective. Repeated rituals that focus on love change the raw circuitry of your brain and your physical body. Your inner musings, wishes, desires and choices create an inner environment that turns on positive brain neurotransmitters. Scientists estimate that there are over one-hundred million neurons in our autonomic nervous system. Turning on new neurons and neural pathways with new ideas stimulates the plastic nature of the brain allowing for possibility for shifts in gene expression. Healing is a potent ritual. As part of the Oneness we are in relationship with everything and everyone. This healing interaction that draws from the greater whole is described by Jesus in the Bible verse, when two or more are gathered together in His name, there I am also. When the two individuals combine their minds and invoke healing, they form a field of energy and information which is picked up by the subconscious mind of the healer. Joining forces with another person and setting the stage for healing creates a unique energy field connection that allows a vibrational and informational transfer. Healers input coherent, vital and intelligent energy into an unbalanced system lacking in equilibrium to adjust the life force to provide reorganization and integration. The frenetic energy of the disrupted system is interrupted and there is a movement towards order and complexity. Somewhere in the Universal field and in the persons depth of the body, mind and spirit, held in reserve is the potential for that healing moment when there is a sudden insight of seeing a higher-consciousness perspective, a creative solution and a
31

bigger picture. This is a quantum jump into a new reality, even just for an impending moment, where there is an uptick in vibration. This ability to tap into the absolute potentiality for exactly what is needed for the person at that moment is part of the quantum nature of consciousness. Every perceived problem, conflict or difficulty can be turned over to the holy wisdom which resides within you and around you. Allow the state of connection and grace and know that there is no separation. In healing, all in interconnected as Zackary Lansdowne, author on esoteric healing, explains, Pranic healing employs the planetary etheric body as the medium linking the healer with the patient. There is no reality to separation, because the healers and the patient etheric body are integral ports of the planetary etheric body, which is whole, unbroken, and continuous. Systems Theory Psychologist Mihaly Csikszentmihalyi, known for his studies of happiness and creativity, describes his concepts of flow and systems theory. All parts of the system are mutually dependent. Fear and fragmentation decrease the available energy of the system. Energetic information becomes organized when separated parts come together. That which has been separate can become more complex and integrated in a non-linear fashion. He states, As a living open system, the person has the capacity to take in matter, energy and information and release the same back. The individual tends to evolve towards a higher ordered, more differentiated system. So we are systems seeking integration as times become more chaotic. The healing state is similar to that of the flow. Csikszentmihalyi described flow as a time of focused attention where the person is "completely involved in an activity for its own sake. The ego falls away. Time flies. Every action, movement, and thought follows inevitably from the previous one, like playing jazz. Rituals such as Tai Chi, meditation, mindfulness, yoga and martial arts as well as some sports such as golf improve the capacity for achieving the flow. The healers focused attention can tap into a flow state where time and space fall away with only the moment of staying with the intention of allowing whatever needs to happen. Healers which catch the wave of the flow available there in the field become completely quiet which allows them to have a greater clarity as to what is needed. Their focus sharpens to picking up the information within the persons field but also information from the greater Oneness. MatrixEnergeticsdeveloperandhealerextraordinaire, RichardBartlettexplains,

32

Dissolvetheideathathealinganddiseaseareapolarityandthatonecant existwithouttheother.Inanopensystemthatisnottrue.Inanopenorso calledfreeenergysystem,youcangetmoreenergyoutthanyouput in.Transformationisamiraculousprocessthatcantranscendwhatyou thinkofasthelawsofphysics. Healers work with the principle that the Universe is an interconnected whole and we are in a systematic relationship with all existing in this dynamic of universal consciousness. Tuning into the right brains intuition includes following your wise hunches, dowsing, muscle testing, and applied kinesiology and all are methods that give a direct connection to your body/mind to access its wisdom. The subconscious mind is more suggestible than the conscious mind. It can be more flexible, open and willing to interchange information. Richard Bartlett concurs: Everything is information. Unconscious awareness becomes an energetic signature. It can be deconstructed or projected to a distance for healing. The information is there. Your subconscious mind knows all of it. Get out of the way. Tune into the Morphic field and get information and then drop it. Deep, core beliefs about being unlovable, undeserving and unsafe that exist in the unconscious can be eradicated when addressed with intention and love. Intuition from the unconscious mind is enhanced along with openness and empathy. Empathy is the ability to deeply care about the feelings or situation of another person and sit with loving compassion for whatever they are experiencing. Being with someone who sits in loving compassion without judgment is a restorative process. Albert Einstein said, The idea that there is separateness is but an illusion, we are all one thing in this universe, and our job is to widen our circle of compassion till it surrounds everything in the universe. Compassion is an integral part of healing. We can access this Source for others or for our own healing. The Thymus Gland and the Energy Portal of the Heart Chakra The Thymus is a small gland located in the chest just under the breastbone. Many spiritual healers consider it to be the energy portal of the Heart Chakra. It brings together the energies of the heart where light or energy emissions are experienced in their essence as Unconditional Love. It is considered the master gland of the immune system responding when there is infection to create needed hormones and T cells. It is sensitive to intention, vibration and sound. Renee Brodie is a sound and crystal bowl healer from the United Kingdom. She wrote The Healing Tones of Crystal Bowls: Heal Yourself with Sound and Colour, and emphasizes that the thymus responds to sounds made by your own voice and those
33

around you. The whole body, mind and spirit need peaceful and lovely sound to create a space in which we can move forward into the full light. Brodie states that the thymus brings together the energies of the heart (love) and throat (creative expression) in total loving communication and to create a strong immune system. Aligning the pineal, thymus and pituitary glands are part of the ascending process according to some spiritual traditions which believe that the pineal is the receiver and transmitter of higher consciousness energy. The Thymus Gland is associated with the heart chakra. It is said that it is the heart that sets the intentions. Stress causes the thymus gland to shrink as is the case with people who have illness and physical stress. It is helpful to your healing to stimulate the thymus gland by thumping it daily and even several times a day. Brodie relates, It has the role of Master Controller that directs life-giving and healing energies of the body, and is strongly influenced by the individuals physical environment, social relationships, food and posture. The thymus gland shrinks with aging. The Thymus Thump is an exercise which was described by psychiatrist, John Diamond, to stimulate your immune system. Diamond believed that our health was directly related to the strength of the thymus gland, saying that people with high strength in their thymus gland respond with strength when faced with adversity. The positive aspects of the thymus gland are courage, faith, trust and gratitude. John Freedom added using laughter to further stimulate the positive motions and neurotransmitters. So with that in mind, heres a one-minute thymus thump tool that will recalibrate your energies. The The Thymus Thump with Laughter To bring together the energies of the heart, make a fist with one hand and thump it over your Thymus in the upper middle of your chest. Visualize the implosion of positive energy in the heart chakra. Feel the vibration; the body loves percussion and loving intent. Take a big breath in and smile. Start laughing out loud, Ha, ha, ha as you exhale and inhale in a rhythm that matches your thumping. Thats right! Beat your chest and laugh. Fake it until you start thinking of something funny. If you cant think of anything humorous, just fake it. The Thymus Thump exercise is so quick and easy to do, taking you to a different state of consciousness. Do the Thymus Thump every day to stimulate your thymus gland, balance your bodys energy and shift into a loving, whimsical outlook on life. Reflect on several things that please you or for which you feel gratitude to further activate the heart chakra.

34

Then tap briskly on your collarbones which is an acupuncture point called Kidney 27 in Chinese Energy Medicine and under your arms down from your armpits, a Spleen point. Tapping on these two points is a quick balancing exercise to counteract fear and helplessness. The Thymus Thump gives a good energy interconnection within and boost to start out your day. Connecting with empathy for yourself activates access to the subconscious mind. Richard Bartlett draws from Quantum Physics in his Matrix Energetics suggesting that you draw from your subconscious mind to access all potentialities: By cultivating the habit of asking powerful, mind-altering questions, you are training your right brain to respond to the signals from your subconscious. anything you notice from the domain of your five senses after asking the question is potentially usefully and possibly life altering. Persistence and belief are the keys. Believe in yourself. You have the right to guidance, love and assistance from the realms of Spirit. The Symbolic Language of the Unconscious Mind The subconscious mind has a language that works through symbols. In addition, the richness of symbols in metaphors, fairy tales and myths bring out the language needed to accomplish healing. Symbols carry energy that engages right brain input. Information is transmitted through symbolic images that can be decoded. Bartlett explains, The subconscious mind operates on a symbolic model rather than a linguistic one, and the images that percolate up from it to the conscious mind, if they can be recorded and deciphered, can be used in reverse fashion to give instructions to the subconscious. We all carry symbolic memory as evidenced by the images received in dreams. Unbidden imagery and ideas arise when the healers ego gets out of the way. Data is waiting for integration. Free-flowing images, symbols, desires and longings of the subconscious emerge and are picked up by the healer to foster coherence and brain integration. In the midst of turmoil, you can learn to maintain a coherent field through daily acts of symbolic appreciation and gratitude. A small change can move a system. In this highcoherence state, which some call fifth dimensional healing of love and acceptance, there is deep alignment with Spirit. One ritual which creates the vibration of thankfulness is paramount. William Blake said, Gratitude is heaven itself. Focus on gratitude and acceptance as a daily ritual to create a high vibration of healing. The highest vibrational energy is the pure state of love of the Oneness. When you ask for assistance from the higher forces in the universe, you create an energy field connection to the greater whole. Leonard Laskow explains, Love creates an energy field that affects all
35

that enters it. It is said that the loving field of Christ was so powerful that people were healed in his presence. This great avatar taught that loving energy is the energy of oneness, harmony, balance, and peace. In the presence of a powerful loving field, if there is the intention and willingness for healing to occur, the body's inherent self-healing capabilities will be stimulated and augmented. Healers have the ability to connect to the great data base called the Universal Mind. You can always ask for what you want. You can request to draw from the field of Oneness of which you are already a part.

36

Chapter 8 The Process of Healing Knowledge, skill, attitude, belief, intention, will, laughter, love, and human caring can all facilitate the
healing process. Thus, we can enhance or interfere with the body's inherent healing process. the energy of love and the creation of a loving field can profoundly enhance healing, not only physically but mentally, emotionally, and spiritually. Love is not only the stuff of poets and mystics but a tangible, transmittable energy that can produce healing. Leonard Laskow

Author Rothlyn Zahourek Ph.D. is a psychiatric holistic nurse who has conducted research on the intentionality of healing. After carefully interviewing healers she concluded, We are all born with this capacity to attend, focus, develop purposeful thought and motivation, interpret meaning and purposefully act. This capacity enables us to put desires and dreams in actions. It evolves as we evolve and is influenced by the same phenomenon that affects our general psyche-social-spiritual development. The movement of light and information is necessary for the Universe to evolve. We are those movers using our immaterial thoughts, ideas, wonderings and imaginations. As purposeful beings, instinctively we seek learning and understanding. We seek order. Energy wants to move. Thoughts are energy. We use movement to seek what we do not yet understand. Even slime mold can solve mazes. According to ancient shamanic lore, Spirit must come when called. The summoned deities, guides, teachers, sages, saints and other evolved beings bring their frequency resources to assist in the session. Command the Law to work, said Ernest Holmes, developer of the Science of Mind principles, which emphasize using the mind to obtain healing. Jesus did not pray over people when He did his healing work; he commanded that healing happen. The ancient law of healing is It will be done as you command. Preparation for healing starts with one persons taking the responsibility for being a catalyst for change. Their mind tunes in going to an altered state of consciousness. The outer awareness of the environment is decreased through setting ones personality and ego aside while quieting and settling the mind. This quieting time sets the stage to pick up subliminal cues in the other persons subconscious mind and energy field. Going into trance allows for an upward shift in understanding while moving attention away from the physical body and environment. The practice of centering puts the healer in the position to receive information from the overall field; he or she learns to wait in this altered state for divine guidance to come through.
37

Steps to Healing In this quiet state, you become alert, relaxed and aware to allow information to come from your subconscious mind and the other persons energy field. You learn to listen with your whole being to get the invisible and subtle cues for someone else or yourself. With practice you can tune into the desired state that brings information. 1. State an Intention: The process of healing starts by stating what you would like to have happen by stating a desired need or request. According to Therapeutic Touch research on healing, intention is considered to be more important to create change than the type of procedure chosen. The intention points the direction of the desired outcome. Stating an intention of wanting the best for another gives a single-pointed awareness and intense absorption in the process. Verbalizing the intention out loud shapes the expectations for both healer and healee. Intention does not mean to will an effort to happen. To will is to try to force an outcome by applying pressure. To intend is to open to all possibilities stating what you would like to have happen but allowing whatever comes forth. Say what you want and then get out of the way. There is a forceful energy that supports evolutionary growth. Be intentional but not willful of connecting with healing to ride with the energy of the Field. To increase your own healing ability, set your intention with love while doing these exercises. Sharpen your focus on positive change and hold it. See, feel and experience the power of love plus intention as powerful change agents. Fervent desires reach heaven, says an old proverb, so be passionate in your intention for healing. 2. Create a Healing Ritual: Human beings require rituals; we have an inborn need for meaningful ceremony. Repetitive rituals are comforting: they create a connection between the participants. They stir our deepest longings to be whole. Rituals come about as a response to need. The rituals can be simple or elaborate but they have deep meaning for us at both a conscious and unconscious level. Visiting a shaman, a healer or a therapist and entering into their procedures can be a powerful ritual. Likewise group rituals create the where two or more are gathered in his name effect. Energy information is transferred in an interconnected field or system. 3. Focus Attention: Lynn McTaggert in The Field, researched quantum physics scientists who study the transmission of energy. She concluded that the healing sessions were intensified by rapt attention and peak experiences of emotion that create a ritual of collective resonance. Intense intention and the expectation for change set up a common energy field to get the ego, along with its lower consciousness vibrations of contraction and fear, out of the way.
38

Energy follows awareness and attention. Projecting the mind for change sets up the framework for the manifestation of information transfer towards movement and wholeness. There is focus on choice for the good of the person and the greater good. It can help the healee release detrimental beliefs, learn repetitive life lessons, release karmic patterns and increase his consciousness. Buddhist monk John Tarrant said, Attention is the most basic form of love. Through it we bless and are blessed. The focus of attention helps shift your brain waves into a state of consciousness where you can ride the energy of the field. 4. Let go of Expectations for Change: Experienced healers agree that they do not do the healing; they are merely the vessel through which a desired outcome in another person may occur. They recognize that to try to direct the specific outcome so they can feel good or take credit merely feeds their own ego. There is an innate wisdom of the body, mind and spirit that knows what direction the healing needs to go. So the message is clear surrender the desired outcome and give up what your ego thinks is needed. Keep your outcomes clean and free flowing by avoiding expectations and the need to control what happens. 5. Call Upon the Higher Forces and what you Believe in to Assist the Process. Turn the healing process over to the greater order of things which is ultimately in charge. See, feel and experience the intense power of love as the powerful change agent while bringing in Higher Resources to promote change. Go into a state of innocence and purity and the focused state of forgetaboutit. Its not about you in the bigger picture. There is an Intelligence much greater than yours at work here. Call upon it for assistance. 5. Allow an Experience of Emotional Intensity: We are emotional beings. Human emotions register and harness energy fields that transmit and transfer information to each other. The accompanying rush of emotion creates a deep release within the person and feelings of relief as he recognizes a truth about himself that has been buried. This high level of love energy allows the person to go past the illusion in which he has lived, past the belief system under which he has been operating, to tap into the true nature of the universe. As the person resonates with this new-found energy of love, his entire body vibrates with his heart center. People often feel deeply moved during a healing ritual. Feeling strong, positive emotions during a healing ceremony imprints the vibrational change on the emotional body. A fragmented part of the self is brought forth and integrated; there is a moment of compassion accompanied at times with tears of gratitude. The gratitude attitude is innately healing. At times, the participants may feel flooded with emotions of being humbled and surrender some longstanding belief with intense gratitude. The surrendering to the healing experience shifts the muscle tension patterns of the body that have been
39

tightly held. The chemical release in this type of tears is of a different substance than that in tears of sadness over loss. Information flows in to expand openness and awareness to Lifes beneficence. 7. Say Empowering Words that Define the New Sense of Self: Talking or thinking about the experience of healing allows its integration in to the total being. Verbalizing some ideas about how the experience has changed you for the better helps imprint the new concepts even further. Visualizing how you could be different in the future anchors the change even further. 8. Recognize the Automatic Integration of the Two Hemispheres of the Brain: In the desired state of calmness and well being, the positive neurotransmitters release and the energies of the brain automatically shift to bring hemispheric balance. Blood flow and energy shifts from the overly reactive left brain and the right brain comes on board. The former problem is seen from a full-brain perspective rather than from the old limited state. 9. Recognize that Healing is an Ongoing Process. Our body, mind and spirit is designed to return to the state of homeostasis again and again and is willing to assist in a lifetime endeavor to stretch and grow. Pastor and healer Ruth Carter Stapleton said, Inner healing is a ladder, not a single rung, a process rarely a onetime event. Healing may or may not bring about desired physical body changes or a cure as physical diseases can be very complex with distortions in physical, mental, emotional and spiritual levels. As we are body, mind and spirit, sometimes there are changes in physical symptoms; sometimes not. At the core, the greatest healing happens at the spiritual level.

40

Chapter 9 How Healers Develop Their Gift


Peoples faults can only be cured by loving them. You can love a greenness into ripeness... or have the owner or sufferer from the greenness into such ripeness as is in him to develop. Kahil Gibran

Archetypes as vibrational images and metaphors learned from our cultural conditioning exist in our individual as well as our collective psyche that guide and beckon us inward and onward. Mythic meaningful images are embedded in ancient legends, fairy tales and replayed in novels and movies. Universal archetypes are primordial images that exist in the awareness of all people coming from various and diverse cultures. The concept of archetypes, said Jung, arises from repeated observation that sometimes myths and tales from universal literature comprise well-defined themes which reappear everywhere and every time. We find the same themes in fantasies, dreams, delirious ideas and illusions of individuals that live in our present days. He goes on to say, The archetype is empty; it is a pure formal element, nothing else. Life giving or life threatening, the archetypes come forth from shadow material and are to be brought into conscious knowing, not banished nor railed against. As instant labels, archetypes give short-byte information and can invoke emotional memory. Choose your archetypes well (or do they choose you?) for they evoke strong meaning and a call to action. For example, those of Christian beliefs might identify an archetype of Jesus Christ as The Sacrificed Christ, the Bleeding Heart Christ, the Ascending Christ, The Angry Christ whipping the money lenders, Christ as the wise teacher of parables or the compassionate healer or the Second Coming of Christ. Or going beyond religion and taking a larger perspective, as the Christ Consciousness energetic which brings compassion and higher consciousness.

41

The Compassion of the Christ Consciousness Energies for our Planet

Your archetypical beliefs define you. Conjure up your demons anyone? Check those negative archetypical images that infuriate you. As the saying goes, If you see it, you be it. If you feel it, you are it. What you focus on and share energy vibrations with is both a mirror and a ticket into your future. Readers who choose to read this book are most likely on a spiritual path to become a healer even if the healing is directed at themselves. And so we look at the archetype of healing. Opening up to the healing abilities within is a journey of many steps and can run concurrently with the spiritual path. Each person has his or her own extraordinary journey of developing the deeper aspects of them to become a healer. And yet there is a general process of gradually understanding and developing ones unique gifts. There is a technology to this science and art of healing. Some healers with a personal history of family dysfunction, trauma, illness or pain have a greater need for personal healing. This is the wounded healer archetype and many have a greater understanding of the pain of others as they have experience pain themselves. Archetypical connections that involve emotional and physical pain can be karmic in nature. For some, becoming a healer is not a choice but a calling that may start with awareness of a personal loss, imbalance or discomfort and recognition of a necessary need for change. There may be a healing crisis where the energy builds up around a psychological issue. Upsets and abrasion in life are needed, as the Chinese Proverb reminds us, "The gem cannot be polished without friction, nor a man perfected without trials."

42

There may be a bottom-hitting time with time spent in despair with a soul-searching recognition that the life is not working as is. The person may mull over unanswered questions in their search for inner peace. The intensity becomes more desperate with the ego hanging on for dear life. Remember that the defenses operate to keep a persons emotional pain from surfacing. As the psychological defenses break down while in the painful period of hitting bottom, a refining hope can emerge about the potential for change and for restoration of wholeness. Wounded healers have experienced pain at their own core level and have the ability to draw from their life experiences to help others. They understand the restorative effect of just being with someone in pain with openness and compassion. After becoming healthier themselves, they become aware of yearnings to help others as well and a keen desire to make a difference to the world. As the healer matures, refined shifts happen on many levels: values, feelings, motivations, neurological organization, ethics, belief systems and world views. These vibrational changes provide a new identity and expanded sense of self and consciousness. Growing in Compassion The healers true capacity is the art of seeing the state of health in the person seeking healing. Knowing the perfection and wholeness of the individual creates an energetic field where all such things are possible. Sitting as a compassionate witness to anothers pain helps create acceptance of what seems horrible. Healers learn to clear the mental clutter from their own minds by working out their own issues as they progress in order to become a clear, telepathic channel. They participate in creating an energetic field to allow in the natural frequencies that transmit Universal information and light. Telepathic sensitivity is developed as they intuit, feel or see vibrational changes in the client as they happen. Alice Bailey says that Love (not sentiment) is the clue to successful telepathic work which happens when the soul of the healer connects with the soul of the person in need of healing. The healer becomes sensitive to the feelings, emotional reactions and needs of the person and tunes out what is not relevant. The healer learns to direct the energy emanating from the energy field and move, balance or integrate it within the client. Boundary softening and expansiveness allows closeness, connection and a great sense of peace for both participants. Healers gain the ability to simply sit in compassion when the client is in pain. As healers expend more energy in developing their skills, they understand that all is interconnected in the universe. They become more generous and have a strong desire to be of service and
43

become aware of their unspoken contract with the Universe. "After the verb to love, the verb, to help is the most beautiful verb in the world, said Bertha Von Suttner, the first woman to be a Nobel Peace Prize laureate. Some people are born with a natural gift for healing; for others, it lies dormant until a certain time of their life when the yearnings inside emerge. Some find their talent by immersing themselves in books, trainings and different healing modality exchanges with other healers. Whether innate or trained or a combination of both, the pursuit changes the healers interests, personality and life course. They become passionate about being receptive to the spiritual influences of healing sounds, traveling to sacred sites, taking courses and visiting different spiritual teachers. Some may share their own process of healing with others as evidenced by Alcoholics Anonymous and other approaches which encourage self-disclosure. Some healers focus on a certain tradition for their craft or work within their specific religion. Others become eclectic in their approach sampling whatever as directed by their inner wisdom. They seek out complimentary modalities and cross train in different healing practices. As their skill set grows, they become more open minded and use their intuition to bring whatever the client needs to restore wholeness. They learn to keep their mind in a highly focused state to be in the moment with the person sitting before them. Extraneous information falls away and the outside world ceases to exist during the healing session. The process of moving from a beginner to an expert healer unfolds as the person becomes more familiar and confident in their role of drawing from Universal Energy. Deep shifts in consciousness occur when a healer practices being in the presence of an intangible power greater than him or herself. Rothlyn Zahourek described how ongoing practices of healing deeply change the individual for the good: the intent for healing becomes imbedded and, as a result, a natural, effortless and nearly unconscious response. The individual develops a healing persona, which is more spiritual and reflects a core of being that has been profoundly changed. It is the development of a healing stance or posture where the person finds it nearly impossible to not heal. For some healers, their journey may halt or take a detour away from their deep spirituality for awhile. Others become more grounded and their expansion of consciousness progresses exponentially. As their spiritual journey continues, the healers ego decreases as their capacity to be with those who seek their healing gift of being able to stay present in the face of anothers pain. Expert healers see themselves as a unified whole with others and all dimensions in the Universe. This is the development of consciousness by conscious design. They use the tools learned on themselves to activate
44

their goal of becoming the best person they can be. Being of service becomes a major goal and direction for their life. This then is the path of the ever-opening heart.

45

Chapter 10 Finding the Small, Still Voice Within


If you love Me, keep my commands, and I shall ask the Father and He will give you another Helper to stay with you forever, the Spirit of Truth whom the world cannot receive, because it neither perceives nor understands Him. You know Him, for He remains with you and will be within you. John 14: 15-17 The Bible, Revised Berkeley Version

In following our own personal vision for healing our self and the planet, we face an exciting challenge. The challenge is to become the most loving, self-actualized individuals that we can become. We have the tools to do this now with the self-help groups, personal growth workshops, therapeutic techniques and spiritual guidance that are available. We are being given the opportunity to achieve our highest spiritual level, and in doing so, to change the world. Following our vision is easier if we have a process that encourages us during times of doubt. Visionaries from all times and ages have been strengthened by listening to their inner wisdom as they followed their unique spiritual journeys. This age is about each individual learning to turn inward to listen to their Highest Self to live in full consciousness and integrity to work for the healing of our planet. We can learn to find our essentially loving spiritual nature to combat those feelings of inadequacy and unworthiness. The Quakers as well as many other religious traditions have the concept of "centering down" or having an inner meeting of one by communing directly with the God who lives within. The process of following your vision starts with developing a loving relationship with yourself. It is to turn away from the voices of fear and remember that you are love. To do so, we must learn to tune into that "small, quiet voice within which calls us. This is the voice that has been echoed in the sacred literature of the world. It is the voice that bids us to be who we were meant to be, pulling us forward through dreams, hunches and intuition to provide information about ourselves. It gives us the key to living from the part of us that hold the most integrity. Learning to use this voice, commonly called your Higher Power, on a daily basis is the most important thing you can do in recovering from the hold of material objects and harmful addictions. Keep at it looking back with hindsight as to the appropriateness of the decisions that come forth. Korean Buddhist master Kusan Sunim said, When there is great doubt, then there is great awakening.

46

Do not judge yourself, just lean into the part of yourself that doubts and smile at it. Forgive yourself for not having trust that you are connected to the greater whole and can access its wisdom if you set your fear/doubt aside. White Eagle said, When you are in doubt, be still, and wait. When doubt no longer exists for you, then go forward with courage. So long as mists envelop you, be still. Be still until the sunlight pours through and dispels the mistsas it surely will. Then act with courage. On Choosing Outer Teachers Spiritual teacher Brugh Joy described the concept of inner and outer teachers. Outer teachers are invaluable along the path of transformation. Outer teachers come to us in the form of a friend, therapist, workshop leader, minister, guru or a spiritual teacher. Some teachers come in the voice of an author or members of a self-help group or a twelve-step program. Outer teachers are individuals who believe in us at a time when we do not believe in ourselves. They can give information but are necessary only as long as we do not know who we are. They can provide some of the tools to make the journey and point the way for us. They are a step along the way and point us down the path, but they are not the whole journey. As Joy says, "Each soul is responsible for its own experience." The path that must be walked is our own. Outer teachers cannot give us our own truth. The function of the outer teacher is to help us get to the Inner Teacher. Some outer teachers still have their own life lessons to overcome. They may play out their unresolved issues of control within each group that gathers around them recreating those same dysfunctional energetic themes passed down to them from their families. As you come into the sphere of influence of a teacher or therapist, observe his or her codependent leanings. Does he or she subtly try to coerce you or others into doing what he or she thinks is best for them? Watch to determine if methods of dependence are used to gain a personal power base. If people are viewed as bad or sick, then methods of shame and blame are being used. Peer pressure and the group process may be used to tell the individual what he "should" be doing with his life. The new paradigm is to understand what has happened not blame others or yourself. The new way of dealing with conflict is to try to understand, take responsibility and fix the problem, not make people bad. The genuine spiritual teacher or therapist will give you the exercises to develop your own Inner Teacher. He or she will look at you with unconditional regard so that you begin to see your true worth and beauty. The true teacher does not seek to make you wrong but demonstrates how you might be better. He or she will continue to focus on their own lessons and issues rather than trying to rescue you or exploit you. Ethical spiritual teachers build checks and balances into their work to prevent exploitation of individuals who can become too dependent. They encourage their followers to think for themselves and to participate only in those activities with which they feel comfortable.
47

In choosing a teacher, channeler, therapist or self-help group, choose people with a high level of consciousness and sense of integrity. Your observations about whether the teacher practices what he or she preaches can help you determine the level at which they operate. Your inner wisdom can help you determine if the teacher is right for you as you listen intently for any dynamics of the teacher that mimic any dysfunction that may have been in your original family. Unfortunately, we attract what is unresolved within us! The same applies in choosing a person practicing the healing arts. Center and ask for guidance before making a phone call in seeking a healer. In the initial contact with the person and then after, notice where his or her consciousness lies. Is there a gentle, loving concern for your being? Is the person heart-centered or fear-based? Is he or she empowering or disempowering? Where is the love? Where is the humility? Use these standards when choosing a medium or intuitive. Does the person tell you negative things to scare you that only he or she can help? Does he or she come up with all sorts of far-out things you have never heard of from other dimensions that may not exist except for in their mind? Does the person use fear-based ideas to try manipulate you or make you dependent upon them? Listen for any messages of gloom, doom and negativity. Does he or she claim to "see" or "sense" bad energy or problems in your brain or body? Giving initial fear messages are ways of trying to control and manipulate you. Is there urgency present where the person seems overly involved in trying to fix you? Remember that fear emotions can be contagious. Dont get caught up in someone elses intensity of fear. Presence of psychic skills does not equal integrity. Notice if the person is overly charming, slick or needy as this may be their way of manipulating you to get money. Be especially alert if someone tries to sell you an extended package of healing for extra clearing because you are so damaged for an exorbitant amount of money. I met a woman who refinanced her house for $60,000 putting her marriage in jeopardy to keep paying money to a so-called healer which was merely a scam. Even if someone has clairvoyant skills and has been able to read you correctly and tell you things about your past or present life, this does not mean that they can heal. One of my clients got a great reading correctly telling her about her life, but then the medium offered to cure her of a hidden, imagined ailment for $7,200. A specific amount like this may just be the amount needed to pay off their credit card bill or the behind-mortgage payments. If you feel any reservations in your gut or notice your alarm system signaling doubt, tell the person that you need some time to meditate on the issue and get in touch with your guidance before making a decision. Get out of that atmosphere of fear and center yourself before deciding!

48

As our society learns more about the process of empowerment, the time of seeking an external healer, teacher or guru to turn over one's power is past. Yes, you can take information from a great leader and learn from books, therapy, self-help groups and experiential workshops. You can get some relief from accomplished healers. However, to truly move past your pain and dysfunctional behavior, your own inner base of knowledge must be developed. You are being asked to seek and find your own answers within and to find your own healing process. Fortunately, the techniques and methods to accomplish this great task are there. Finding your Higher Power will help to erase those misbeliefs about the unworthiness and sense of emptiness about yourself. Finding your truth through accessing your inner wisdom may be the most important thing you can do in accomplishing your healing. Steps to Develop Your Inner Teacher Outer teachers are part of the early spiritual path. The Inner Teacher takes the place of outside authority and guidance further down the road. The Bible tells us "...be ye transformed by the renewing of your mind." Receiving inner guidance can become a daily act that will transform your life. Meditate upon your concern. Ask questions that can be answered in the yes" or "no" format. Listen quietly to the messages that you receive. The voice may be hesitant at first or it may come only part of the time. Pose questions several ways such as May I do.....? or Shall I .....? One question to use is Is this action in my best and most perfect good for me to do this action?" or Is it in my highest and best interests to....?" Watch your wording. Your inner guidance will take the question literally. Ask for the clearest message that you need for guidance on the specific concern at hand. Sometimes a quiet question will suffice. What would you have me do? Then listen. Once you master accessing the inner voice, you can use it to gain answers to take on any specific matter. Asking with the proper intentions can be helpful in clearing the fears that are present. Your intent in seeking inner guidance should be to know your innermost loving self. Ask to have any fear or selfish ego thinking set aside so that you may truly know what is right for you. Its purpose is guidance, not to be a fortune teller. Do not try to use it for amassing personal gain, but only to guide you on your spiritual path. Dont ask for information of the stock market or which lottery ticket to buy. Remember you are seeking information that will assist your growth. Letting go of ego attachments that have been conditioned through living in a certain family within a certain culture should be your goal of fostering this inner wisdom.

49

Gaining Clarity and Discernment through Focusing Your truth is known when all parts of yourself are comfortable with what has been revealed. This is that "small, still voice within" that resounds with recognition. Your truth is that knowledge that brings tears of recognition to your eyes and gives a resounding "Yes!" in your heart. This is what EugeneGendlincalledafeltsenseinhisbook Focusing.Hisfocusingtechniquehasyoulistenforthatfeltsenseatabodysensation leveltolistentoyourgutthatsignalsthatyouhavetheinformationyourequire. Atadeepestlevel,youfeeltherightnessofthevibrationthataparticularanswer givesyou.Itisaknowingofwhattherightanswerisforyou.Yourbody,mindand spiritresonatewithtruth.Whenyouareinaccordancewithyourtruth,yourbody relaxesandyourenergyisenhanced. According to Gandhi, "Truth is what the voice inside tells you." The knowledge may come through as a voice, as a knowing or as a visual experience. Once you learn to go into a calm state where you can access your voice, there is no question to which you cannot gain the answer. Richard Bach, author of the popular book Illusions: The Adventures of a Reluctant Messiah, reminds us that if you know to ask the question, the answer lies within. You may not always like what you hear. You may feel uncomfortable or frightened by what has been revealed but you know its "rightness" in terms of your growth. Your conscious mind may disagree with what your wisdom says. You then have a choice to make whether to carry it out or not. Gandhi spoke often of this knowing: "...the moment of truth is suddenly there--unannounced and pervasive in its stillness. It comes only to him who has lived with facts and figures in such a way that he is always ready for a sudden synthesis and will not, from sheer surprise and fear, startle truth away." Discernment is absolutely necessary in recognizing the one true voice from other voices that you may hear. This voice is not the voice of your parents or other authorities in society. It is not a guilt-driven "should, must, have to or ought to." It is not the voice born of desire and cravings. The true voice has a different vibration and takes you out of the fear, guilt and obligation to knowing what is right for you based on love. It is the quietness of knowing that comes through, causing a release of body tension. It is the "Aha!" and the deep knowing behind the message by discerning what is right for you. The true voice is profound and at the same time extremely light. Some call it "the truth that feels like you." The answer of truth will feel right--it will feel satisfying and peaceful. But the demands of the crafty ego must first be quelled; when the ego is set
50

aside, truth can emerge. Satya Sai Baba said, People say I want peace. If you remove I (ego), and your want (desire), you are left with peace. How do you distinguish that one true voice inside if you have other voices nagging at you? Is the answer consistent with your standards and deeper values? Your fears send their voices also stopping you in your tracks in conflict. Determine if the voice comes out of your fear or if it adds to your sense of mastery. Is it in your best interests even though there may be some risk? Does the answer measure up to the highest ideal that you have set for yourself? If you feel unsure of the authenticity of the message you get, ask if the information that comes from your inner knowing is for your best and highest good. Ask the same question using slightly different wording to validate the answer. When there is conflict, still your mind and ask, "What is it that I really need to know? What is in my best interests about this matter?" You can choose to laugh at the tug of war that sometimes goes on between your conscious mind and your wisdom. The difference is that the conscious mind may be caught in fear and addictions whereas when you are connected to the greater Intelligence of the universe, the inner wisdom comes from love and the yearning to be whole. A Course in Miracles tells us that there are two basic emotions--love and fear. Love and fear are opposing emotions that cannot occur at the same time--where love is fear cannot be and vice versa. When you turn to the loving aspect of the deep knowing within thats generated by your heart, you bypass fear. Gathering Beautiful Fruits There are some strong considerations to be followed when you contact and use the inner voice. Continue to check to insure that the messages you get are consistent with your sense of your highest self. Continually checking is necessary to determine whether the information that comes through is of purity and love. Some messages, which have been received through an Ouija Board or channeled writing, may come from a lowered energy source, which can be mischievous or potentially harmful. Some may start out giving what seems to be correct information but then turn hateful. Spiritual books have long cautioned the novice on the spiritual path against using these forms of occult communication as they can pull in negative energy. Yet some individuals with higher consciousness have used these forms of communication and received information. Whatever way you bring in information, consider the messages you get; see if they fit with that which is consistent with your best and highest self.

51

Messages that lead the person into believing that he or she is a special person is another trap. There are dangers for being carried away into grandiosity if there is no active program for addressing the pretensions of the ego. False voices can subtly lead individuals away from what is their real truth into believing that they are special, are a divine messenger on earth or are reincarnated from important historical personages. Through constant study and cleansing and purification of reducing ego attachments, you will be able to discern the authenticity and appropriateness of messages that you may hear. If the message you hear seems grandiose or bizarre, it probably is. If it leads you to believe that you are special and better than others, its not your wisdom speaking. Once you learn to recognize the strength and power of your inner wisdom, you will better understand the discernment process of sorting out the true from the false voice. The determination of its authenticity then becomes how well it works for you. The Bible verse What are the fruits of the labor?" reminds you can remind you of the outcome of following messages received. If the fruits are beautiful and abundant, the voice is in alignment with everything that is truth for you. The ultimate test of truth, according to Gandhi, is the refusal to do harm to yourself or another individual. Daily practice and hindsight vision will convince you of the accuracy of the answers that come through when you tune inward. Check the results of your decisions when you have followed the advice of the Inner Voice. Keep track of the wisdom and changes that it brings into your life. As your confidence builds, you will find yourself turning to your inner guidance more and more for important decisions. Your conscious mind will become more in tune with the inner self so that you need not ask with regard to small issues. Your intuition will develop more so that decisions are made with your conscious mind and intuition working together. You will experience less conflict in your life as you have a means of always knowing what is right for you. As you learn to recognize the genuine authority of your inner guidance, you will realize the power that you hold is within your own being. Daily practice seeking your own truth, instead of relying on others, helps validate the information that you are given. Trust in this process of seeking within grows as a tenure of your experience. Once you are certain of the validation of the voice that you hear as being consistent for your growth and well being, the process becomes an automatic part of your spiritual practice. Your small, still voice within that is connected to higher consciousness will lead you to places that you do not want to go, as it will send you to places where you will challenge your fear. It will tell you things about your integrity that you may not want to hear. If you need to leave an unhealthy situation but stay because of fear, you will be shown the way.

52

You have already had some practice in being a partner with your inner wisdom. It has been present in moments of great decision and turning points in your life. It works daily in your intuition. Your invitation now is to ask it to come though directly to give you guidance. There is a part of you that knows your wholeness. This is the part that is all knowing and loving. It wants to speak to you of its yearning for your happiness. It has been there all along and now wants to speak in a direct voice to further your growth and creativity. Accessing the Small, Still Voice Within Close your eyes and start to breathe deeply. If you are able to meditate, go into the process that has worked for you. If this is new to you, continue to breathe deeply and become quiet and still inside. Start to feel your inner smile as the corners of your mouth turn upward while you think of something pleasant. Let the smile spread as you remember something funny allowing the nostrils to flare and the whole face to follow as you continue to send your smile to all parts of your body. Smile as you breathe in and out. Blow out tension, as you breathe in, bring in peace and harmony. Say to yourself several times, "Inpeace. Outtension." Feel the stirring for health and wholeness within. Ask all of the forces who have been working for your best and highest good to be with you. Ask to have any guardian angels or spirit helpers that assist you be present. Ask for your conscious mind to be set aside to gain information from the Inner Teacher. Make this affirmation: I am willing and ready to hear truth at a deeper level for my healing and transformation. Now in this time of quiet and harmony, ask a question about what is the best action for you to take on a specific matter. Ask a question where you will recognize the truth of its answer. Listen quietly to any changes in your thoughts, mind or body. The answer may come through as distinct words, a release in body tension, or as a "knowing." Listen well. Continue to inquire within while attending to the replies that you are given. If you are not given an answer, thank your inner wisdom for bringing you to this point. Make the affirmation: I am willing to set aside any fear belief that blocks my accessing my wisdom. My truth is there waiting to be heard. Repeat this exercise at another time again when you are in a contemplative state of mind. If you are given useable information, thank your Inner Self for this process of finding your truth.
53

Awareness is key here. Be awake for those moments of synthesis. Gandhi recommended that you be prepared to be blown away with each new recognition of truth, one after another. Go into the gentle, loving place of the heart and listen for the Truth that wants to come through. The wisdom is there waiting for those who become quiet and listen for it. In this translation of Proverbs 3: 13-20, wisdom is given a feminine gender. Consider this message of the astuteness of searching for and finding wisdom as a lodestar to guide your way. Blessed is the man who finds wisdom, the man who gains understanding, for she is more profitable than silver and yields better returns than gold. She is more precious than rubies; nothing you desire can compare with her. Long life is in her right hand; in her left hand are riches and honor. Her ways are pleasant ways, and all her paths are peace. She is a tree of life to those who embrace her; those who lay hold of her will be blessed. By wisdom the LORD laid the earth's foundations, by understanding he set the heavens in place; by his knowledge the deeps were divided, and the clouds let drop the dew.

54

One of Jungs Mandala Drawing from his Last Journal called The Red Book

55

Chapter 10 The Dark Must Be Played Through


Between the conception And the creation Between the emotion And the response Falls the Shadow. T. S. Elliott

The word psychology comes from the root word psyche which means soul or spirit. Indeed the journey through life with its accompanying developmental tasks is essentially a journey through the psyche. Psychology originally delved into theories of the subconscious mind through Sigmund Freud's and Carl Jungs influence. Psychoanalysis sought to describe human behavior in terms of instinctual drives and their repression. Behaviorism became highly popular for a period of 50 years through the theories of John Watson and B. F. Skinner. This theory sought to reduce human nature to complex chains of positive and negative reinforcements. In the l960s, Abraham Maslow opened up the way for a shift in the field when he studied healthy people and described love, meaning, purpose and humor which were neither reducible to infantile drives nor external reinforcement. Now the field has rediscovered the unconscious mind to study the spiritual aspects of human consciousness. An article in American Psychologist, official journal of the American Psychological Association, said that there was a scientific turnabout on consciousness in l970 leading to a true paradigm reorganization. As new energy streams into the planet, powerful opening-up techniques are being discovered and Jungian psychology and the use of dreams, myths and archetypes are currently undergoing a revival of interest. The mystery and paradox of being human is that you hold both the dark and the light. Carl Jung described how the human psyche is split into the persona, which is the aspect of the self of which you approve and with which you identify, and the Shadow, which consists of those dark, unbearable, hated characteristics. The Shadow is those parts of the self that are cut off from the rest just as a real Shadow is attached to the body. Unresolved issues lay buried in the subconscious mind outside the realm of knowing. Jung said, By shadow, I understand the 'negative' side of the personality, the sum of all those hidden unpleasant qualities, the insufficiently developed functions and the contents of the personal unconscious."

56

The Shadow parts are born of great confusion around issues of neglect, abandonment and abuse. The original trauma is called the activating event those overwhelming life experiences out of which the child forms his view of the world. Debilitating experiences in early life often have a profound effect on an individuals personality and subsequent life decisions. A trauma is an event of such confusion and terror that the individual feels helplessness and cant process its meaning to make sense out of it. The separated self is accentuated through the splitting of the self during trauma. Often there are conflicting messages associated with the emotions of threat and shame that accompanied the overwhelming event. These fragmented, multiple selves are formed when the child feels threatened and needs to protect him or herself during traumatic events where he cannot escape. He dissociates or runs away in his mind thus creating an energy field that is separate from the rest of the personality. These subparts, identities or alters of the personality are created when the vulnerable child becomes traumatized by shame, criticism, rejection and physical or sexual abuse. A subtle magnetic field with its own vibration is set up in the brain which holds the memories and overwhelming emotions of terror, fear, anger, shame and confusion. We Are Many Parts The subparts represent the different expressions of two basic emotions: love and fear. Layering of trauma after trauma creates the fear aspects of the person. Polarization occurs and events, others and your own nature are viewed negatively. This angry, self-debasing subpart develops if the child was raised by a negative, critical parent and some part identified with that energetic pattern. A negative, self-critical side of the personality is developed resulting in dysfunctional communication and behavior patterns. During early traumatic events, the person formulates core powerful beliefs or scripts (I am unlovable. I am not worthy. I am not safe. etc) that will play out consciously or unconsciously in life. Often there is a cluster of other negative beliefs that become fixed to the central negative conviction. Fear programming beliefs then run the life, playing out what the person decided was true at a time when his resources were nonexistent or small. Core beliefs center on not being safe and ideas about the self, others, the environment and/or God. Some are unknown, stored deep underground in the subconscious mind. These are considered developmentally arrested, little child parts. The Shadow holds these core negative beliefs, keeping you stuck in denial, discouragement, desperation and despair. It holds the not knowing that prevents you from knowing. Denial with its projecting of blame, excusing the self or refusing to see the truth behind the issue is only another symptom in clever disguise.

57

Ignoring or attaching to these Shadow subparts by denying or projecting them often gives rise to physical and mental symptoms. Attachment to the darker fractions of who you are happens due to the feelings of horror and shame about exposing them to others. Thus, attachments become the source of isolation and separation from others; the parts may become autonomous, appearing to have a life of their own. In buying into the fear that you are bad, you unknowingly add to the disintegration of unity and consciousness. As Jung said, Whenever we are still attached, we are possessed; and when we are possessed, there is one stronger than us who possesses us. Some individuals are aware of these different subparts of their personalities, most are not. Amnesic barriers to remembering the terror of the trauma or parts that hold the pain are put in place so you wont feel its impact. The more conscious you can become about the disparate parts of the personality, the more centered energy is available for helping others and living a balanced life. What you do not know about the more dysfunctional subparts can hurt you. Energetic Interferences at a Core Level Often in unhealthy families, there are rigid rules that state that negative emotions should not be expressed. The child learns to emotionally detach from any experience that might be painful. As a mechanism of self-defense, the child shuts down a major part of him or her self the vulnerable feelings are repressed or he or she may go into an anger state. Yet the energies around the repressed feelings remain as they not allowed to be expressed. Energy must go somewhere as the laws of physics tell us. Repressed feelings become stuck in the fragmented younger child parts that have been split off. Shutting down the negative emotions binds them to the persons physical body and helps create the energetically-defined much younger subparts. Jana Dixon says that Repression does not simply make things go away but condemns them to the shadow realms, where they incubate and infect the entirety of our lives with poison. Numbness and unconsciousness produce ever-increasing dysfunction, neurosis and removal from reality. This is called developmental arrest where the person stops growing emotionally but remains stuck on that issue at that earlier age when trauma first hit. Unhealed emotional wounds are registered energetically in the body as duality thinking and separation from the Oneness. Injury and not being heard or validated can create a split in the total energy; fractures are held at an energetic level in the subconscious mind. The subparts carry different vibratory rates of energy, i.e., the confused, spaced-out part is different in terms of the amount of resources that are available to the person than the self-confident part. Brain studies show that they have different neurological patterns.

58

They may each hold their own emotionally-laden memories of pain around that originating event. Trauma can cause the blood to be shut off to the forebrain and sent to the midbrain which activates the stress hormones. Survival through limbic system activation takes precedence when we perceive danger even though the threat may not be a rational one. The limbic system becomes dysregulated and the neo-cortex which has logic and rational thinking goes blank. Brain studies show that the limbic system lights up during stress conditions and the adrenal glands are activated for a burst of energy to prepare to fight or flee. The subparts represent conflictual pairs of opposites (from bad to good) that operate within your consciousness and are seeking resolution. Seen simply, they are disowned energy patterns that are out of harmony with the integrated self. Conflict between the parts requires energy and draws from the total reservoir that could be available. Chaos reigns within and coherence is lost. The flow of consciousness is interrupted. There is injury at a deep level which is perpetuated by the ego beliefs of separation. In addition to energy disruptions in this life, interruptions also come from three other karmic sources to disrupt the flow of energy towards wholeness: Ancestral (genetic patterns of the parents, family, grandparents, ancestors) affecting the DNA. Other dimensions-- past lives, other aspects of the multiple selves and the collective consciousnesses. Soul all that has affected us including karmic patterns and lessons.

Divided parts have potent energies, which results in the person playing out the negative behavior pattern again and again. Sigmund Freud first described the repetition compulsion, which is behavior that represents a re-enactment of the childhood trauma. Having their origin in learned messages and internalized beliefs about self-worth, different parts continue to play out their function, rising to meet current situations. Freuds concept of repetition compulsion is that negative ideas hidden deep in the subconscious mind that are not brought to consciousness and addressed will repeat in your life. The crafty ego is resistive every step of the way. Jung said, "The psychological rule says that when an inner situation is not made conscious, it happens outside, as fate. That is to say, when the individual remains undivided and does not become conscious of his inner contradictions, the world must perforce act out the conflict and be torn into opposite halves." The deceptions of the ego are like the layers of an onion to be peeled away. Jung
59

believed that healing is moving past the snares of the ego that preach disgust and moving into self acceptance: We cannot change anything unless we accept it. Condemnation does not liberate, it oppresses. We Cannot Help but Act Our Unresolved Defenses Negative core messages show up as primitive defense mechanisms such as passive aggressive behavior, whining, splitting, anger reactions, addictions, and blaming others. They are played out as psychological reversals such as Im unlovable, unworthy or unfixable. A common defense of these times is playing out the angry/victim core script. Unresolved feelings are shelved away somewhere in the body-mind complex and acted out as behavioral or physical symptoms. The disruptive feelings remain on the shelf until the time comes to deal with them. Ongoing, intrusive experiences trigger old undigested emotions and memory fragments, bringing them to the surface. They come back with a vengeance in playbacks such as dreams, intrusive thoughts, dreaded memories, acting out behavior or physical problems. The previous energy of wholeness becomes the energy of defense with the mission of not allowing the self to become hurt again. Virginia Satir, a pioneer in the family systems movement, used to say that all behavior, no matter how distorted it was, has a purpose. Aristotle said, Everything in Nature behaves to achieve a goal. You are purposeful beings, although you cannot always understand why you do the things you do. Much of the underlying purpose of seemingly irrational behavior lies hidden in the subconscious mind. Each symptom or behavior pattern, whether it is physical or mental, has its own underlying meaning and function. Even the so-called negative aspects of the personality exist for some reason. The submissive part, the aggressive part, the acting out part, the sick part, etc. were each learned in childhood as a survival response to a threat in the environment. Seemingly nonproductive parts continue as a fragmented energy pattern in your behavior as an adult as over-learned autonomous patterns. They remain when you are in denial or dont know how to release the negative subconscious content behind it. The patterns that have been formerly passively ignored and denied or active resistance or agitation are not addressed, imbalance builds up. As energy fluctuations which are vibratory in nature increase, the instability of the individual increases. Illness, physical stress, fatigue, sensory deprivation and threat of harm render the person into heightened conflict and a weakened state of the ego. In this vulnerable state, the system can collapse allowing new ideas to take form. Preconceived notions or distorted versions of reality fall away, which sets the stage for new patterns of health to be suggested. The moment of release comes when the individual can give up the rigid structures of the defended ego in order to view the events and situations of his existence with acceptance.
60

Ye Suffer from Yourself, Nothing Else Compels Our ego is not all bad. The psychological community relates the term ego to the need for sufficient ego strength to organize our life to make it go smoothly. The egos positive functions are to figure things out, plan and organize. It makes distinctions and hierarchies based on the need to survive and to distinguish less than and more than. The ego analyzes a situation and determines that what it concludes about it is real. It develops beliefs which may or may not be true. This is the concept of the healthy ego as described in some psychological literature. However the ego has a dual nature and another meaning which will be used in this book. The common usage of the word ego in spiritual and Alcoholics Anonymous writings is as the fear-based part of the self that must defend, rationalize, nag, scold and judge. Here, the ego holds the repository of betrayal that holds onto the hurt, the pain and the defiance. The negative part of the ego has a closed mind and does not want new information to come in to refute current opinions. It sets things in stone and then believes the writings it has made. To wander into ego territory is to be on a constant vigil with roadblocks, seemingly inaccessible peaks, sudden drop offs and ever-present illusion. Participants from AA call the ego Easing God out. The ego is the mechanism of attachment. It is the chatter mind part of the greater whole that incessantly says, Its about me. I hold the trauma story. I know the problems and obsess about them. I must run the show. Me! Me! Me! When there are fears in a life, the ego is the problem. It holds a narrow view based on fear, loss and pain and cant experience the vast expanse of the Total Self which is connected to God. The ego tries to prevent you from recognizing your Shadow parts that hold greed, deceit, denial and self-importance. You might dislike, be ashamed of or even hate your dark side for the raw power it holds and the possibility of destructiveness within. Our religious traditions steeped in the concept of original sin have long demanded that you try to control or destroy the more animal-like aspects of your nature. When society did not have the required knowledge or techniques to work through anger, lust, hatred, manipulation and greed, the only answers seemed to be denial or control of the negative emotions. The Shadow aspects are merely a part of the sum and total of the complexity of the human condition. They hold power over us only when they operate deeply in the subconscious mind, misunderstood and unexplored. Philosopher and mystic resident for our planet, Ken Wilber said that there is strong opposition to owning negative aspects of our personality.

61

All of us have a dark side. But dark side does not mean bad side; it means only that we all have a little black heart... Those items in the environment (people or things) that affect us instead of just informing us are usually our own projections. When you refuse to acknowledge your dark side, it clings tenaciously. What you are ashamed of or deny in yourself gains great power just through the energy it takes to contain it. You remain in conflict when you have to hold something strong at bay all of the time. The heart and soul long for more. The conflict between wanting what you want of the ego-based personality and the longing of the soul for purity and simplicity uses up much psychic energy; we call this confusion, depression or anxiety. Longing both sets up and takes us through this conflict. Rumi describes this exquisite pain of seeking and releasing: Longing is the core of mystery Longing itself brings the cure. The only rule is, Suffer the pain. Your desire must be disciplined, and what you want to happen in time, sacrificed. In looking at the Shadow part in ourselves, we are reminded that there are always moral decisions. The behaviors that you abhor can be brought forth and examined in the light of day. Observing how you treat others and yourself is certainly a large part of the spiritual journey. There are choices on how you live; many of the choices you make have a moral basis based on your values. Spiritual teacher, Lazaris said Choice is focused intent. It triggers belief, attitude, feeling and decision making. Choice is the keystone to creation and manifestation. Choice can encourage the subconscious to override the subconscious. Choice opens gateways to the future, to the possible and to your many possibilities. The choice to live with a pure heart is to choose to live respecting others and yourself and our Mother Earth. The spiritual journey is bringing forth the unhealthy, neurotic and selfish behaviors and confronting them with acceptance and determination to release their hold on the personality. The shadow is absolutely necessary in the process of spiritual growth. You cannot perceive things except when there is contrast. Dark Shadows and figure-ground contrast are needed for the sense preceptors and the nervous system to understand what is there.
62

Jungs work described integrating the Shadow parts as a life-long process of coming to terms with the unacceptable aspects of your personality such as hidden impulses, desires, selfishness, hostility and greediness which are merely aspects of the ego. Individuation is the longing for the essence of ones self. Integrating the Shadow parts is a major part of the spiritual growth process. The evolutionary process is to return to the wholeness of the Self--the return to the wholeness of all which is the Oneness. The process of integrating the many unresolved shadow parts to become aligned with the souls purpose is often a rocky one. However, knowing both extremes of your nature can open you up to the wonderful variations of all that lies between the two poles so you can heal the opposites within you. To understand and accept your own rottenness is a significant step on the way to healing. If you do not go into the dark you cannot expect to be of the light. You can flip the coin over to see the other side to find that it is one and the same. All is One. The greatest pair of opposites has to do with soul and personality, according to Alice Bailey. Your soul wants you to address the shadow parts to evolve while personality is that part of your ego which wants pleasure and escape from suffering and pain. Bailey describes this division between soul and personality/ego as a psychological cleavage which has the goal of becoming integrated. But I Just Want Everything to be Goodness and Light! Some spiritual people focus only on the light and the positive side of life. In doing so, they ignore a deeper, essential part of themselves which must be addressed. They thrive on myth, beauty, visualizations and rituals which make them feel good. They say positive affirmations but never do the deeper work and wonder why their negative emotions do not subside and why their lives dont improve. They are attached to the romanticism of spirituality and to rituals, techniques and workshops that make them feel good but are not transformative in nature. They cant address the negative polar opposites of their personality and thus miss out on the deepening of the journey. This is woo, woo spirituality which focuses only on sweetness and light. This may be a phase or a part of the process when accepting a spiritual framework to life. Spirituality is not only about being positive. Getting stuck in the fantasy land of your own mind keeps you from the depth of growing personally and spiritually. Discovering your spiritual nature is not spiritual highs and feeling good it is deep soul work. The spiritual path is a serious undertaking which is concerned with all aspects of who you are as a human being, including detachment from both the positive experiences of life as well as dysfunctional beliefs and behaviors. Those seven deadly sins of greed, lust, envy, stubbornness, hatred, denial and sloth are Shadow material to examine.
63

Jungian therapists Elizabeth Howes and Sheila Moon described their understanding of the Shadow parts: But these dark powers have their particular healing qualities, if you learn of them, and sacrifice your narrow ego defenses. You are the child of the below as well as the above. As we explore in the depths of our darkness and begin to accept it, we come to realize that it is not evil but rich and full. To gain the balance and integration of the body/mind/spirit, the dark must be addressed. Walking the Shadow side of the spiritual path helps you come to terms with the Shadow parts. In coming to understand, accept and forgive them, the Shadow side loses its power over you. Befriending the Shadow Parts of Yourself Seen from a higher perspective, our subparts, shadows, projections, neurotic behavior and seemingly irrational thoughts hold gifts for us. They can be windows into the darker regions of the self which are still unresolved. The disappointment, hurt, betrayal and anger that you feel at others selfish behaviors can be an invitation to look within at an aspect of the Shadow Self which is waiting to be reclaimed. Doing the Shadow work is a dis-identification process which allows for old scripts from the various parts of the personality to be integrated into the total being. The beliefs from the Shadow parts and their originating memories can be brought forth to be examined and expressed, thus allowing for their release. Most often, this is done with deep processing types of psychotherapy. Misbeliefs can be re-framed to cancel out old emotions of hurt, anger, jealously, shame and fear. As you move from the narrow, fearbased ideas and gain a new energy-activated perspective, you understand that your healing process is part of the total cosmic plan. Emotional patterns are transformed through the infusion of spiritual energy. The acceptance of the formerly-abhorred subpart is transferred into a state of neutrality through acceptance, which is a higher energetic state than fear. By owning the dark aspects of yourself, you release judgments and reclaim the fragmented parts. Spiritual writer Matthew Fox describes the acceptance of a negative subpart as a process of making friends: Learning to befriend the dark means learning to befriend nothingness, to reverence it. To let nothingness be nothingness. To trust nothingness. For in the ultimate of darkness, in what Meister Eckert calls our unknowing knowledge, wisdom itself is often tasted...we need to recall how holy nothingness is, how it deserves our respect and attention, how nothingness needs to be allowed in our lives. The Divine Plan is for Spiritual Growth

64

The Shadow parts must be brought out of the hidden recesses of the mind and be moved into the light. Give light and the darkness will disappear of itself, said Erasmus. Integrating the Shadow parts and assimilating them into the totality of the Self is the path to becoming whole. The Shadow parts also carry inherent goodness in them once you traverse the fear. The positive possibilities come forth when you sit with them, bringing them into the light with positive intention. This developmental process of seeking to return to the Source by transforming the Shadow parts is tied to the maturity and depth of consciousness of the person. As you move into the higher aspects of the spiritual path, you come to realize that the dark is part of being human. The dark is not empty, but rich and full. In accepting these disowned parts that you have kept hidden away, you allow them to become part of your healing resources. Integrating the Shadow parts and assimilating them into the totality of the Self is part of becoming whole. When you face the dark aspects of your nature in a different context than you faced them previously, and move in love and non-judgment, the energy of these dark aspects dissipates. You can own the deliciousness of being of the dark, and in doing so, claim the polarities. Carl Jung said, To confront a person with his own Shadow is to show him his own light. Keys to Integration: Understanding, Acceptance and Forgiveness All experiences hold opportunities for learning and you are here to get the lessons. Attachment to strong feelings and life experiences (we attach to the good experiences as well as the bad) is but an invitation to see the situation differently. Lessons are for learning and they are always about stretching and growing and dismantling the ego defenses. There is always a deeper message behind the surface feelings. "I am never upset for the reason I think," A Course in Miracles reminds us. This search for deeper understanding of your pain is about your search for wholeness and love. The Shadow work need not always be intense and serious. At times it can be held in the light with a sense of humor of the absurd nature of what it means to be human. A Course in Miracles reminds us "Forgive, forgive, and then forgive some more." Forgiveness is the final step in anger release. Yet forgiveness can never be a should imposed on you by yourself or someone else. Sometimes anger has to be expressed before forgiveness comes forth. Other times, forgiveness comes of its own accord. When the deep longing to touch into love is tapped, the heart opens and forgiveness can happen. When you forgive someone else or yourself, you are cleaning out your own Shadowthe part that is disliked and disowned. You may have to experience forgiveness for someone who hurt you more than once, depending upon the number of betrayals that have been perceived. You may experience an overall forgiveness, releasing the bonds of negative
65

energy between you and the other person. With surrender and forgiveness, there is a leap to Higher Consciousness where personal energies go into creativity, self-expression and service to the greater good for all. Seeking Wholeness and Union The ancient philosopher Plato said that there were two great movementsdecension and ascension. And so it goes throughout the Cosmos. Source/Spirit made manifest and scattered its Being as humans, on Planet Earth at least, in great diversity. The One became many and developed ego. Now we the many are to return to the One through this psycho-spiritual process that Jung described of heating our crucible and cooking our karmic seeds that encompass the fear programming we call the ego. The ultimate betrayal is that we abandoned our selfour deepest knowing of who we are as part and parcel of Universal Intelligence. And yet how could we not? In the tremendous upheaval of moving from pure spirit to matter when we first came to earth, we had overwhelming tasks to face. Being in a human body with the strange experience of intense emotions and not knowing how to survive physically was a monumental job. So if we forgot our essence in the struggle to survive, it is truly understandable. And we are given the alchemical tools for absorbing ourselves back into our true nature. From separation to integration and fragmentation to wholeness, forgiveness and humility are part of the alchemical tools that lead the way home. As St. Augustine said, "Do you wish to rise? Begin by descending. You plan a tower that will pierce the clouds? Lay first the foundation of humility." It might be said that the journey takes you through ego. What has been scattered and cast apart can be reunited. The process is honoring the dark corners of your mind that were formed from feeling betrayed and abandoned by others and yes, even by your own self. This magical experience of experiencing wholeness is an alchemical process to be savored. The souls longing comes shining through with a leap to Higher Order. There can be a recalibration of energy and vibrational level resulting in bringing those fragmented energies into the total aspect of the personality. When you become tuned into your Higher Self to listen to the souls message, you remember what has been forgotten: I am intact. I am whole. There is nothing to fear. That indeed is the Higher Order which is Perfection Itself operating in the Universe. Reconnecting Energy Fragments

66

United we stand, divided we go into fragmentation. We carry complex geometrical information within located in our electromagnetic field. We need our energy to be intact so that the chakras remain open, vibrating at the correct geometric speed, direction and ratios. Intact energy allows the free flowing of light and information from Infinite Intelligence to us in our physical bodies. With integration of the separated energy parts, the chakras that were affected at the time of trauma can come back into balance and are available for downloading of light and information from the higher realms. Our energy is for our use and for sharing but we are not to give it away or have it taken from us by others; this is the concept of soul retrieval. We also are not to take on hitchhikers of our life energythose entities who join us to use our bodies when they die as they are fearful about crossing over to the other side. This ritual is called de-possession or entity removal. Shamans can assist in releasing energies that are not yours and calling back any of your energy that has been taken away. Ancient and modern day ceremonies, rituals, dreams and transformational therapies bring forth separated energetic aspects and dualistic beliefs back to connection to Unity Consciousness. Integrating the fragments is Union which brings order from disorder. Each fragment contains the totality of the entire system, a hologram of sorts, and can be fused back in the whole without destroying it. As part of the hologram, each strong emotion with accompanying ruminative thoughts can be a signal that this part is asking for healing. The soul wants wholeness. It brings forth emotional and physical symptoms which are informational patterns to get your attention. The urge from soul is to call all fragmented energy home. The patterns and shades of the psyche are numerous; some are of wholeness and some are of separation. Some aspects support life and some reject life. The shadow parts revealed and befriended are born thus discharging the frenetic energy. You can bring them back home calling upon the evolutionary drive within. Those disconnected, arrested child parts want to come into integration. What has been split off wants to return to the whole. Dissociative states allow for the opening up of the good, the bad and the ugly within us. The horrors as well as the beauties of the mind as when meditating or chanting are brought forth when you go into an altered state for the purpose of healing a disowned self. View all subparts with compassion and touch into the hurt deep within that caused them to form. Dialogue with them and ask them what they need and how they would look if the fear was examined. Offer them forgiveness and grace. Bring them into the whole body/mind/spirit. Here is one such technique drawn from the Jungian Psychology tradition. This energy fragment visualization helps heal the hurt, frightened, lost and angry parts of the self that
67

continue to be expressed in energetic ways. This protocol gives the imagery for the splitoff energy to be reunited with the entirety of the energy field. This exercise may also be done with any past life memories or aspects of the self that exist in other dimensions. Call forth the frequencies of Love and Integration to assist in this process. There is no I or divided mind in Unity Consciousness; there just is. Inner Child Work: Calling Energy Fragments Back Home Lynne Namka To heal a dissociated part, set the intention for the return of the whole, integrated energy. A dissociated child part has felt rejected, abandoned and not listened to or valued. Due to its rejection from parents or even yourself, it feels very bad about itself. These feelings of not being worthy of attention and caring must be reversed by applying love from you, the adult self. Sense or visualize where the split off child part went outside your body (front, back, side, up or down). If possible, get a memory of the first trauma but dont go full fledged into it. What false belief did the child pick up? Call this child or younger self to you. Tell it that you are its older self and you want to provide for it what your parents could not long ago. Honor and validate this child and its pain. Ask this part what is needed (a hug, being held, reassured, etc.) Ask the child part to name the fear belief. Have your adult self explain the belief in a different way that will comfort the child. The erroneous belief was created in a time of neglect or abuse to this much younger part of yourself that didnt have much language or life experience to understand what happened. Give compassion and reassurance to this cast-out child part. Ask the child what he or she needs and visualize giving validation, being listened to, being held or love from you, the adult self. Take a breath and ask for the frequencies of connection and integration and love to achieve healing. Move into Love that emanates from Source and come up with a different understanding. Visualize the child coming back inside you. Bond and merge the separated part back into your whole being. Mental Body: See the connected child who feels validated. Visualize the energy of the body becoming whole. Emotional Body: Feel the emotions of relief and joy of reconnection and integration. Physical Body: Feel and know the sensation of being intact, solid, healthy energy.

68

Take a deep breath and feel the integration. State this affirmation I am safe. I cannot be harmed. I am One with All. Ask if there are any other dissociated child selves and repeat the integration process. Call the separated energy home. Bring it home to love and interconnection. No matter what the question, love is the answer. No matter what the fear, love is the remedy. Unity is the true reality of things. Fear Separates, Love Integrates. Polarity Separates, Unity Integrates. For what is life but alternate times of light and shadow? As we work out the shadow part in our self, the fears and negativity of the shadow are not so dark. The Divine Plan for each of us is to bring together the dualities within us that appear separate and celebrate one as all and the same.

69

Chapter11 AlchemyandtheSpiritualAwakeningProcess Alchemyisbestknownfromancientwritingsandpracticesasthesecretformulas forchangingimpure,basemattersuchasleadintogold;thisisknownasthe chemicalapproach.Alchemyisconsideredtobethebeginningofmodernchemistry. Anotherunderstandingofalchemyistofindthesecretprocesstodistillgoldintoa whitepowderthatwillgrantimmortality.Athirdapproachtoalchemyfromthe Jungiantraditionusesmetaphorsfromalchemytoaccelerateapsychospiritual processtoadvanceconsciousness.Thisinneralchemyservestohelpyouclear emotionalblockages,deconstructtheegoandrememberpastlivesandother incarnations. CarlJungbelievedthatalchemyprocesswasametaphorformansspiritualand psychologicaldisciplineandtransformation.Theegoisthebasesubstancebeing workedontheprimamateriawhichmustgothroughthealchemicalstepsof washing,distilled,cleansed,dissolved,purifiedandrenderedwholeandintegrated. Thiswasconsideredtobethesymbolicgoldofgreatworth.Workingwiththe unconsciousmindisthekeytounlockingthesymbols.Inhisbook,Memories, DreamsandRecollections,Jungsaid, Alchemy,asanaturephilosophyofgreatconsiderationintheMiddleAges, throwsabridgetothepast,thegnosis,andalsotothefuture,themodern psychologyoftheunconsciousOnlybediscoveringalchemyhaveIclearly understoodthattheUnconsciousisaprocessandthattheegosrapportswith theunconsciousandhiscontentsinitiateanevolution,morepreciselyareal metamorphosesofthepsyche.Itisallabout,ofcourse,theindividuation process. Forthelaterpartofhislife,Jungstudiedthesymbolsandrecordedandinterpreted hisdreamslookingforthetransformationalsymbolismofthehumansoul.He foundparallelsbetweenOrientalandGnosticteachingsandalchemysymbolsforthe psychicenergythatiscreatedthroughtheconflictoftheopposites. Theendgoalofthisdeepworkisaprocessofeverdeepeninginnerdevelopmentof goingthroughacircularmovementtowardsthecenterwhichistheSelf.Jungcalled
70 "TheTruthwillsetyoufree,butfirstitwillmakeyoumiserable." TheTalmud

thisprocessindividuationwiththeegobeingassimilatedintotheSelf.Shadowparts representingtheseparatedsubpartsorthemoraloppositesarebroughtforth;the consciousandunconsciousarereconciled.Perfectionofthemanisachieved throughunifyingwiththeDivine. TheElixirorThePhilosophersStoneisthesecretsubstancethatperfectedthe process.FindingthatsecretingredientiscalledTheGreatWork.Thissevenstep formulaofachievingperfectionisdescribedbytheancientEmeraldTabletof Hermeswhogavethephase,Asabove,sobelow.HermesTrismegistuswasalso knownasThothorTehutibytheearlyEgyptians.Hiswritingsalsopointedtothe necessityofthebalancingoftheopposites,Bringtogetherinyourselfallopposites ofqualitythenyoucanapprehendGod.HermesisconsideredasTheDivine Messengerwhocomestoearthduringcertaintimestoimpartinformationofsacred science.SeveraltranslationsoftheEmeraldTabletweremadebytheearly alchemistsfromdifferentcountries.

TheEmeraldTabletofHermesfromManlyP.HallsTheSecretTeachingofAllAges

Englishfriar,RogerBaconstranslationoftheEmeraldTablet,calledtheSecretum Sccretorum,wasmadearound1445andgivesthestepstogainthebrightnessof thewholeworld.Baconconsideredmoralityanecessarypartofalchemyaspartof


71

liberationandlongevity.Baconandotheralchemistswroteinambiguoustermsto preservethesecretformulasandideas. Trueitis,withoutfalsehood,certainandmosttrue,thatwhichisabove isliketothatwhichisbelow,andthatwhichisbelowisliketothat whichisabove,toaccomplishthemiraclesofonething. Andasallthingswerebythecontemplationofone,soallthingsarose fromthisonethingbyasingleactofadaptation. ThefatherthereofistheSun,themothertheMoon. TheWindcarrieditinitswomb,theEarthisthenursethereof. Itisthefatherofallworksofwonderthroughoutthewholeworld. Thepowerthereofisperfect. IfitbecastontheEarth,itwillseparatetheelementofEarthfromthat ofFire,thesubtlefromthegross. WithgreatsagacityitdothascendgentlyfromEarthtoHeaven. AgainitdothdescendtoEarth,andunitethinitselftheforcefromthings superiorandthingsinferior. Thusthouwiltpossessthegloryofthebrightnessofthewholeworld, andallobscuritywillflyfromthee. Thisthingisthestrongfortitudeofallstrength,foritovercomethevery subtlethinganddothpenetrateeverysolidsubstance. Thuswasthisworldcreated. Hencewilltherebemarvelousadaptationsachieved,ofwhichthe manneristhis. ForthisreasonIamcalledHermesTrismegistus,becauseIholdthree partsofthewisdomoftheworldthatwhichIhadtosayaboutthe operationofSoliscompleted. Theuniversalthemesofunionoffatherandmothertoproduceadivinechildand thedescentandascentareagainbeingplayedout.Alchemybecomesascension.The Onehasbeenmadeintomatterandweasthatmatterarenowtoascendandknow ourOneness. IntensifyandInverttoGoThroughtheChaos Thealchemicalconceptofinversionisanintegralpartofhealing.Thingshaveto heatuptoprovidetheimpetusforchange.Energybuildsuntilitcanbuildnomore andthenmustshift.IntensificationishappeningnowonourphysicalPlanetEarth. Likewise,inindividualgrowth,energyincreasesasacallfromthesoul.Thepersons
72

mindruminatesaboutanunresolvedissuewithunbearableemotionfortheenergy toshiftlikeapendulumtotheoppositeside.Feelingsbuildupuntiltheyreachtheir zenithandfliptheswitchtogotheoppositedirection. Duringinversion,thereisanupsettingofagivenordersothatitmaybereplaced byitsopposite,accordingtoJuanEduardoCirlotinhisclassicbookofarchetypes, DictionaryofSymbols.ThewordinvertisfromtheLatin,vertere,versiwhichmeans toturn,theturningattheendofalineinmusic,tospin(vertigo.)Cirlotdescribes howcrisisandthenaturalconceptofinversionprovidemomentumtomovetoward healingandintegration: Mantendstoquestionhisdestinymostlyinmomentsofcrisis,thatis,when thestreamoflife(eitherthestreamwithinhimofhisfeelingsandpassions, hisabnormalurgesorsenseofinadequacy,orthatflowingoutsidehimthe floodofobstaclesandfailuresincommunicationgoesagainsthimorcarries himalongfartherthanhewouldwish.Thereis,then,aprimordialdesirein Mantoexperienceinversion,thatis,tofindthetechniquewherebyanything ofakindcanbetransmutedintoitsopposite.So,forexample,illnessinverted becomeshealth,hatebecomeslove,lonelinesscompany,ignorancewisdom, dissensionsolidarity...Suchinversionatfirstappearsasacrossroads,thatis, asapotentiality.ThenittakestheformofsymbolsofsacrificeThen,finally comesthesymbolofinversionproperandofrebirth. InversionistheconceptbehindtheYangYinsymbolofthedistributionofforces; counterbalancing,containingwithinitselftheantithesis;toswitchtheoppositesas thefocalpointisreached.Ourworldispossiblyenteringintothisinversionconcept wheretheenergyincreasestogiveimpetuousforgreatchange.

HealerRichardBartlettemphasizes,Changedoesnotcomecausally;itcomes throughintentandintensity.Changecomesfromintensity!Sometimesapersons lifehastobeturnedupsidedowntoproducetheenergyforchange.Greatpoweris


73

neededtobringaboutchange.Anothernoteofinterest,Cirlotsaysthattobreathe istoassimilatespiritualpower.Cirlotrelates, Themoreterriblethesituation,themoreurgenttheneedtotransformand invertitandthegreatermustbethesacrificetheprocessofsublimationis alwayspromotinginversionsandmetamorphosisofthisorderunknowable bymeansofcontrasts...eachphenomenonasthesedenotedbyitsopposite. Theinversionprocessmaybebehindtheenergeticintensitybuildingupthatbrings aboutwhatCarlJungcalledistheconfrontationwiththeunconscious."Perhapsthe unconsciousmindrequiresacertainconcentrationofforcesandvolumetogather theenergyforchange.Decisivethinkingisareleaseofenergy,explainedteacher JackSwartzwhodescribedhowtheenergeticprocessworks.Assoonasone decides,onereleases.Thewholebodyswingsintoamorerelaxedstatewhena decisionismade.Whatisreleasedisafearstateandaccompanyingbeliefs.Needed transformationmaybedoneatthissubliminallevelwhichisconnectedtoandplays outtheuniversalneedforevolution. GeorgeLeonard,inTheSilentPulse,describeshowtheprocessofintensivelytrying toforceanissuethroughgreatdeterminationcanbringapersontohisknees physically,psychologicallyandspiritually.Personalenergybecomesdepleted.When thepointoftotalexhaustion,resignationanddespairisreached,theegois relinquished.Thepersongivesupinhelplessnessandhopelessness.Thissurrender pointhappenswhentheselfisemptiedofallroles,attachmentsandegodefenses aroundthatissuethatithadbeenholding.Thetransformationoccurswithtears, intenseemotionandfeelingsofrelief. CrisisProvidestheOpportunityandtheEnergyforShadowConfrontation Creativecrisisprovidestheheatandtheenergyforalchemicalchange.VirginiaSatir describedhowchaoswithinapersonbothprovokesandprovideschange.Inthe statusquostage,everythingremainsonanevenkeeltokeepthingsthesame.As changeisalwaysinevitable,aforeignelemententersthesystem.Thisforeign elementcanbeexternalchangesintheenvironmentoraconflictintheperson's beliefsystemwhichfunctionstothrowtheindividualintochaos.Duringthisstage, theHigherPowerofthepersonmaydrawpainfulexperiencestotheindividualto promotegrowth. Innerconflictprovidestheopportunitytoconstructivelyconfrontwhatisnot workinginalifetobringaboutashiftinperception.Oldexpectationsandthe
74

accompanyingblockageofnegativeenergyareclearedallowingahigherstateof consciousness.Theemotionalchargearoundtheoldpainfulmemoriesisreleased alongwiththeirdefensivebehaviors.Thentheindividualmovesintotheintegration phasewhichischaracterizedbyadoptingnewvaluesandbeliefs.Thefinalstageis practicingthenewlyformedattitudesandbehaviors.Theindividualthengoesback intoanewstatusquoperioduntilthenextperiodofchaoscomesup. Afterahealingexperiencewhenmajorenergiesaretransmutedfromlowerto higherconsciousness,theindividualmayfeelungrounded,vulnerableandexposed forawhile.Theseexperiencesbringaboutrapidchangesinvalues,moralsandself identity.Oldperceptions,beliefsandpatternsofbehaviorareshatteredandfall awaytomakeroomfortheexpandedself.Oldpsychologicaldefensenolongerwork leavingfeelingsofrawness.Theremaybea"healingcrisis"wherethephysicalbody respondsthroughillnessordiarrheaasthebodyundergoesaphysical detoxification. Fatiguemaybepresentalongwithaneedfortimespentalone.Theprocessrequires intenseenergytointegratethesechanges.Thephysicalbodymayneedtoshut downtemporarilytodealwiththeintensityoftheemotionsandadjusttotherapid vibrationalchangethathastakenplaceonacellularlevel.Anacuteboutof depressionfunctionstoshutdowntheperson'senergyforoutwardthingstofocus ontheinwardprocess.Theindividualmovesonthroughthetemporarystateof uncertaintyasheintegratestheknowledgeofthenewexperienceintohisbeing. Socratesdescribedthephenomenawhenhesaid,"Ourgreatestblessingscometous bywayofmadness,providedthemadnessisgivenusbydivinegifts." ReductionoftheEgoasPartoftheAlchemicalProcess RobertoAssagioli,developerofPsychosynthesis,states"Spiritualdevelopmentisa longandarduousjourneythroughstrangelandsfullofsurprises,joy,beauty, difficultiesandevendangers.Itinvolvestheawakeningofpotentialitieshitherto dormant,theraisingofconsciousnesstonewrealms,adrastictransmutationofthe "normal"elementsofthepersonalityandafunctioningalonganew,inner dimension."Thereareamultitudeofpotentialoutcomesavailabletousthatcanbe achieveddependentuponourabilitytotapintothem. Therearemanywaysthattheegopuffsitselfupduringthespiritualjourney. Reductionoftheegoisarecognizedaspectofspiritualgrowth.Theancientspiritual literaturerepeatedlywarnsagainstthedangersofemotionallyattachingtonewly foundmysticalexperiencesthatcomeupduringthespiritualjourney.Yetsome
75

peopleareoverlyfondoftellingtheirstoryoftheunusualandexcitingmystical eventsthathavehappenedtothem.Thisisthe"inflationoftheego"trapwhich oftenaccompaniesspiritualgrowthanddevelopment. Thepurposeofthemysticalexperiencesistolearnandgrowinconsciousness withoutaweorattachmenttothesensoryevents,healingabilitiesortheheightened intuitionthataccompaniesthem.Healerswhoarebeginningtorecognizetheir healinggiftsoftenexperiencefeelingsofsuperiority.Feelingsuperiorbecauseone hasachievedintensespiritualevolutionisbutanotherattachmentoftheego. Thealchemicaltraditionstresseshumilityandpurityofheartanddescentintothe darknessforthealchemisttobecomegroundedbeforeascendingintothelight. Fromseparationtointegrationandfragmentationtowholeness,forgivenessand humilityarepartofthealchemicaltoolsthatleadthewayhome.AsSt.Augustine said,"Doyouwishtorise?Beginbydescending.Youplanatowerthatwillpierce theclouds?Layfirstthefoundationofhumility."Itmightbesaidthatthejourney takesyouthroughtheego. AliceBaileysteachingsdescribewaysseekersonthepathcankeeptheiregoin checkthroughidentifyingwiththemetaphorofseeingoneselfasbeingapartofthe numerousanonymous,spirituallightworkerswhobringchangetotheplanet.The servicetootherswithoutfeelingapersonalincreaseinselfesteemisonesignthat theegoisinalignmentwithhighestspiritualguidance. GivingUpyourStoryandtheGlory;GivingUptheFearsandTears Deepspiritualworkisaboutreleasingtheneedforyourattachmentstothehighs andlowsoflife.Youstopattachingtotheegosidentitywiththejoyousandblissful timesoflifeaswellasthebetrayals,traumasanddramas.Youbegintoseethatall thathappenedtoyou,goodorbad,arejustexperiencesthattheegogavedireor joyousmeaningto.Selfinvolvementandselfishnessaswellasselfdoubtandself hatredcanbeunderstoodandreleased. Surrenderistheaskingforandtheprocessofreleasingtheegodefensesthatwere bornoutoffeelinghurt,betrayedandabandoned.Theprocessofsurrenderistodie totheseparatesenseofself.Itisthewillingnesstoacceptlifeasitis.Togobeyond attachmentsandacceptlifejustasitis.Tosurrenderistocontinuallyreleaseboth egodesiresandfears.SurrenderissayingYestothemomentsoflifeastheyarise beforeyouandlivinginthepresentevenwhenthereispain.Tosurrenderistolet

76

goandmakepeacewithyourhistoryofpainthroughintrospection,self examinationandacceptance. Themovementfromthepositionoffeartolovehappenswhenthepersongoestoa stateofmindthatletsgotothe"Thywillbedone."Thisistheessenceofhealingof themind/body/spirit.Surrenderingintohumilityasyouletgooftheoppositesof beingbetterthanorlessthanothersispartofthealchemicalprocess. Lettinggooftheemotionalchargecultivatedbydualitythinkingofharm/noharm freesyouforotherprioritiessuchascreativityandjoyfullylivinginthepresent. ThereisanemptyingofoneselfsothatafillingoftheOnenesscantakeplace. SurrenderistheSelfAbsoluteseekingitself.Separationmeldsintowholeness. Surrenderistheshiningjewelinthecrownforemotional,psychological,and spiritualliberation.Thereisarespiteperiodtoprovideintegration,andthenthe surrenderprocessbeginsanewwithanotherissue. AlchemicalArchetypes Thehealingofthepurifiedopposites,themasculineandfeminineenergiesthat arisenaturallyfromtheenergythatconflictproducesasthesoulconfrontstheego. HealingissymbolicallyrepresentedbythearchetypesoftheKingandQueenwhich becomeconjoined.ThismarriageproducestheDivineChild.Theleftbrainactivityis consideredSolar(sun)innaturewhichisrational,logicalandintellectualwhilethe Lunar(moon)activityiscreative,intuitive,artistic,musicalandknowingofthe heart.TheSolarKingandtheLunarMoonaresymbolsoftheYangandYinin Chinesealchemy.

77

UnionoftheSolarKingandtheLunarMoon

Jungdescribedofheatingourcrucibleandaddressingthatshadowselfthatcarries thefearprogrammingwecalltheego.Wearethecruciblethatheatsup.Theraw materialsofthealchemyproceduresareourthoughtsandfeelingsthatbecome unifiedthroughthisspiritualartandprocess. OfthesecretingredientinthealchemyprocessParacelsussaid,Loveistheagentof theprocess,thatwouldfinallymakemanifestthegoldwithintheflask,andthe releaseofthedivinewithinman.Bothtakentobeimplicitfromthebeginning. Whenloveandacceptancebreakthroughthefear,youcanfeelgratitudethatbrings movementintoaclearervibratoryfield.ItsanAhhhhhhhfeelingastheconflictual energiesdrainout.Aninternalquietingresponsehappenswhenyourecognizethat therewasnoharm,onlyexperience.Whatwasmadeoftheeventwhichseemed harmfultheperceptions,beliefsandreactionsofwhathappenedisfluidand thereforemoveable.

78

Throughthehealingoftheopposites,themarriageofthemasculineandfeminine energiestakesplace.Throughthisdevelopmentalspiritualprocessofdeep introspectionofdiscoveringThePhilosophersStone,ourilluminatedenergyshines through.TheunionproducestheDivineChildwiththeinherentluminosityofour divinenaturecoming.


TheDivineChildoftheMarriageoftheSunandMoon

DrunvaloMelchizedekgivesaUnityMeditationinhisbook,LivingintheHeart, whichputsyouintoastateoflove.Themeditationhelpsyoudropintothesacred spaceofthehearttoconnectwithMotherEarthandFatherSkytoproducea recognitionofyourownDivineChild.Theintentioncomesforthfromyourheart andmindtobidyoutogointolongingforunion.HesaysthattheHolyTrinityis aliveineachandeveryoneofuswaitingtoberecognized. TheAlchemicalPathasaWayofUppingyourVibrations ConsciousIncarnationiswhatEckertTollecallsThepowerofnow.The alchemicalprocesslaidoutbyCarlJunggivestheroadmapforemptyingoutthe shadowandfullygraspingmovementdowntheevolutionalpath.Therearemany fineteachers,traditionsandspirituallyawakeningexercisesthatwillremovethe
79

veilfromyoureyes.ThelessonsofgainingSelfRealizationareouttherepresented inmanyformsanddirectionsthatareavailableifyoulistentoyoursoulslonging. Jungsalchemymodelgivesthestepsongoingthroughthisimportanttask.PoetT.S. ElliotunderstoodsurrenderingtotheevolutionalpurposeoftheShadowwhenhe said,Isaidtomysoul,bestill,andletthedarkcomeuponyou.Whichshallbethe darknessofGod. Responsibilitytotalresponsibilityisrequiredformakingthistransition.Youare beingheatedupandforgoodreason!Eventhoughwemayfeelthatwehavebeen betrayedandabandonedbythosewelove,theoriginalabandonmentisofourown self.Acknowledgingthatwehavedeniedpartofwhowetrulyareisanecessarystep ofhealing.Having undergone two great awakening experiences, Jana Dixon has a great understanding of the process using the Jungian perspective of the alchemy process. She states that acknowledging the initial abandonment is a necessary part of the integration process: Self-abandonment is the primary trauma that we must learn to face into to avoid abdicating from our own life. All we really want and need is our Self; that is what we are longing for. TOTAL RESPONSIBILITY for ones condition needs to really be grokked in order to move into the kind of sovereignty where self-Self development is even possible. Otherwise everything else in the world (according to our triggers) determines who we are. Love of course is the opposite of abandonment. Self-responsibility, that is becoming responsive to Self, is none other than freedom, enlightenment sovereignty and Individuation. Theevolutionaryurgeprods,pushesandpullsusontogreaterconsciousness.We areheldbackbylackofinterest,fear,worldlydistractionsandignorance.Conscious incarnationmeanstoreallybehereonearthwithawarenessthatwearespiritual beingslivinginmatter. Raisingyourvibrationsmeansyourenergysystemvibratingatafasterlevelthatis moreconsistentwithSpirit.Slowervibrationsaremoreofmatter,ofphysicalityand thereforearedense.Raisingthephysicalbodysvibrationstoahigherlevelisthe purposeofspiritualalchemytoallowyoutomoveintostatesofhigher consciousnesswheremoreandmorearepossible. Butnottoworryaboutallthis.Youareaworkinprogressandallisinprocess.You areconsciousnessmovingbackuponyourself.Thatisthebeautyofbeinga conscioushumanbeingdoingconsciousincarnation.

80

Chapter12 TheHolyBreathasanAlchemicalTool
Canwe,inlove,breathetogether?. Eachofusisinterpenetratedwithallthethoughtsandjudgmentsofeachother, andthelove,thelightandallthethingsapparentlygoodandapparentlybad. Likethewavesofthesea,thesemovethroughusonthebreath.SocanwelearntobreathewithGod? ReshadField

Yourbreathisyourbestfriend.Oneoftheverybestthingsyoucandotoimprove yourhealthandlifeistopracticedailybreathawareness.Anthroposophyauthor, RudolfSteinersaid,Allhealingoriginallyresidesinthehumanbreathingsystem. Deep,slow,rhythmicbreathinglowersthebreathdeeperintothediaphragmand lowerbellyandincreasestheoxygensupplyofthehumanbody.Itstrengthensthe musclesoftheabdomen,reducesthesizeofthestomachanddecreasesabdominal bellyfat.Itpromotesthecurriculumofthecoronaryarteryandincreasesbloodor oxygensupplytotheheart. Alongwiththeexercisethatdeepbreathinggivebymovingthemuscles,ithelps releasethelacticacidwhichisawastebyproductofthecellswhichhasbeenbuilt upinthebody.Thebreathworkswiththevagalnerveinrelaxingthemusclesand calmingtheheartrhythms.Breathingstrengthensandexpandsthelungsbyslowing respirationtoincreasevitalcapacity.Itturnsthemindfromdisordertocalmnessby expellingdistractingthoughts.Itsevenreportedthatdeepbreathinghelpsyoulose weightasyouareexercisingyourinnerorganswitheachbreathyoutake! Therearenumeroushelpfulformsofbreathing.Theancientspiritualtraditionsof theEastofferascienceofbreathingtocreatedifferentbrainwavesthatbalancethe brainhemispheresandstrengthentherespirationsystem.SpiritualteacherThomas Crumsaid,Whatwoulditbelikeifyoulivedeachday,eachbreath,aworkofartin progress?Imaginethatyouareamasterpieceunfoldingeverysecondofeveryday,a workofarttakingformwitheverybreath. Askforpeaceandunderstandingaboutanissuebysayingapositiveintentionto createtheenergyforchange.Breathingdeeplycreatesoxygenintakeandthequiet internalspacetoallowanemotionalshifttohappen;mostoftheexercisesinthis bookincorporatebreathingaspartoftheirprotocol.
81

Observehowthedifferentbreathpracticesaffectyouremotionsandbody.Findthe approachesthatrelaxandenergizeyou.Herearesixbreathpatternsthatyoucan choosetoincorporateinyourdailyritualofhealing.Forasuperdupercalmer downerandenergizeratthesametime,doallsixinarow! AlternateNostrilBreathingtoCalmtheEmotions TheDalaiLamaTheUnionofBlissandEmptiness InthepracticeofthesixyogasofNaropa,aprocessofdispellingtheimpurewinds throughnineroundsofbreathingisexplained.Firstoneinhalesthroughtheright nostrilandexhalesthroughtheleftthenoneinhalesthroughtheleftandexhales throughtheright.Firstclosetheleftnostrilwiththebackofyourrightindexfinger andinhalethroughtherightnostril,andthenexhalefromtheleftnostrilwhile blockingtherightnostril;afterthat,blocktherightnostrilwithyourleftindexfinger andsoforth.Duringthisprocess,althoughyouareinhalingandexhalingthroughthe nostrils,imagethatthewindscomeoutandgointhroughthetwosidechannels.This willcalmtheforceofwhateveremotionyouhavebecauseitpreventsreinforcementof it.Thestrongforceofemotioncalmingisjustliketurbidwaterbecomeclear.A nonvirtuousstateofmindshouldbetransformedtoaneutraloneandthenskillfully transformedintoavirtuousstate. ThisalternatingnostrilpatternisknownbysomeyogisasPranaBreathingwhich connectstherightandlefthemispheresofthebrainthroughbreathwork.Pranais theHinduwordforchi,thevitalbreathwhichisnecessaryforlife.Alternateholding therightnostrilshutwhilebreathinggentlyintheleftone,thenholdingtheleft nostrilshutwhilebreathingouttherightnostrilwithalong,slowbreathandvice versatocalmyourcentralnervoussystem.PranaBreathinggivesyoubilateral stimulationcausingyoutoshiftbackandforthfromtherightandleftbrain hemisphereswhichcreatesrelaxation. Integrationoftherightandleftbrainhemispherescanbeaccomplishedwithanyof thebilateralstimulationtechniqueswhichbreakintothedysregulatedemotional states.Intheintegratingbrain,energyflowsfreelythroughtheprefrontalcortex. Thoughtsandinsightsasneuralenergygarneredduringthehealingprocessturnon newneuralnetworks.Thesenetworksbecomeconnectedatthemomentsothat informationcanbeprocessedandincorporatedintothegreaterwholeandlater becomeincorporatedatadeeperlevelduringquiettimesorsleepandREM dreaming.
82

BreathingforSurvival:WhenChaosStrikes RamiKatz

BreathisourlinktothemiraclecalledLife.Ourbreathplugsusintotheuniverse bringingtheLifeForceintous,throughusandoutagain.TheLifeForcewhichisour Sourceofenergy,thought,feelingandalivenessfeedsus,nourishesusandkeepsus alive.Weareautomaticallyinarhythmoflivingthoughourbreathandour heartbeat. However,mostlywearenotconsciousofhowshallowandirregularourusual breathingpatternbecomeswhenweareanxiousandoverwhelmed.Whenweare experiencingtension,anxietyandfear,ourbreathratemaydoubletoausualsixteen timesperminute.Ifweconsciouslyreduceourbreathratetoeightbreathsper minute,weslowourheartrateandexperiencemorepeace,clarityandawareness withinthecircumstancesthatareoccurringonadaytodaybasis. Asyoupayattentiontoyourbreath,itdeepens,slowsdownandstartstocalmyour racingthoughts.Inslowingthebreath,youincreaseyourconnectiontoyour intuitionandfeelings.Youonlyneedtodothistofindoutifitworksforyou. The4:1Breath FromYogiBhajanaswrittenbyRamiKatz Thispatternofbreathinguseanddevelopsourcapacitytobreathe.Itcanbeused duringanemotionalcrisisandwhencopingwithasituationthatseemsimpossible.It canalsobeusedtobreakaddictionsandcalmthecravingsforsubstancesthatwe habituallyturntoforcomfort. Sitinacomfortablepositionwithyourhandsrelaxedinyourlap.Closeyoureyesand inhaledeeplythroughbothnostrilsinfourequalparts.Eachpartisaquicksnifflike inhalethatcausesthesidesofthenosetocollapseslightlywitheachbreathyoudraw. (Doyourbesttomakethemequalbutdontworryiftheyarenotatfirst.) Nowexhaleinonesinglebreaththroughthenose.Letthebreathbeveryrhythmic.Do yourbesttokeepyourattentiononyourbreathingthoughyourthoughtsmaystray.
83

Continueforthreeminutes.Nowrelax,keepingyoureyesclosedforanotherminute, breathingnormallyandbewithyourself. BreathRhythmtoFacilitateLettingGo FromYogiBhajanaswrittenbyRamiKatz Breatheinlong,slowanddeeplythroughyournose. Focusyourattentionasthebreathcomesin,receivingitastheGiftofLife.Relaxyour abdomenandallowittogentlyexpandandthennoticethissameexpansionintoyour chest.Letgoofthebreathslowlyandcompletely. Asyoureleasethebreath,feelalltheairmovingout.Gentlypullinyourabdominal musclestohelpemptyyourlungs. Breatheinarhythmoftwobeatsfortheinbreathandfourbeatsfortheoutbreath. Inhale1&2 Exhale1&2&3&4&takingtwiceaslongasyourinhalebreath. Followyourbreath,mentallycountingorrecitingarepetitivestatementthateases yourmind. Examples:Relaxingnow.MySourcesustainsme. Allowthebreathtobenatural,gentlyreceivingtheflowofbreathonyourinhaleand lettinggowiththebreathoftheexhale,elongatingitasmuchaspossible. ConnectingHeavenandEarth WecanlearntoconnectourselveswiththegreaterwisdomontheUniversalLove EnergiesandtheLoveenergyofMotherEarth.Humansaretheconduitbetween thesetwogreatforcesandwecandrawenergyfromeach.Contemplatethemeaning ofIbnelAralusquote,AlliscontainedintheDivineBreath,likethedayinthe morningsdawn.
84

HoldthisimageofyourselfasabridgebetweenHeavenandEarthasanintention andconnecttotheDivineenergiesoftheUniverseandthegroundingenergiesof ourplanet.Youaretheconduitbetweenheavenandearthastheenergiesflow throughyou.ThisfollowingbreathexercisewillhelpgroundyouintoMotherEarth whileremindingyouthatyouareachildofaboveaswellasbelow. BreathingEarthandSky LynneNamka Visualizeatall,thingoldentubeoraflowoflightaboutahandswidthabovethetop ofyourheadthatrunsdownyourbodybehindyournavalgoingintotheearthbeneath yourfeet.BreatheintheDivineBreath.Focusonlifegivingenergycomingintofrom thetopofthetubedownthroughyourbodysendingittoyourheartandcellsas needed. SeeandfeelenergyflowingintothegoldentubefromtheUniversetoyourheartand therestofyourbody.ReleaseanynegativethoughtstoMotherEarthwheretheyare neutralized.Groundyourselfbyseeingyourselfsinkingdeepintotheearthuptoyour ankles. ThenfocusonthebreathbringingupgoodenergyfromMotherEarth.Sendthisearth energytotheneededpartsofyourbody.FeeltheenergiesofourUniverseandthoseof ourplanetflowingthroughyouastheyintermingle. Visualizethebreathcomingbackthroughyourbodygoingupaboveyourheadto againgathermoreenergy.Smileandsoftenthebackofyourthroatandsinusarea. FeeltheconnectionwithinasyoucontinuetoinvitetheDivineBreathtocirculate throughyou.YouarethemeansofexpressionbetweenHeavenandEarth. PurificationBreaths LindaRichards Breatheintheearthbreath Workwiththephysicalbody. TuneintogratitudetoMotherEarthforsupportingandnurturingyou. Cleansethebodywiththeearthshealthymagneticbody. Radiateoutpastthephysicalbodytothehealthmagneticbody.
85

Onthisbreath,IaskMotherEarthtogroundme. Breatheinthewaterbreath.Waterislight. Workwiththeemotionalbody. Tuneintoforgiveness. Cleansetheemotionalbodywithwater. Radiateandexpandoutpasttheemotionalbodytothelightbody. Breatheinthefirebreath. Workwiththemoralorrelationshipbody. Tuneintoloveandlifespassions. Cleansethemoral/relationshipbodywithfire. Radiateoutpastthemoralbodytothekarmicbodyandhealthyrelationship boundariesbothpastandpresent. Breatheintheairbreath. Workwiththementalbody. Tuneintofreedom(soaringonairabovethethoughts) Cleansethementalbodywithair. Expandbeyondthe"monkeychatterthoughtsouttowisdom. Breatheintheetherbreath. Workwiththespiritualbody. TuneintotheaonementwithGod. Cleansethespiritualbodywithether. Radiate/expandouttothearmsofGod. Reconfirmthatitisyourintentiontobehealthyphysically,emotionally,morally, mentallyandspirituallyinthislifetime.Askforguidanceastohowtoachievethis intention. Wecanuseourconsciousmindtocreatehigherconsciousnesswhenweremember tobreathedeeplyandstateanintentionofreleasingego.Whenwedropintothat deeppearlofstillnesswithwegointoastateofbeingthatconnectsuswiththat healingfieldalwayspresent.Thisisthevibrationalfieldofinformationof compassionshownbytheBuddha,MotherMary,Jesus,PadrePioandallgreat healers.

86

"EFT(theEmotionalFreedomTechnique)offersgreathealingbenefits. DeepakChopra

Chapter13 ModernDayEnergyPsychologyApproaches

Thisisahasteningtimeformanyofus.We,likeMotherEarth,areintheprocessof ourownhealing.Individualswhoareonaspiritualpathareamicrocosmofthat muchlargerprocessthatishappeningonaplanetlevel.Asthevibrationalchanges streamintoourplanet,individualsarebeingquickenedinspiritualgrowth.Weare experiencingwhathasbeencalledEarthPlaneAnxiety!Thisisanintensetimefor thoseofuswhoclearlyidentifywithbeingonaspiritualpathaslongheldattitudes andvaluesarebeingchallengedtopushusontofurthergrowth.Fortunatelywe havebeengivensomenewinnovativetherapeutictechniquestohelpus,comewhat may. TheEnergyPsychologyTechniquesorMeridianBasedTherapiesincorporateself acupressureandpositiveintentiontohelpshifttheenergybehinddistortedideas anddistressingemotions.Thereareoverthirtydifferentenergytechniquesandnew onesarebeingdeveloped.Theyincorporatetapping,holdingorrubbing acupuncturepointstobringaboutarelaxationresponse. Thesedesignatedpointshavebeenshowntohavegreaterelectromagnetic conductivitythanotherpartsoftheskin.Theyliealongthefourteenprimary energeticmeridiansasmappedoutbyTraditionalChineseMedicinewhichhasa richtraditionofhealingofthousandsofyears.Themeridiansaredesignatedby ChineseEnergyMedicineaseitherbeingfeminineorYingormasculineorYang. Imbalancesinthemeridiansaddtoimbalancesinthebrainhemispheres. Thesenewtechniquesquicklydecreasefear,anxiety,phobias,frustrationandanger. Studiesshowthattheseapproachesslowtheheartrateandshutoffthefightor flightresponseandprovideasenseofwellbeing.Thenewenergytherapiescalm themoreprimitivepartsofthebrainwhichhavebecomeoverlystimulatedand sensitizedthelimbicsystemandamygdalaandotherpartsofthemidbrainthat firstreverberatedwiththeemotionssurroundingatraumatizingevent. PsychologistJimLanegivesathoroughreviewoftheresearchliteratureastothe underlyingdynamicsofhowthestimulationofacupointsreducesmidbrainarousal
87

andregulatestheautonomicnervoussystem.Acupunctureandacupressure increasethepositiveneurotransmitterssuchasserotoninandtheendorphinsand reducethestresshormonesnorepinephrineandcortisol.Theracingheartrateis reducedandpaindecreasesastherelaxationresponseinproducedthrough acupressure.Thefight,flightorfreezeresponseisinterruptedasthedistressing ideaorsituationisreframedorseeninadifferentway.Thepersonshiftshis understandingofhimselfandcansay,Imincontrolnowandcanseethisupsetting situationasoneIgotthrough. Insomepeople,thelifeenergydoesnotflowfreelyduetoapasttraumawhichsets uptooexcessesordeficitsofenergyflowwithinoneormoremeridians.This distortioniscausedbyemotionthathavenotbeenprocessedandreleased.The energytherapiesworkthroughprovidingdesensitizationtostressrelatedstimuli thatcausepeopletotriggerbackintotheoldemotionalarousalpatterns.By creatingarelaxationresponse,theyreducestress,tensionandpainandincrease endorphinsandotherneurotransmitterstoproducenaturalopiatereleaseinthe brainthatdecreasespainandpromotesasenseofwellbeing. ThethesisofChineseEnergyMedicineisthatthemeridiansofthebodygooutof balanceduetoexcessesofemotions.Inmostenergytherapies,tofullyreleasean energeticchargeyouhavetogetbacktotheassociatedlearningbetweenthe traumaticeventandtheemotionsandmeaninggiventoitofnotbeingsafe.Thisis calledtheactivatingeventortheoriginaltraumawhichisthefirsttimethat excessiveemotionsbecameassociatedwithabelieformeaning.Togettothehidden contentoftheunconsciousmind,youhavetogetbacktothelowestcommon denominatorwhenyoufirstfelttheoutofcontrolemotionsthatbecame imprintedinyournervoussystemandmuscles. AssumptionsUnderlyingtheEnergyPsychotherapies l.Partofbeinghumanishavingemotionswhichhelpprocessandclarifyour experiences. 2.Humanshaveaninternalhardwireddrivetoseekgrowthandhealth. 3.Loss,threatandtraumagenerateintenseuncomfortablefeelingsand physiologicalarousalofanxietyandshame. 4.Strong,overwhelmingfeelingsduringmomentsoftraumacantbeprocessedso arestoredawayasemotionalcharges.Negativebeliefsbecomeattachedtothe negativebodystates. 5.Negativeaffectandphysiologicalarousalofanxietyandshameareavoided,as theyareuncomfortable.
88

6.Effectivepsychologicaltechniquesallowthesurfacingofsafeamountsofnegative physiologicalarousalofaproblemtodesensitizeitwiththehelpasupportive,calm therapist. 7.Desensitizationofthenegativebeliefbringsaboutareleaseofemotionalcharge throughextinction. 8.Theneutralizationoftheemotionalchargethroughtouch,tappingoreye movementsbringsaboutachangeinthebodyspolaritysystem. 9.Thereisashiftatthecognitivelevel;themeaningofthenegativeexperience changesandtheeventisintegratedwiththepersonsabilitytoseethings differently. 10.Vibrationaltechniquesdecreasethefrequency,intensityandclarityofintrusive, triggeringstimuli. 11.Bythecontinualreleaseoftheemotionsandmuscularpatternsthatsurrounded theearliertrauma,basiccorebeliefsofIamunworthy,Iamnotsafe,etc.beginto fadeaway. 12.Theenergytechniqueshelpthebodyreturntothestateofhomeostasisafter feelingstressedorthreatened. Theseenergyapproachesmakeiteasyforyoutoreleasemanyofyourown unproductivefeelingsandirrationalthoughtswhenyoutakethemtotheunderlying traumatogettothedysfunctionalemotions,beliefsandwaysofcopingarounda problem.Theyprovideaquickapproachtotakeresponsibilityforwhatyouthink, feelandhowyouact. Takingresponsibilityforwhatyouthinkorfeelisthebeginningstepformakingthe desiredcorrection.EnergytherapistTomAltaffersaid,Ifyoufeelitorthinkit,it belongstoyou.Ifyoufeelitorthinkit,youcanfinditandcorrectityoucanhealit. Treatyourselfforit.Itstheresponsibilityofthepersonwhoholdsthefeelingor belieftotreatit.Findtheruthlesshonestytoownyourstuff. TheSubjectiveUnitofDistress(SUDS)andTapping Mostoftheseapproacheshaveyourateonatenpointscaleastojusthowupsetyou arebeforeandafterthetreatment.BehavioristJosephWolpegaveustheSubjective UnitofDistressScaleorSUDSlevelisanindicationofhowstrongtheissue,feeling orbeliefisforyou.Itsanindicatorofhowmuchenergeticinterferenceyouhave aroundanissueusingascaleofonetoten.Alevelofoneisverysmalldistresswith tenbeingthehighestamountenergeticcharge.TheSUDSlevelisobtainedbefore andafteratreatmenttodeterminetheshiftsinyouremotionalintensitylevelsas youworktheissue.
89

012345678910 NotupsetAlittleupset Quiteabit!Overthetop!


TheSubjectiveUnitsofDistressScale

TryItOnEverythingTheEmotionalFreedomTechnique

TheEmotionalFreedomTechnique,developedbyGaryCraig,hascreatedaworld widemovementwithusersbothinthementalhealthfieldandlaypractioners. Tappingisdoneononepointofthemajorenergymeridiansthatgodownthehead andbody.Thereareover400acupuncturepointsrecognizedinChineseEnergy Medicine.Craighaschosenonlyafewpointstotaponwithasimple,quick,easyto learnprotocolthattapsdownthefaceandbody. Tappingisagentleformofsoothingtouchwhichputsapercussiveenergeticinto yourbody.Thoughtsofnegativityandjudgmentkeepyoufromwholeness.Youcan taponlongstandingorcurrentissues,fearsandfalseideasaboutselfworth.You cantaptoreleasetheintensitysurroundingphysicalaspainhasanemotional component.Bytappingonthepaindirectlyandtheideasofsufferingandbeinga victimofanillness,youcanreleaseguilt,shame,anger,resentment,worry,or frustration. Theseselfguidedenergyapproachesaskyoutobeveryspecificindefiningyour problem.TheEmotionalFreedomTechniquehasyousayaselfforgiveness statementormakeapositiveaffirmationafteryoudescribeyourfeelingorproblem. Someauthoritiesbelievethatallhealingisselfforgiveness.Thesetupstatementsof EFTexquisitelypromoteselfacceptancesothatyoucanmovetotheholystateof forgiveness.Youdonotforgiveothersbutastheholderoftheproblem,youforgive yourselfforhavingthenegativefeelingorbelief.Inactuality,youforgiveyourself forhavingexcessiveemotions(goingbacktotheoriginaltraumaevent)thatput yourbodyoutofbalance. GaryCraigsaid,Trueforgivenessistheaimofallhealing.WhileCraigstressesthat EFTgivesusfreedomfromtroublesomeemotions,therealfreedomistobreak throughthenegative,falseconditioningthatwehavebeenexposedtofromour parents,institutionsandculturalmores.
90

PsychologistDavidFeinstein,inThePromiseofEnergyPsychology,explainshowEFT worksonabrainbasis:Bymentallyactivatingapsychologicalissueandstimulating asetofenergypoints,theneuralconnectionsgoverningthatissuecanberewiredin anewway.Thistechniquewhichallowsalmostsurgicalprecisioninchanging neurochemistrywithoutcausingsideeffectsisuniqueinthefieldsofhealing, psychotherapyandeducation.ThepromiseofEFTisprofound. TheEmotionalFreedomTechnique GaryCraig Startbythinkingofanissue,problem,feelingorbeliefthatyouwouldliketorelease andbecomeclearabout.FindyourSubjectiveLevelofDistress(SUDS)levelfromone totenwithoneortwobeingsmallandtenbeingveryintense. Sayasetupstatementwhereyouownafeeling,problemorbeliefandthengivea statementofselfacceptance.Repeatthestatementthreetimes.Beasspecificas possible. Eventhough_____(stateyourproblemorfeelinghere),Ideeplyandcompletely acceptmyself.Alternatelyyoucansayanypositiveaffirmation. TapontheKarateChoppointwhichisonthesideofyourhandusingthefingersof yourotherhand.Tapwiththeotherhand,usingyourfingertips.SaytheEventhough statementwhiletappingcontinuously.Somepeopleprefertostartwithrubbingthe SoreSpotinstead.TheSoreSpotislocatedaboutfourinchesdownfromthepointof thecollarboneandafewinchesoutfromyourheart.

91

Nowtapdownyourfaceandbodystartingatthetopofyourhead.Tapbothpointsat thesametimewithtwotofourfingersusingbothhands.Taponthepoints approximatelysixorseventimeswhilethinkingofyourissuetoholditforemostin yourenergyfield.Dontworryaboutgettingtheexactpointsorthecorrectstatement tosay.Justgowiththeflowofwhatevercomesintoyourmind.Tappingisvery forgivingasitvibratestheentireareaaroundthepoint. Takeadeepbreathanytimeyoufeellikeitisneededoryoufeelstuck.Takebreathsat theEyebrow,UndertheEye,CollarboneandUndertheArmPointstoreduceanxiety. TheTopoftheHeadPoint. TheEyebrowPointsarelocatedatthebeginningoftheeyebrow,nearestthe centeroftheface. TheSideoftheEyePointsarelocatedonthebonesattheoutsideoftheeyes nearyourtemples. TheUndertheEyePointsarelocatedonthebonelocatedundertheeyeeven withthepupils. TheNosePointislocatedmidwaybetweenthebottomofthenoseandthetopof thelip. TheChinPointismidwaybetweenthebottomofthelowerlipandthechin,in thatindentationarea. TheCollarbonePointsarelocatedatthebaseofyourthroatandmoveaboutan inchdownandaninchoutwardtowardsyourshoulder.Thesepointsarefor fear,stressandanxietyreduction.Somepeopleautomaticallytaptheir collarbonepointswhentheystarttofeelanxious. TheLiverPointsareonthelowerribsjustdownfromthenipples.(Note,Iadd thispointtoCraigsprotocolasthelivermeridianisassociatedwithanger.) TheUndertheArmPointsarelocatedabout4inchesbelowthearmpits.Youcan reachacrossyourbodyfoldingyourarmstotaptheseorplaceyourarmsunder yourarmpitstotap(thisiscalledtheFunkyChickentap!)
92

ReturntoTopoftheHeadanddothesequenceagain.Givemoretapping attentiontoanypointthatfelttenderorespeciallygood. Repeatthetappingsequenceseveraltimes.TakeanendingSUDSlevelfromonetoten withonebeingnointensity(itsgoneaway)andtenbeingveryintense.Repeatthe stepsaboveifyourlevelisaboveatwo.YoucanmodifythesetupstatementtoEven thoughIstillhavesomeofthis_____,IdeeplyandcompletelyacceptmyselfandIama goodperson,justasIam.Oryoucansay,Theremainingsymptomasyoutapon eachpoint. TherearemanywebsitesdevotedtoTheEmotionalFreedomTechnique. Therearemanyderivativesofthetappingapproachesandtheyallworkwell.Roger CallahansThoughtFieldTherapy(TFT)startedthetappingmovement.Meridian TappingTechniques(MTT),WHEE,EnergyTapping,HealingfromtheBody LevelUpandBeSetFreeFastaresomeexamples.Workshopstolearnthese tappingapproachesthatarefuntolearncanbefoundwithawebsearch.Theycan belearnedbythelaypersonorprofessionalinthementalhealthfield.Thebody likesusingvibration,percussionandpositiveintentiontoreleaseuncomfortable feelingsandbeliefs. Inaddition,theAppliedKinesiologyandchiropracticfieldshaveanumberof energeticapproachessuchasTouchforHealth,BEST,PSYCHKandTheNeuro EmotionalTechniquethatusemuscletestingtoconnectwiththewisdomofthe bodytodeterminewhatisneededenergetically.SomaticExperiencingandEye movementDesensitizationandReprocessingaretwoothervaluabletechniquesthat havebeeneffectiveinreleasingtrauma. Ifyouaredrawntoahealingtechniqueworkshop,byallmeans,goaheadandsign upforit.Investthemoneyandtakethetrainingaslearningnewskillsisan importantinvestmentinyourself!Youwilllearnaboutyourselfandgetfree treatmentsthroughtheleadersdemonstrationsandtheotherattendeespracticing onyou.Youwillcomeoutwithagreatsetofskillsyoucandoonyourselfandtrade withotherpeople.Barteringortradingsessionswithotherhealersisthewaythat manyspiritualpeoplegetfreework.Someworkshopgraduatesmeetregularlyto practiceoneachother. Acrosstime,manyhealersbecomeproficientinnumeroustechniquestohelptheir friendsandfamilymemberswiththeirproblems.TheseEnergyPsychology approacheshelpyouopenyourmindtodifferentwaysofworkingwithenergies.
93

ReleasingSadness,LossandGrief

Youcanreleaseunhappyandsadfeelingsandlongheldgriefbygentlytappingon theLungmeridianwhilethinkingaboutwhatgrievesyou.Tappingbringsattention andenergytoaspot.ThelungmeridianinChineseEnergyMedicinerunsfromtwo pointsonyourchestabouttwoinchesnearyourarmpitdowntheinsideofyourarm totheoutsideofyourthumb.Itrepresentssadness,grief,anguishandcloudy thinking. Sadnessisanormalfeelingwhenwelosesomethingthatisofimportancetous.You neednotremaininsadnessforever.Unresolvedgriefistypicallyanattachmentto thegoodfeelingsthataccompaniedthepersonthatyouwereclosetooranindicator thatthereisanentitypresentwhichisusuallyabenignone.Understandingthatall thingspassawaywithtimehelpsyouaccepttherealityofimpermanence.Usethe SADStechniqueforsimplegriefissues.Complicatedproblemsmayneedtoinvolve assistancefromaprofessionalmentalhealthpractioner. TheSADSTechnique:SootheAwayDistressandSadness LynneNamka Thinkaboutsomethingthatmakesyoufeelunhappy.GetaSUDSlevelonaonetoten scaleonyoursadness.Sayoutloudthreetimes,Iloveandacceptmyselfeventhough Imsadabout_____. Tapbrisklybesideyourarmpitonyourchestneartheoutsideofyourscapulawhere yourundershirtorbrastrapwouldbe.Slowlytapacrossthefrontofyourshoulderand downthemiddleoftheinsideofyourarmtotheoutsideofyourthumbatthe fingernailuntilyoufindatenderorsorespot.Thismaybeablockageofenergythat canreleasethroughacupressure. Breathedeeplyasyoutapintothattenderspotwhilethinkingaboutsadness.Honor thosefeelingsofsadnessandtaponthesorespotuntilitdecreases.Repeatthetapping andlookingforatenderpointonthelungmeridianonyourotherarm. Taptheoutsidesofyourthumbstogether.Say,Iforgivemyselfforfeelingsad.Sadness isanormalemotionwhenIexperiencelossofsomethingimportant.

94

Crossyourarmsonyourchestjustbelowyourthroatandtapnearthescapulanear yourarmswhiletakingthreelong,deepbreaths. Taponthesideofyourhandjustbelowyourlittlefingerwhileyousay,Iacceptmyself forbeinganormalhumanbeingwithnormalfeelingsofsadness.Takeadeepbreath intothesadfeelingsandvisualizethefeelingsrelease. Taponthebackofthewebofyourhandbetweenyourringfingerandlittlefinger.Say, Iforgivemyselfforbeingattachedto_____.Iforgivemyselfforinvestingmyself esteeminthispersonorobject.Iamagoodpersonwithsadfeelingsaboutbeing attachedto_____. Breatheinandoutandvisualizeyourselfreleasingsadfeelings.Holdyourheadstill androllyoureyesinabigcirclethreetimeswhiletakingdeepbreaths.Say,Iaccept thesesadfeelings.IamagoodpersonevenifIfeelsad. NowcheckyourSUDSlevel.Repeatasnecessary. Crossovers:BlockedEnergeticPatterns DonnaEdenisanenergytherapistandanintuitivewhocanseesenergy.Edenhas writtenaboutmanydifferentwaystobalanceandworkwithenergy.Sometimes yourenergypatterncanbeblockedinoneormorewaysorevenruntheopposite direction.Theremaybeablockageoftheflowofenergiesbetweenthetopandthe bottomofthebody.Theremaybearighttoleftinterferenceflowortheremaybea fronttobackblockageinhibitingtheenergyflow.Sustainedstressofanykindcan interrupttheenergyflowbetweenthebrainhemispheres.Onepartofthebraincan becomeunderchargedwhiletheotherisovercharged.Thepolarityofthebody becomesreversedandtheminddisorganizedaroundthatissue. Itsbesttodothesecrossovercorrectionswithallthreeenergyflowsevenifyou dontknowwhetheryouhaveablockage.Itonlytakesafewminutesandifyou donthaveablockage,nothingwillhappen.Thesecorrectionapproacheswillallow theenergiestoopenupandflowevenly.FormoreofDonnaEdensenergy techniquesseehercoauthoredbook,ThePromiseofEnergyPsychology: RevolutionaryToolsforDramaticPersonalChange. CrossoverCorrectionsofBlockedEnergyPatterns
95

DotheEmotionalFreedomTechniqueseveraltimesoneachstatementuntilyoufeel clear. 1.EventhoughIhaveatoptobottomenergyblockageinmybody,Iloveandforgive myself.Ichoosetoallowmyenergytoflowfreelyfromtoptobottomandviceversa. Visualizeyourenergyflowinginacircularpatternfromyourheadtoyourfeetand theninareverseflowfromyourfeettoyourhead.Visualizationofthesecircularflows isagoodtooltodowithyourbreathforhelpingyourelaxatnightandgotosleep. 2.EventhoughIhavearighttoleftenergyblockageinmybody,Iloveandforgive myself.Eventhoughtheenergyflowisinterruptedbetweentherightandleftsidesof mybrain,Ichoosetoallowmyenergytoflowbackandforth.Visualizeyourenergy flowinginacirclefromrighttoleftaroundyourbodyandthenreversetheflowfrom lefttoright. 3.EventhoughIhaveafronttobackenergyblockageinmybody,Iloveandforgive myself.Ichoosetoallowmyenergytoflowfromfronttobackandviceversa. Visualizeyourenergyflowingfreelyinacirclearoundyourbody. DeepBreakingwhileWorkingtheBladderMeridian TheSpinalReleaseTechniqueisalovingtoolfromthechiropractictraditionthat couplescandotoreleaseangertakingturnstappingdowneachothersback.The sympatheticnervoussystemchainwhichactivatesthefight,flightorfreeze responsestravelsdownthethoracicspine.Tappingoneithersideofthespinal columnhelpsbreakintothefightorflightresponse.TheBladderchannel,as describedbyTraditionalChineseEnergyMedicine,runsfromtheinsideofthe eyebrowsbackacrosstheheadanddownthebacknearthespinecontinuingdown tothetoesandistheonlymeridianthatisconnectedtoalltheorgansinthebody lungs,heart,liver,spleen,pancreas,stomachandintestines.TappingontheBladder channelwhileyouthinkofyourproblemcancreateashiftintheenergysystemof thebody. TheSpinalReleaseTechnique

IdeasfromDonnaEden

96

Enlistapartnertobrisklytapupanddownoneinchawayfromyourspineonboth sideswhileyoukeepyourproblemorfeelinginmind.Breatherobustlywhileaccepting whatyoudontlikeinyourlife. Ifyoucantfindapartner,reachbacktotaponyourownbodyasmuchasyoucanon thetop,midsectionandlowerback.Startwiththetopofyourneckattheskullgoing asfardownasyoucan.GiveextratappingtoanytenderareasalongthisBladder channel. Thinkofwhatupsetsyouandturnitintoaneventhoughstatement:EventhoughI _____,IdeeplyandprofoundlyloveandforgivemyselfandIchoosetochange. Dothreedifferenttypesofbreathpatternswhiletapping;onedeep,longbreath,four halfbreathsandthenshortrapidbreathsasifyouarebreathingupanddowna musicalscale.Thisvariationofbreathingunlocksenergeticblocksintherespiratory system. Ifanunhappymemorycomesup,staywithitwhiletappingandbreathing.Tell yourselfthatwhateverhappened,yousurviveditandyouarestrongenoughtodeal withanythingthatcomesup. GoingInwardandCentering TheCentralorConceptionMeridianinChineseEnergyMedicinerunsfromunder yourbottomlipdownthroughthecenterofyourbodytothegenitalarea.Asa metaphor,itisconsideredhowyouconceiveofyourselfyourselfesteem. Energetically,itconnectsthehigherThroatCharkaandHeartChakrawiththethree lowerchakras.Itistheplacethatwegointotogroundandcenterourselves. ThecenterofyourchestonthemidlineisanacupuncturepointcalledTheSeaof TranquilityinChineseEnergyMedicine.Thisistheplacewhereyourpalms naturallycometorestwhenyoufoldyourhandstoprayagesturethatisusedin manyspiritualtraditionsforcenteringandgrounding.Fromthisplaceofyourheart moveoutofwhateverfearthathasheldyouinitsgrip. TheSeaofTranquility LynneNamka
97

Placethetipofyourtongueonthetopofthebackoftheroofofyourmouthtoconnect theConceptionMeridianwiththeGoverningMeridian. Tapsharplyonthecenteronyourchestwithyourfingersandtakesomedeepbreaths. Tappingandbreathingputastrongvibrationintothethymusglandandtheheartto calmyou.ThinkoffloatingintheSeaofTranquilityandlettingyournegativethought washawayfromyou. Monitorandcorrectyourrestrictivethoughtsdailytobemorepositiveinyour thinking.Askyourself,DoIhaveahigherthoughtthanwhathasbeenbotheringme? Whenyourthinkingismorerationalbasedonactualfacts,notthefearinterpretation ofthefactsthatyouregowants,youareleftwithacalmermind. Healingisreleasingthatsenseofthelimitedself.Withthefirstemotionalarousalcue comesupinanysituation,tellyourself,Icanchooselove.Ichooselife.Ichoosepeace. Touchintothecenterofyourchestandallowatranquilmoment.Takeadeep, replenishingbreathandfeelitmovethroughyourbodydownintoyourheart.Then bringyourhandsstillintheprayerpositionuptotouchthecenterofyourforehead andfocusonilluminatingandopeningyourThirdEye. SelfSabotagingCoreBeliefs Forsomepeople,changecanbethreatening,evenpositivechange.Theyhangonto deepseatedbeliefsduetofearofchange.PsychologicalReversals(PRs)aredeeply hiddencorebelieffearsthatliewithinthatkeepyoufrombeingsuccessful.Theyare thoseperpetualblindspotsdescribedbyThoughtFielddeveloperRogerCallahan whogaveusthefirstEnergyPsychologytechnique. Weallhaveourblindspotswhichcarrychronicpatternsofenergythatkeepus caughtinunproductivethinking.PsychologicalReversalsarepervasivemental blocksthatpreventyoufromexperiencinghealing.Theyareunconsciousobjections tohealingthatwereprogrammedintoyouwhenyouwerenaiveandopentothe condemningjudgmentsofothers. PRsarethedogmaticbeliefswhichkeepyoucaughtevenwhenyouwanttochange. Theyarethedecisionsyoumadewhenyoufeltoverwhelmedandunworthyasa childthatcontinuetodaybecauseyouhavenothadthetoolstoreleasethem.They createsystemicenergyblockagesandenergeticimbalancesinyourbodyand depleteyourlifeenergy.PRsarelikehavingyourbatteriesinbackwards.Nothing
98

willworkforyouuntilyougetyourenergyfieldstraightenedout.Thebeliefthat nothingyoudowillmakeadifferencetomakeyourlifebetterisareversalitselfthat needstobecorrected. PsychologicalReversalscomefromtheegosdesperationtostayalive.Theyarethe sneaky,ingeniousreasonsforstayingasis!Theyarethecharacterflawsbornof yourdeepestfearsandattachments.Manyofthemliedormantinthesubconscious mindandthenpopoutasanunhealthydefensewhenyoufeelthethreatof uncomfortableemotionscomingup.Theseprogrammedideasthatthemindholds hurtyou.Theyoftencarrysomehiddenreasonthatyoucanferretoutandconfront. Herearesometypicalselflimitingcorebeliefsforyoutocheckoffandconfront: _____Iamnotlovable. _____Iamnotsafe. _____Iamunworthy. _____Myworldisnotsafe. _____Idontdeserveabundance. _____Idonthavetherighttobelong. _____Iamguilty.Imustremainguiltyandashamed. _____Imincompetent. _____Imabadperson. _____Ihatemyself. _____Icanneverchange. _____Imtrapped. _____Imavictim. _____Ivebeenbetrayed. _____Icantreceiveabundance. _____Peoplewillhurtme. _____Imustrescue/fixothers. _____Imspecialandshouldgetspecialtreatment. _____ImsuperiorandcandowhatIwant. _____Iambetterthanyou. _____Icanhurtothers. _____Ragingisokaytoavoiduncomfortablefeelings. ChallengingUnsavoryCoreBeliefs Chooseasituationthatyouhavenotbeenabletochangeandaskyourselfthese questions.Writingdowntheanswerswillhelpclarifyyourneedtoholdontobeliefs andcopingmechanismsthatdonotsuityou.Digdeep!
99

Allbehaviorhaspurpose.Whatpossiblebenefitistheretohavingthiscoping behavior? Howdoesstayinginthesituationkeepyousafeatsomelevel?Whatdoesitkeepyou fromrisking? Whatdoesyoursubconsciousmindwantyoutogetordobeforethebeliefunderyour behaviorgoesaway? Whathaveyoubeenunwillingtodoinordertokeepthisproblem? Whatareyouwillingtodoinordertochangethisunhealthysituationnow? Howwillyoubedifferentifthisissuegoesaway? Negativebeliefsheldatthecoreofyoursubconsciousmindthatwereformedduring traumaticeventscanholdgreatpowersabotagingyoufromhavingloving relationshipsandsuccessinlife.Theycanbebrokenintowithenergypsychology techniques.Whenchallengedrepeatedlyandturnedupsidedown,youwillhavea senseofpeaceandrenewedenergy. Identifythesituationwhereyoufeelstuck: Identifyyourbeliefsregardingthesituation: Identifyyourfeelingsaboutthesituation: Nowthatyouunderstandmoreaboutyourreversedwayofthinking,dosomething aboutit.Sayyourproblemoutloudtogetauditoryfeedbackthroughhearingyour ownvoice.Sayeachstatementtwicewhiletakingdeepbreathswhiletappingonyour bodytocreatetheenergyforchange. Tapalloveryourbodyandbreathevigorouslywhilerepeatingthestatementsbelow. Poundawayifthedeepervibrationfeelsgood.Thisbrisktappingorpoundingwill stimulateyourendorphinsandyouwillfeelmuchbetterandyoujustmightseethings inanewlight. Cupyourfingersandtapbrisklyalloveryourbodystartingfromtheheaddownto yourtoeswhileyoubreathedeeply.Taponasmuchofyourneckandbackasyoucan reach.
100

Saythesestatementseventhoughyoudontmeanthem!Describingadifficult situationwhileyoutapawayonitcansometimesshiftfromnonacceptanceto acceptance.Rememberyoucanalwaysgiveyourselfpermissiontoleaveasituation thatisharmfultoyou. EventhoughIminimizeanddontwanttoaccepthowbadmysituationis,Ideeply forgivemyself. EventhoughIdontlikethissituation,Iacceptmyselfandmyfeelingsjustastheyas theyare. EventhoughIhatethissituation,Icannotchangeanyonebutmyself. EventhoughIfeelfrightenedandhopelessaboutthissituation,Ichoosetoseemy situationclearlyandgivemyselfchoicesindealingwithit. EventhoughIhatethewayIactinthissituation,Iacceptmyselfandallmyfeelings justastheyastheyare. EventhoughIjudgemyselfbadforbeinginthissituation,Ichoosetoseemysituation clearlyandgivemyselfchoicesindealingwithit. EventhoughIwanttoescapefromthissituation,Ideeplyandprofoundlyforgive myself. EventhoughIjudgethissituationtobeunfairandwrong,Ichoosetoseemysituation clearlyandgivemyselfchoicesindealingwithit. EventhoughIthinkthatIambetterthanorlessthanother,Ichoosetoaddressthis errorinthinking. EventhoughIbelievethatIcantbearthisloss,Ideeplyandprofoundlyforgivemyself. EventhoughIdontacceptthissituation,Iacceptandforgivemyselfandchooseto becomeclear. Thatsit!DothesetoolstobreakintoyourPRseventhoughyoudontwantto.Do tappingandbreathingontheideathatyoudontwanttodothisexercise.That mightremoveyourresistancetodoingthework!
101

Gobackthenextdayandtaponyourdistortedthoughtsagain.Andagain.Keepatit! Theonlythingyouhavetoloseisyourfearandstuckness! YouareNotAlone!RequestingHelpfromHigherForces Therearelovingspiritualforcesaroundusthatarewaitingforaninvitationtohelp asdescribedbytheanonymoussaying,Weentertainangelsunawares.Youcancall onyourGod,guidesandteachersandspiritualdeitiesyoubelieveinfromhigher realmstoassistyouinachievingpeace.JohnFreedomadaptedtheAskandReceive Techniquetodrawdirectlyfromhigherspiritualresources. HigherFrequencyDownloadisastructuredprayerwaytoaccessandknowanswers toproblemsbyconnectingwiththesubconsciousmindwiththeHigherResources thatareavailabletous.Ithelpsyouaddressyourdeepestbeliefsthatarenot helpful.Youcanrequesthigherfrequenciesfromabovethroughintentionand askingforwhatyouwant. HigherFrequencyDownload JohnFreedom Findanissueforwhichyouwishassistancewithfromthosespiritualforcesgreater thanyourself.DeterminetheSUDSlevelofintensityoftheproblem. 1.IKNOWthatthereareAngels&Allies,Healers&Teachers,HigherForces& Resources(God)thatknowhowtoheal,balance,correctandrealignalltheerrorsin mybeliefs,attitudes,perceptionsandmemoriesregarding_____. 2.TheseAngels&Allies,Healers&Teachers,HigherForces&Resources(God),are completelywillingtoheal,balance,correct,andrealignthisissue,inme,ifIbutask. 3.Iamcompletelywillingtoreceivethisdivinehealing,balance,correctionandre Alignment. 4.IamnowreceivingthisDivineHealing,Balance,Correction,andReAlignment,in thosespecificmemories,circuits,channelsandlocationsneedingcorrection,inall partsofmybody,mindandspirit,inalltimespast,present,futureandbeyond,inall places,spaces,locationsanddimensionsofexistence,formyself,myfriendsandfamily,

102

forallbeingswhohavesimilarmemories,issues,harmonicsandMorphicfields,forall sentientbeingsandforAllCreation,fortheHighestGoodofAll. 5.ThisHealing/Balancing/CorrectionandReAlignmenthasalreadybegun,andwill continueforaslongasneeded. Thankyou,thankyou,thankyou.Thankthosedeitieswithwhomyouidentifyand receiveguidance. EnergytherapistDawsonChurchsbookonneurogenesiscalled,TheGenieinyour Genes:UsingtheStunningNewBreakthroughsinDNAResearchtoGeneratePeak Health,quotesresearchshowingthatitdoesntmakeadifferencewhichdeityyou callupontohelpwithhealing.Helpistherewhenaskedfor.Thatinnateintelligence willrespondtoyouraskingforhelpasyouconnectinwithyourheart.Thehearthas thestrengthandintelligencetocarryyouthroughtothatplaceoflove. FamilyAncestralEnergeticThemesandEmotions Someoftheemotionsthatwecarryarenotonlyourownbutareenergetically transmittedtousfromourparentsandourancestors.Wereplaysomeofthe dominantemotionsandthemesofourparentsandthosewhocamebeforeus,good, badandindifferent.Someoftheenergeticinterchangemayberegisteredatthe subconsciouslevelinyouorinyourrelativesfromgenerationspast. Destructivethemesarealsopasseddowninfamiliesgeneticmemory.Beinga victim,incest,addictions,stubbornnessaresomeexamplesofthemes.Ifyour parentshavehadathemeeventhoughtheymayhaverepressedit,youprobably haveiteitherataconsciousoranunconsciouslevelorboth. Childrenareoftenlittleenergeticspongesandtakeontheenergiesoftheirparents withoutbeingawareofthem.Theygrowupandmakethesamemistakesormarry someonewhohasasimilarenergeticthemeastheirfamily.Themesinfamiliesare intertwinedwiththepastandfuturegenerationsandasbeliefs,emotionsand defensemechanisms,thesecanbereleased. Youcanclearnegativityaroundanemotionalstate(anger,fear,grief,sadness, shame,anxiety,etc.)orathemethathavecomedownthroughyourfatherand/or mothersancestralline.Inthisexercise,angerisgivenasitisauniversaltheme familypresentinmanyfamilies.Youcansubstituteanyotheremotionsuchas shame,depressionandanxiety.
103

YoucanusetappingprotocolofTheEmotionalFreedomTechnique(EFT)totake personalresponsibilityandgodeeperintoresistant,energeticallyboundfamily themestoprovidesystematicclearance. Callonanyteachers,helpers,guardians,angelsandGodtoassistyouinthishealing. UseEFTtotapwhilemakingthefollowingstatements.Thistooltakesafewminutes, butitisthoroughworkingtheissuewithforgivenessforyouandyourancestors.It usesangerreleaseasanexample,butyoucanuseanyemotionortheme. TappingtoReleaseFamilyEnergeticThemes Chooseageneralfamilyemotionorthemethataffectsyourlife.Workthisissuefirst withyourfatherssideofthefamilyandthenyourmothers.Eventhoughthereis angerinmyfathersancestrallinethatcontinuesinmeandmychildrenand grandchildren,Ideeplyforgivemyselfandallofthosewhoprecededme.Ihumblyask Sourcetoreleaseallenergies,beliefsandthispredispositiontoanger. Eventhoughthereareissuesoffearandangeraboutbeingrejectedandabandonedin myfathersgeneticline,Iforgivemyselfandthosewhocamebeforeme. EventhoughIamangrythatIverejectedmyselforapartofme,. EventhoughIamangrythatIveabandonedmyselforapartofme,. EventhoughIverejectedmyvaluesof_____,. Eventhoughthereareissuesofangerinmyfathersgeneticlineatbeingbetrayed,I forgivemyselfandthosewhocamebeforeme. EventhoughIvebetrayed_____,.. EventhoughIvebetrayedmyselfby_____,.. EventhoughIvebeenangryatbeingbetrayedby_____,.. Eventhoughthereareissuesofangerinmyfathersgeneticlineaboutfearofbeing criticized,Iforgivemyselfandthosewhocamebeforeme. EventhoughIvecriticizedandfaultinmyself,.. EventhoughIvecriticizedothers,.. EventhoughIvebeenangryatmyselfformakingmistakes,..

104

Eventhoughthereisjudgmentanddisgustwhenothersdidthingsdifferentlythanmy fathersvalues,Iforgivemyselfandthosewhocamebeforeme. EventhoughIvebecomejudgmentalanddisgustedatothersbehaviors,. EventhoughIvebecomejudgmentalanddisgustedatmyselforapartofmyself,. Eventhoughthereisirritabilityandfrustrationinmyfathersgeneticline,Iforgive myselfandthosewhocamebeforeme. EventhoughIamirritableandfrustratedwith____,. EventhoughIvebeenirritableandfrustratedwithmyself,.. Eventhoughthereisdisappointmentinmyfathersgeneticline,Iforgivemyselfand thosewhocamebeforeme. EventhoughIvebeendisappointedwith. EventhoughImdisappointedwithmyselfabout_____,. Eventhoughtheresdenialofpersonalresponsibilityandblamingothersinmyfathers geneticline,Iforgivemyselfandthosewhocamebeforeme. EventhoughIvedeniedpersonalresponsibility,.. EventhoughIveblamedothersinsteadoflookingatmypartoftheproblem,. Eventhoughtherearepowerstrugglesandissuesofcontrolinmyfathersgeneticline, Iforgivemyselfandthosewhocamebeforeme. EventhoughIvehadpowerstrugglesandissuesofcontrolwith_____,.. EventhoughIvehadpowerstrugglesandissuesofcontrolofmyownabout____,. Eventhoughthereisbullying,meanteasingandaggressioninmyfathersgeneticline, Iforgivemyselfandthosewhocamebeforeme. EventhoughIveteasedandbulliedothers,.. EventhoughIvehadaggressivethoughts/behaviorswith_____,.. Eventhoughthereisrageandviolenceinmyfathersgeneticline,Iforgivemyselfand thosewhocamebeforeme. EventhoughIveragedat/about_____,.. EventhoughIvehadviolentthoughts/behaviorat_____,..
105

Eventhoughthereishatredandrevengeinmyfathersgeneticline,Iforgivemyself andthosewhocamebeforeme. EventhoughIvefeltloathingformyself,. EventhoughIvefelthatredandrevengefulat_____,.. Youcouldalsorepeatthisexercisewithanyfamilytraitdepression,mentalillness, incest,addictions,narcissism,codependency,stubbornnessetc.thanhasbeenpassed down. CoveringalltheBasesPast,PresentandFuture WeareallinterconnectedthroughthatgreaterMorphicField.Peoplewhoare presenthavereincarnatedbacktobetogetherasasoulgroup.Yourgoingforthe whole,supersizedenchiladaofhealingwiththesepeoplewithwhomyouve experiencedkarmacanthutandjustmighthelp!Aspartofasoulgroupthatcame throughtogether,therearemanyunresolvedemotionalissueswithanyoneyour haveloved,hatedorbeencloseto.Thisincludesyourparents,siblingsand importantrelatives. Ifyouwereadoptedorraisedbysomeonewhodidnotshareyourgeneticheritage, mostlikelyyoucamefromthesamesoulgroup.Thiscategoryincludesastepparent oranadoptiveparentwhoinfluencedyourbeliefs.Thisenergeticinfluencearounda negativeemotionalthemethatwaslearnedfromthemalsohastobeworked. Gobackanddothepreviousexercisesubstitutingthenameofthesteporadoptive parentwhoraisedyouforthephrasemyfathersgeneticline.Youcouldalsodo thisalteredversionforanypersonnotofyourfamilywhohashurtorabusedyouor thatyouhavehurttobreakanynegativepastlifeconnections. ReleasingThemesfromOtherDimensionsandOtherAspectsofOurselves LynneNamka Weareindeedprivilegedtobelivinginatimewherewehavetheresourcesand techniquestocarryouthealingnotonlyforourselvesbutforthegenerationsthat camebeforeusandthosewhocomeafter.DotheEFTtappingprotocolwiththese followingpossibleenergeticimbalances.
106

AfterthefollowingSetUpStatementsgivenbelow,addIchoosetobeinastateoflove andhumblyaskGod/Sourcetoreleasetheseissuesfromthepastorfuture. Eventhoughthereareunresolvedpastlifeenergeticissueswith_____,.. Eventhoughtherearesoulgroupimbalanceissueswith_____,.. Eventhoughthereareotherdimensionsconnectedtothisissue,_____,.. EventhoughIcarrythecollectiveconsciousnessgroupthemeofthisissue,_____,.. Eventhoughmychildrenandgrandchildrencarryoutthistheme,.. Eventhoughtheseissuesplayoutinmycurrentlifeinmyrelationshipwith_____.. Eventhoughthisgenerationalthemeoperatingcurrentlyhascausedenergetic blockagesinmybodyandmind,.. ClearingOldKarmicLessons Karmaistheunderstandingoftheproverb,Whatyousow,iswhatyoureap.What isunsolvedandunsettledinapersonsconsciousnessisplayedoutthroughtheir experienceswiththepeoplearoundthem.Atcertaintimesinapersonslife,oldsoul memoriesstarttoawakentocallthepersontoaddresswhatisunresolved.Karmic lessonsarehiddendeepwitinourcharacterandwhatwevibrationallydrawtous. Themisconceptions,falseexpectationsandfalseassumptionsthatkeepourlifeout ofbalancecomeupagainandagaintofindresolution.Heraclitussaid,Our charactercomesbacktousasdestiny.Eachinitsowntiming,thosesoullessons comebackuntiltheyareaddressedandlaidtorest.TheChineseteacher,LiJunfan said,Thewaytotranscendkarmaliesintheproperusofthemindandwill.The onenessofalllifeisatruththatcanbefullyrealizedonlywhenfalsenotionsofa separateself,whosedestinycanbeconsideredapartfromthewhole,areforever annihilated. ClearingSoulContracts Whatkarmiclessonsdidyoucomebacktolearn?Whatnegative,reoccurringpatterns haveyoubeenplayingout?Whatagreementshaveyoumadeatasoullevelwith certainpeopleinyourlife?Whereisyourlifecontinuallyoutofbalance?What mistakesdoyoukeeprepeating?Whatareyoudoingtoaddressyourlessons?
107

Thinkofanuncomfortablelifesituationoranunhealthypatternwithsomeoneinyour life.Whatdoesntworkforyou?Youwillhavemorethanonelessontobechallenged. Onceyoubringtheseoldcontractstoaconsciouslevelbybeingawareofthem,you canworkandreleasetheonesthatareimpedingyourspiritualgrowth.Turnthe negativethemethatyouhaveexperiencedaround.Reworditasapositivelessontobe learned. _____Toliveinfreedom. _____Toreleasenarrowmindedprejudice,intoleranceandcontemptforthosewhoare differentfromyou. _____Toreleaselossandidentityconfusionissuesaroundlossandgrief. _____Toreleasecravingsforsomethingoutsidetheselfseekingaddictions. _____Toreleasehatredandrevenge. _____Toreleasecodependentbehaviorandtheneedtoexcessivelytakecareoforfix others. _____Tobalancepowerandissuesofsubmissionanddomination. _____Toreleasebeliefsandbehaviorsofsuperiority. _____Toreleasebeliefsandbehaviorsofinferiority. _____Toreceiveabundancegracefully. _____Toliveinharmonious,lovingrelationships. _____TospeakmytruthandliveinaccordancewithInnerWisdom. YoucantapusingTheEmotionalFreedomTechniqueontheseoldcontractsthatyou camebacktorelease.Setyourintentionforhealingtheunresolvedkarmiclessonsthat areplayingoutinyourlife.Observehowthesecontractsplayoutinyourdailylifeand addressthemoften.

108

Brainwavesareus!Wehumansareelectricalandchemicallybasedandourbrains haveelectromagneticimpulsesorcurrentswhichcanbemeasuredandchartedwith anelectroencephalogram(EEG).Thisfrequencyorspeedofthebrainwaveis measuredinhertz(Hz)orcyclespersecond.Youengageinvariedbrainwave frequenciesasyoumovethroughyourdaydependinguponwhatyouaredoing. Ifcertainpartsofyourbrainhavemoreelectricalenergy,theybecomedominant withotherpartshavinglessenergy.Thebraingoesoutofbalance.Depressedpeople havelowlevelsofactivityintheprefrontalcortexwhileexperiencedmeditators, healersandTibetanmonkshavehighlevelsinthisarea. Wenowhaveimportantbrainentrainmenttechnologyfromthesoundtherapyfield tohelpusoffsetsomeofthestressorsthatgooninourworld.Byusingbrainwave entrainment,youcanshiftyourbrainwavestoafrequencythatassistslearning, relaxation,meditationandhealing.Meditationhasalwaysbeenarecognized spiritualpracticethatallowsfortheshiftingofdisturbingmaterialfromthe subconsciousmindandenhancingconsciousness. Thebinauralbeatsoundhealingtechniqueusesbrainwaveentrainmentthatallows apersontoperceivetonesthatarebelowtherangeofhumanhearing.Binaural beatsareproducedwhentwotonesofslightlydifferentfrequencies(suchasaslight hertzleveldifference)areplayedineachear.Thebraintriestofigureoutwhatitis hearingandproducesasortof"backandforth"wavesoundthatpulsesatdifferent rates.BinauralbeatsrecordingsareavailableonCDsordownloadedtoyourMP3 arespeciallygeneratedsounds,designedtoalteryourbrainwavesforoptimum functioning. Yourmoodisaffectedbythetypeofbrainwavesyouareexperiencingandvice versa.Differentcommercialwavepatternspromotedifferentmentalstatesor combinationsofthedifferentranges.Binauralbeatstimulationhasbeenusedto decreaseanxiety,controlweight,depression,stress,focus,attention,anddeepen
109

Thebraintendstomatchitsownwavepulsestothoseofexteriorsoundpulses,aphenomenonknownas acousticbrainwaveentrainment.Researchhasshownthatspecificstatesofconsciousnesscaninduced throughhearingsoundpulsesthatmatchthebrainwavefrequencyofthatparticularstateofmind. JefferyThompson

Chapter14 TheBrainEntrained:SoundTechnologytoEnhanceyourBrain

statesofconsciousness.Brainenhancementhasbeenusedtofacilitateprofound relaxation,sleep,paincontrol,weightlossandtodevelopaharmoniousattitudeand strengthenthemindbodyrelationship. Hemisphericsynchronizationisaprocesswheretheelectricalactivitybetweenthe leftandrightbrainhemispheresbecomebalanced.Havingaccesstobothsidesof thebrainatonceishighlydesirableastherighthemisphereisassociatedmorewith emotionsandcreativitywhiletheleftisassociatedmorewithrationalthought,logic andspeech.Increasedsynchronizationisfoundinlongtermmeditatorsand happier,contentedpeople.Whenyourtwohemispheresaresynchronized,youfeel energized,healthier,happier,andemotionallystableandhaveaclear,focusedmind. Brainsynchronizationispartofthespiritualjourney. BetaWaves YourThinkerthepartofyouthatisreadingthisrightnowusesbetawaves.Beta, oureverydayworkingwavestatepatternismeasuredat1340Hzwhenwe problemsolveandaremotivatedtodosomething.Whenwethink,planorinteract withothers,weareinthebetawavestate.Howeverfearthoughtsarealsopartof thebetawavepattern.Certainhertzrangelevelsofbetaareassociatedwithstress, depression,anxiety,insomniaandObsessiveCompulsiveDisorder(OCD). Betawaveshelptakeinandprocessdatareceivedthroughthesenses.Theyare requiredforconsciousthinkingandprocessingofemotions.Betawavesarepresent whenyouworry,areangryorafraid.Thefrontallobesofthebrainarewherebeta brainwavesareproducedaswellasonbothsidesofthebrain.Donottrytoincrease yourbetawavesifyouareanxiousorstressed. AlphaWaves Alphabrainwaveactivity,measuredat713Hz,iscommonamonghighlycreative individualswhohaveaclearmindorareexperiencingrelaxation.Alphaisalso associatedwiththebeginningofaccessingtheunconsciousmind,softeningyour focusandincreasingyourcreativevision. Doyougettoorelaxedandzoneoutwhensittinginfrontoftheboobtube?Itsa brainwavething.Researchshowedthatpeoplewhowatchedtelevisionproduced brainwavesinthelowalpharange.Itonlytookoneminuteforthebrainwavesto turnofftheworldandtoenterlowalpha!Extremetelevisionwatchingcanproduce
110

anunfocused,daydreaming,brainfog,lowalphastatethatmakesitchallengingto gobacktotherealworldandgetsomethingdone!Nowondertelevisionis addictive.Peoplewhostartedreadingamagazinequicklywentbacktotheeveryday stateofbeta. ThetaWaves Generatingthetaactivity,measuredat47Hz,forafewminuteseachdayisaboon forhealing.Thetawavesaresaidtoboosttheimmunesystem,enhancecreativity andobtaindeeprelaxationandmeditation.Youexperiencethetaduringhypnosis, tranceandgoingdownintoREMdreamsleep.Thishappenswhenyouareina twilightdreamlikementalstate.Childhoodmemoriescancomeup.Thetahasbeen associatedasthebreakthroughstatewheresuddeninsightandcreativeideas breakthrough.Thetawavesarepresentduringshamanicjourneys,outofbodyor astraltravel.SoundhealerJefferyThompsondescribesthehealingreactionsthat canhappenwhenthetabrainstateisactivated. Thisiswhereemotionsandpasthurtsandtraumasarehealed.Formany,theTheta brainwavesthawfrozenorstuckfeelingsfrompasttraumasandhurts.Asthebrain stateforhealingfeelingsandemotions,theThetasessionisverygentlebut powerful:insightsenhanceunderstandingandrealizationscomewiththeAha momentsbroughtaboutbyhemispheresynchronization. ThetaHealingisapopularworkshoptrainingprogramthatteachespractitioners howtoinducethisdeephealingstateinclients. GammaWaves Thegammabrainwavesmeasuredfrom4070Hzmakingthemthefastestand smallesttypeofwaves.Theyareconsideredbysometobeanaturalantidepressant whichpromotesaconnectiontoincreasedperceptionandhigherconsciousness. Whengammawavesincrease,theleftprefrontalcortexactivityisincreased allowingforthewholebraintobalanceandintegrate.Gammabrainwavesare commonlyassociatedwithincreasedlevelsofcompassion,feelingsofhappiness, optimalbrainfunctioningandaconsciousawarenessofreality.Theyarealso associatedwiththeahha!momentandmysticalexperiences. Researchfromacrosstheworldshowsthatsomehealersreachstatesofgamma waveswhileintheiralteredstateofhealing.Researchersfoundthatstronggamma
111

waveswereproducedineightTibetanmonkswhomeditatedinastateof "unconditionallovingkindnessandcompassion.Someresearchindicatesthat peoplewithpsychiatricandneurologicalproblems,learningdisordersand schizophreniahavedisruptedgammawaves. Lowerandhigherstatesofconsciousnesshavedifferentbrainwavestates.Nuclear physicistDr.RobertBeckwentallovertheworldmeasuringthebrainwavesof healers.Hemeasuredtheirelectricalbrainwaveswithanelectroencephalograph (EEG).Hefoundthathealersallexhibitthesamebrainwavepatternof7.88Hz whentheyareengagedinanalteredstateofconsciousnessduringthehealings.He testedmanydifferenttypesofhealers:psychics,Christianfaithhealers,Hawaiian Kachinas,Wiccapractionersandgenerictypehealers. OnehypothesisbyEvanVorleyfromthehighconsciousnesswebsite www.themeditationsolution.com/isthatbabieshavebrainswithstronggamma activity.Ofcoursethiswouldrefertobabieswhohavenotexperiencedbirthtrauma andearlyneglectorabuse.Acontented,happybabyhasamoreintegratedbrain. Later,whentherehavebeenunsettlingexperienceswheretherehasbeenstrong emotionthatwasnotprocessed,certainpartsofthebrainbecomemoredominant givingtoomuchofcertaintypesofwaves.Integrationandwholenessbecomes interruptedwithchangesinthebrainselectricalactivity.Traumaexperiences fragmentthebrainanddisorientthechild.Thebabysegoisformedwhenhis gammawavesaredisrupted.Vorleygivesagooddescriptionofhowbrainwavesare relatedtotheformationofthechildsego. Whengammabrainwavesarestrongtheentirecortexisactivated.Itisa brainwavethatintegratesthebrainandhelpsittoworkasawholeTheir senseofselfissimple,wholeandintegrated.Asthechildgrowsuphowever theirbrainstartstoworkincompartmentswithsomepartsbecomingmore activeandotherslessactive.Asthepersonalitybecomesmorecomplexand theGammabrainwavebecomesweakerthechildstartstolookforitssenseof selfinwhatitdoesandhowitrelatestotheworldinsteadofitswholeness,its being. Thisisaturningpointintheevolutionoftheego.Whendoesthechild'ssense ofselfshiftfromitspresence,thebeingnessthatwasborntothatoftheego? Itisagradualprocessbutthereareperiodswherethechildisactuallyaware oftheshiftItisonlyyearslaterwhentheegobecomesincreasinglycomplex thatthesenseofselfshiftsfromthatofEssencetothatofego.Whenthis occurs,thegammabrainwavehasbecomemuchweakerandthebrain becomesdisjointed.
112

Theconceptofentrainmentfromthebrainwaveresearchexplainshowdeep healingoccursinthepresenceofgurus,shamansandhealerswhocaninduce (entrain)gammawavesinothers.Duringhealingexperiences,piecesofthe fracturedegomaybebroughtintobalancewiththetaandgammaactivityto resonatewiththehighervibrationfrequenciesofloveandinterconnection. DeltaWaves Deltawavesarethosegooddeepsleepwaveswhichproviderestorativehealingfor thebody.Theyaremeasuredatlessthan4Hzandaccompanythelossofbody awarenessasyoudropintodeepsleepthatrestoresyourbody.Duringdeepsleep, thereisanincreasedimmunefunctionanddeepphysicalrelaxationwiththe potentialforhealing.DeltawavesduringREMsleepgiveyouaccesstothe unconsciousandcollectiveunconscious.DuringdeepestREMsleep,information thathasbeenlearnedduringthedaybecomesincorporated.Peoplewithbrain injuryandcomasmayhavetoomuchofthesedeltawavesandareunabletoshiftto otherneededbrainstates. TheBinauralBeatTechnology Somesoundhealingprogramsusepleasantbackgroundsoundssuchasocean waves,rainforestsounds,birdcallsorambientsound.Someprovidehypnotic suggestions,verbalinstructionsorsubtlesoundeffect.Othersarepurebeatsonly withnosubliminalmessagesorvoiceovermessages.Freesamplesareavailable fromsomeofthewebsitesthatselltheseprogramseithertolistentoorto downloadtoMP3devices. JefferyThompsonincorporatesprimordialsoundstohisrecordingswombsounds, mothersheartbeats,naturesoundsandsoundstakenbyVoyagerSpaceCraftasit passedbyouterplanetsofourSolarSystemJupiter,Saturn,Uranus,andNeptune. Thompsonrelates, Thesewererecordingsofchargedelectromagneticparticles(ions)inthe magneticfieldsoftheseplanetsvibratingwithintherangeofhumanhearing. Whatdidtheysoundlike?Theysoundlikedolphins,choirsofvoicessinging, crickets,birds,Tibetanbowls,andoceansounds,plusothersoundstoo strangetoidentify,butwhichseemveryfamiliar.Couldthesesoundsbe deeplyrecognizableatadeeperlevelofthe"collectiveunconscious?
113

Brainmappingresearchindicatesthatsomepeoplehavetoomuchofonetypeof brainwaves.Exposingtheirbraintomoreofthesamewavescanbedetrimental withmorehemisphereimbalance.Peoplewhoaredissociativeorfeel depersonalizedandlosetheirsenseoftimemightstandagooddoseofbetawake upnowwaves.Peoplewithseizuredisordersmayhavetoomanythetawavesat certaintimesmightbenefitfrombetaactivitywhenapossibleseizurestartstocome on.Betawavesmightbehelpfulforpeoplewhospaceoutandthosewhofeel ungrounded. ThereisasmallamountofresearchsayingthatpeoplewithADDhavedifficulty maintainingthehighlevelsofbrainarousalassociatedwithsustainedalertnessand focusedattention.TheyhavelowlevelsofbetaactivityasmeasuredbyEEGsandtoo muchthetawavessomeofthetimesendingthemoffintodaydreamingand distractionInaresearchstudy,enhancingbetawaveswasshowntohaveaneffect ontheabilityofchildrenwithADDtoimproveattentionandperformvarioustasks. DesignerBrainWaveProgramsforDifferentPurposes Listeningtodifferentwavepatterns,youmaynoticetinglingsensationsindifferent partsofyourbrainaselectricalactivityshifts.Thebinauralbeatfieldisworth researchingasmoreisbeingdiscoveredwiththenewbrainimagingstudies. Achievingabalanced,interconnectedbrainisoneofthemostimportantthingsyou candotohelpwiththestressorsthatyouface.Reunitingthedisconnected hemispheresandmovingfromlowerlevelconsciousnesstoahigherstateof vibrationwillhelpincreasethepeaceandharmonyinyourlife. Youmightaskyourself,Whattypeofbrainwavesareneededforthisparticular task?orWhattypeofbrainwaveswillcalmmedownorrevmeuprightnow? Theresnotmuchwrittenonunderstandingyourowntypeofbrainwaveactivity andhowtooptimizedesignerbrainwavesforyourspecificneeds.Ifyouhavean unusualbrainoronethathastoomanyofonetypeofwave,youneedtobea connoisseurwhenchoosingwhatworksforyou.Orgotoabrainmappingclinicto learnaboutyourparticulartypesofwavelengthsandhowtooptimizetheelectrical activityinyourbrain. Warning,ChooseWisely:OneSizedoesnotFitAll!

114

Herearesomegeneralideas.Doyouhavetroublefocusingandpayingattention? Whenyourbrainfeelsgroggyorscattered,tryoneoftheHemisyncsCDsfor alertnessandfocus.BetawaveCDswithvarioustypesofclassicalmusiccanbe foundattheMonroeInstitutesHemiSyncwebsiteatwww.hemi sync.com/shopdisplayproducts.asp?id=204&cat=ADD. Forcreativityandcalming,trysoundhealerDr.JefferyThompsonsmusicsuchas Gamma2.0orThetaMeditationatwww.neuroacoustic.com/.UseThompsonsDelta waveCDforgettingtoandstayingasleepwhenyourmindisoverstimulatedand busy,busy,busy. Forspiritualdevelopmentandunderstandingofyourmultidimensionality, Meditationsolution.comgivesametaphysicalunderstandingandthebinauralbeat technologyembeddedinsoundandhigherlevelpracticestoassistyourawakening intohigherknowledge.Theyhaveaprogramthatbalancesalltheorgansand chakras. Whileallhumanbrainsaresimilar,individualbrainsareuniquelikefingerprints; eachhasitsownspecialneedsonadaytodaybasis.Caution,cautionaboutstaying inalpha,thetaandgammatoomuchofthetimetothedetrimentofyoureveryday lifetasks.Usethissoundtechnologyintelligentlydrawingfromyourinnerwisdom. Donttrytogettoomuchofagoodthing.Dontoverdousingthisbrainentrainment technologytostayinthefeelgoodbrainstatesallthetime;dontcreateanew addictiontobeinginlalalandattheexpenseofotherrequiredbrainwaves.Ashort periodadayissufficienttoachieveharmony. Yourintelligentbraincanlearntoreproducedesiredbrainwavesonitsownthrough repeatedlistening.Yourbraincanholdthememoryofadesiredwavepatternand recognizewhatisrequiredforacertaintypeoftask.Thenwithmuchpractice,your braincanrememberhowtoproducethatparticularactivityandchemicaland hormonalstatethatisneeded.Thisistheabilitytoentrainyourownbraintoa desiredbrainstatebyusingbreathing,intentionandaconditionedresponsetoput yourselfintoadesiredbrainstate.AstheancientTaoistsknew,healingisalways aboutbalance.

115

Chapter15 Coherence:BecomingPureofHeart
Intelligencecapacityisdiminishedwhenfrustration,anxietyorinnerturmoiloperate. Suchemotionalstatescauseincoherenceintherhythmicandelectricaloutputoftheheart, diminishingneurologicalefficiency.It'soneofthereasonssmartpeoplecandostupidthings. Whenyoumakeinternalcoherenceadailypriority,yousavetimeandenergy. Internalcoherence"oils"yoursystem. Withoutoilinanengine,itburnsup. Socanyou. DocChildreandBruceCryer,HeartMathInstitute

Wehumansaresoheartconnected.Theheartisthefirstorganthatdevelopsinthe fetusbeginningabouttendaysofage.Theheartcreatesastrongelectromagnetic fieldthatsendssignalsthroughoutthebody.JosephChiltonPearcesaidthatthe electromagneticfieldgoesoutuptofifteenfeetfromthebody.Theheartisan intelligencesystemthatworkswiththementalemotionalreactionsthataffectour health.TheHeartMathInstitutehaspioneeredresearchforoveradecadeshowing themechanismsthroughwhichtheheartcommunicateswiththebraintoprocess perceptions,emotions,organfunctionandoverallhealth. Wearebothelectricalandchemicalinnaturewithonehundredtrillioncellsseeking informationthroughspecializedpathwaysandcommunicatingwitheachother. Throughstudyandmappingtheelectricalandthechemicalsynchronization betweentheheartandbrain,theresearchershaverepeatedlyshownthatcreativity, intuitionandproductivityincreasewhenthereiscoherenceinthesystem. Ahh,itistheheartthatsatthecenterofourhealing.Thehearthasanelectrical amplitudethatissixtytimesgreaterthanthebrain.Themagneticfieldoftheheart is5,000timesgreaterthanthebrainsgeneratedmagneticfield.Yourheartbeats chaoticallywhenyouareinemotionaldistress.Yourheartandbraincommunicate viaelectricalandchemicalmessagesthatdictatethefightorflightresponse.Yetyou canresetthemechanismtobringyourselfbackintofeelingsafeandcompetent. Healingmomentsaccesshigherlevelsofinformationthatcreateharmonyand balanceinthebrainandheart.ChiltonPearcesaid,"Theintelligenceoftheheartis theintelligenceoftheUniversetoholditselfinunison." ItsaboutBalancetheTwoBranchesoftheCentralNervousSystem
116

As I described in my book, Your Quick Anger Makeover: Plus Twenty Other CuttingEdge Techniques to Release Anger, Five Element Theory and Traditional Chinese Energy Medicine came out of the ancient Taoist philosophy. Five Element Theory describes wood, fire, metal, earth and water energies and the tendency or predisposition of a person to act in certain ways due to the imbalances of their body. For example, angry people typically have an imbalance in their wood energy which is concentrated in the liver and gall bladder meridians. Acupuncturist Lonny Jarrett states that Chinese theory describes how . a child becomes stuck in one of the five movements of the Tao as a predominant form of selfexpression. Traumatic life experiences including positive and negative core beliefs and the perceptual lens of how the world is viewed can further impact the child, enhancing their imbalance. Using anger as an example, if liver chi is obstructed or exaggerated, it accumulates without the ability to flow which causes excess heat. Excessive chi in these meridians is characterized by a person who is hostile, belligerent, frustrated and has a sense of being thwarted and the need to always be right which results in the inability to control anger. TheTaoistconceptofstrivingforbalanceisconsistentwithmoderndayscientific theorythathomeostasisistheresultofequilibriumbetweenthesympatheticand parasympatheticnervoussystemsotheycanfunctionintandem.Coordination betweenthetwobranchesofthecentralnervoussystemhappenswhenthe individualisabletodetectsafetyinnotonlytheouterenvironmentbutwithinthe memoriesofthemind.Dangerisnotperceivedsothepersondoesnothavetostayin hypervigilancealwayspreparingtofight,fleeorfreeze. Everythingthatyouperceiveandthinkistransmittedfromyourhearttoyourbrain thoughthesympatheticandparasympatheticnervoussystem.Thetwosystems worktogethertospeedyouupwhendangeriseminentandtoalternatelyslowyou downtoensuresurvivalofyourbody.Thesympatheticnervoussystemreactsto stressandthreat;thinkofitasbeingsympathetictoreacttoDANGERenergizingthe heart,glandsandsmoothmusclestoprepareforaction.Itgivesthemessageto fight/flight,whichisescaping,orfreeze. Freezing,atypicaldissociativeresponse,makesthebodyimmobile(likeapossum playingdead)butinthisstatenoenergyisdischargedfromtheautonomicnervous system.Amnesiaforwhathappenedmayoccur.Thethinkingprocessandmental functionsareseparatedofffromtheemotions.Inthisstate,alltheinternalorgans areaffectedandthereisnodischargeoftheexcessenergiesofshock,shame, helplessnessandhopelessness.
117

Theparasympatheticnervoussystemwiththehelpofthevagalnervetriestoget thebodybacktohomeostasisbyslowingdowntheheartbeattobringthebody backtoacalmerstate.Peoplewithconstantstressorsintheirlifecangetstuckin hyperarousalorsympatheticnervoussystemarrest.Seventytoninetypercentofall visitstothedoctorresultfromstressrelatedcausesaccordingtotheAmerican InstituteofStress.

Researchindicatesthatsomeverysensitivepeoplewhoexperienceearlythreats havecompromisesinthesympatheticandparasympatheticnervoussystems disrupttheirabilitytoremaincalmastheirbrainoverinterpretsincomingstimuli. Disruptionofthesensorystimulisignalsmakesmoreofachallengewithbehavioral overreactivityandemotionalselfregulation.Peoplewithsensorydefensiveness haveintenseinterpretationsofnoise,touch,olfactoryandvisualstimulithatothers findinnocuous.Itstandstoreasonthatthemoresensitiveyouare,themoreself careintermsofcalmingtechniquesyouwillneedtodotokeepyourbodyin homeostasis.Andthefeelingthatyouaresafeinyourworldisafunctionofthe amountofyouroriginalemotionalarousalandsenseofhelplessnessifyou experiencedearliertrauma. TheCoherenceResearchfromtheHeartMathInstitute TheHeartMathInstitutestudiesmeasuredtheheartvariabilityrate(HRV)toshow howtheheartspeedsuporslowsdowninresponsetostress.Theirfollowing graphsshowthedifferentpatternsofheartratevariabilityunderconditionsof stressandthenhowtheheartrhythmschangewhenyoufeelgratefuland appreciative.

118

StressProducingHeartRhythmofaChaotic,JerkyPattern

Anincoherentheartismarkedbyjagged,disorderedorirregularheartrhythm patterns.Whenyouhavestressfulfeelingsyourheartgoesoutofbalanceandyour brainbecomesfloodedwithcortisolandotherstresshormones.Unresolved problems,stressandnegativethoughtscreateanelectricalsysteminthebodythat isoutofbalance.Chronicstressisanongoingselfinducedstateofemergency. Excessivenegativeemotionsaddtobeinginastateofchronicdehabilitatingstress andfatigueandinterruptyourbodysabilitytohealitself.

HarmoniousHeartRhythmwithCardiovascularEfficiency

Acoherenthearthassmooth,orderedheartrhythmpatterns.Healingisachievedby reachingacoherentenergyfieldwithinthesystembybringinginrefinedandhigher frequenciesthatcreateaharmoniousbalancebetweentheheartandthebrain.This istheheartbrainentrainment.Strongemotionschangeyourheartandbrain rhythmsanddisruptthefreeflowofelectricalactivityandenergy.TheHeartMath researchconcludes,

119

Depressedpeopleoftenobsessabouthowbadtheyfeelandfocusonthenegative aspectsoftheirlife.Arecentstudyusedatreatmentofhavingdepressedpeople makealistoffivethingstheyweregratefulforonceaday.Alltheyhadtodowas makealist.Theiremotionalstatechangedandtheybecamemuchhappier.Imagine howmuchbetteryouwouldfeelifyounotonlymadealist,butactuallyexperienced thefeelingofgratitudedaily?ThatsthepremisebehindtheHeartMathInstitutes mindandbodycalmingpractices.Youcangotoyourhappyplacebyconnecting yourheartandbrainincoherence! HeartMathsresearchshowsthatwehavetheabilitytocreateheartrhythm coherencetolivehappierlives.Connectingintoyourheartandactivatingaheart feelingsuchaslove,gratitudeorafunexperiencesuspendsyoureverydayreality fromdisruptivethoughtsandemotions.TheHeartMathsresearchshowsthat feelingsofappreciation,gratitudeandhappinessincreasewhitebloodcellsand strengthentheimmunesystem. UsetheHeartMathexercisesthatfollowtogiveyourselfcongruent,coherent momentsoftentoallowthatentrainmentbetweenyourheartandbrain.Stop readingnow,anddothesequickexercisestoentrainyourheartandbrain. QuickCoherence:TheRhythmoftheHeart HeartMath HeartFocus:Shiftyourattentiontotheareaofyourheartandbreatheslowly anddeeply. HeartBreathing:Keepyourfocusintheheartbygentlybreathingbig breaths5secondsinand5secondsout.Pretendtobreathethroughtheareaof yourheart.Dotwoorthreetimes.
120

Sincere,positivefeelingstateslikeappreciationcanresultinhighlyordered andcoherentheartratevariabilitypatterns,generallyassociatedwith enhancedcardiovascularfunction.Whatshappeningisthatthetwobranches oftheautonomicnervoussystemare"entraining"andworkingtogetherat maximumefficiencyinsteadoffightingeachother.Thinkofentrainmentas beinginsync.Whenyourheadandheart,thoughtsandfeelings,areworking harmoniouslytogether,youhavemoreclarityandinnerbalanceandyoufeel better.

Thinkofatleastfivethingsthatyoufeelgratefulfor.Noticehowyourbodysoftensand yourheartandmindcalms.Thinkofyourhappyplace.Focusonthepositiveinyour lifetogetmoreofit! FreezeframeTechnique HeartMath FreezeFrameisaoneminutetechniquethatallowsamajorshiftinperception.More thanpositivethinking,itcreatesadefinitive,heartfeltshiftinhowweviewasituation, anindividualorourselves.Whenyoufeelstressed,stopforaminute: Shiftoutofthehead,andfocusontheareaaroundyourheart.Keepyour attentionthereforatleast10seconds.Continuetobreathenormally. Recallapositivetimeorfeelingyouhadinyourlifetoreexperienceitmentally. Trynottosimplyvisualizethisevent,butratherfeelitfully. Askaquestionfromtheheart:WhatcanIdointhissituationtomakeit different?orWhatcanIdotominimizestress? Listentotheresponseofyourheart.Youmayhearnothing,butperhapsfeel calmer.Youmayreceiveverificationofsomethingyoualreadyknow,oryoumay experienceacompleteperspectiveshift,seeingthecrisisinamorebalanced way.Althoughyoumaynothavecontrolovertheevent,youdohavecontrolover yourperceptionofit. AttitudeBreathingTool HeartMath InAttitudeBreathing,youfocusonyourheartandsolarplexusasyoubreatheintoa positiveattitude.Thesolarplexusistheareaofthethirdchakrawhichcarrieslessons ofbalancingpowerwithothers.Theheartwillautomaticallyharmonizetheenergy betweentheheart,mindandbody,increasingcoherenceandclarity.
121

HeartFeeling:Activateandsustainagenuinefeelingofappreciationorcare forsomeoneorsomethinginyourlife.Focusonthegoodheartfeelingasyou continuebreathingthroughtheareaofyourheart.

Focusontheheartasyoubreathein.Asyoubreatheout,focusonyoursolar plexus.Thesolarplexusislocatedaboutfourinchesbelowtheheart,justbelow thesternumwheretheleftandrightsidesofyourribcagearejoined. Practicebreathinginthroughtheheart,andoutthroughthesolarplexusfor30 secondsormore,tohelpanchoryourenergyandattentionthere.Next,selecta positivefeelingorattitudetobreatheinandoutthroughthosesameareasfor another30seconds(ormore).Forexample,youcanbreatheinthroughthe heart,anattitudeofappreciation;andbreatheoutthroughthesolarplexus,an attitudeofcompassion. Selectattitudestobreathethatwillhelpoffsetthenegativeemotionor imbalanceofthesituationyouarein.Breathedeeplywiththeintentofshifting tothefeelingofthatattitude.Forexample,youcanbreatheinanattitudeof balance,andbreatheoutanattitudeofforgiveness.

Practicedifferentcombinationsofattitudesyouwanttodevelop.Youcantellyourself, breathegenuine,breathecourage,orwhateverattitudeyouwant.Evenifyoucant feeltheshiftatfirst,makinganearnesteffortwillhelpyougettoaneutralstate. HeartLockIn HeartMath HeartLockInhelpsyouexperienceyourheartatadeeperlevelthroughspending moretimeinappreciation.Thisapproachdoesnottrytoproblemsolveorfix somethingbutputsyouinalongercoherentstatesoyoucanseethingsclearly. These quick,powerfulHeartMathexercisescanbedoneseveraltimesdailytoimprove physical,mental,emotionalhealth,reducestressandmaximizecreativity! Shiftyourattentionawayfromyourmind,andfocusonyourheart. Rememberthefeelingofloveorcareyouhaveforsomeonewhomitseasyfor youtolove.Trytostaywiththatfeelingforfiveto15minutes. Gentlysendthatfeelingofloveorappreciationtoyourselfandothers.In15 minutes,aHeartLockIncanprovidephysical,mentalandspiritual regenerationasyougiveyourselfthegiftoftappingintoastateofloveand creatingoxytocinandothergoodbrainchemicals.
122

123

TheancientwisdomofTaoismspeaksoftheconceptofachievingaconsciousnessof nodualityorseparation.Muchofthesufferinginlifecomesfrombeliefsthatweare separate.InEsotericwisdomallextremesofemotionsflowoutofourperceptionof duality.Unhappinessandanxietyresultfromthenonacceptanceofthenegative aspectsoflifesexperiences. Dualityperceptiondivideseverythingintopolaroppositesthatthenmustbe judgedthatthereisharmornoharm.Thissetsupadualistictensioninthe body/mind/spirit.JungstudiedtheTaosconceptsofseparationandstatedthat humanneedshavefashionedmostconceptsintodichotomies: Man'sreallifeconsistsofacomplexityofinexorableoppositesdayand night,birthanddeath,happinessandmisery,goodandevil.Wearenoteven surethatonewillprevailagainsttheother,thatgoodwillovercomeevil,or joydefeatpain.Lifeisabattleground.Italwayshasbeenandalwayswillbe; andifitwerenotso,existencewouldcometoanend.TheTaospeaksofa placeofpeaceofachievingaconsciousnessofnodualityorseparation. Emotionalhealingresultseverytimeweshiftapartofthepolarizedthinking. Thehealingofnegativefeelings,thoughtsandjudgmentstakeusoutofthe senseofbeingseparatefromothers,fromourownspiritualnatureandthat whichweperceiveasGod. Dualisticthinkingcausespsychicconflictbetweentheaware,consciousmindand therepressedsubconsciousmindwhichifbroughtintoyourawarenesscanbring theenergynecessaryforchange.Dynamicpolaritiessuchaspassivityversuspain, lifeversusdeathforce,selfversusouterworldandloveversushateexistas conflictualenergywithinthepersonality.
124

Emptyyourselfofeverything. Letthemindrestatpeace. ThetenthousandthingsriseandfallwhiletheSelfwatchestheirreturn. Theygrowandflourishandthenreturntothesource. Returningtothesourceisstillness,whichisthewayofnature. LaoTse

Chapter16 BalancingthePolarOpposites

TheTyrannytoSeparatistThoughts

Thebeliefsthatweareseparatefromthetotalunityandthatwecanbeharmedare partofsuffering.Thewordseparatemeanstodestroytheconnection;tobecome detachedfrom;tooccupyapositionbetweenandtokeepapart.Italsomeansto alienate,detach,disengage,disjoin,disunite,divide,part,remove,sever,split, sunderorwithdraw.Separationistheprocessofdivisionorthestateofbeing disconnected.Believingoneselftobeseparateisanillusionfosteredbythe either/orpolarizedthinkingofourtime."Allsufferingiscausedbyanillusionof separateness,whichgeneratesfearandselfhatredwhicheventuallycausesillness, saidBarbaraBrennanauthorofHandsofLight. InthePaliCanonscriptures,theBuddhaexhortedhisfollowerstoreleasetheir attachmentstocravings,materialobjectsandfalseidentityideas.DidtheBuddha predicttheendtimesthroughdestructioninthistranslationorisheusinga metaphor?Ishesayingthatthisearthlyexistenceisnotpermanentsoprepare yourselfbyaddressingattachmentsandaddictiveneeds? Therecomesatime,monks,whenthegreatseadriesupandevaporatesand nolongerexists,butstill,Isay,thereisnotmakingofsufferingforthose beingsroamingandwanderingabouthinderedbyignoranceandfetteredby craving.Therecomesatime,monks,whenthegreatearthburnsupand perishesandnolongerexists,butIsay,thereisnotmakinganendofsuffering forthosebeingsroamingandwanderingonhinderedbyignoranceand fetteredbycraving.


125

AccordingtotheBuddhistphilosophy,alllifeissuffering.OnethingIteach,is sufferingandthereleasefromsuffering,saidtheBuddha.TheFirstNobleTruththe Buddhatellsusisthatallexistenceissuffering.Sorrowhasacauseandthecause canbeended.TheSecondTruthisthatcravingscausethepain.Feelingsand perceptionsoftheegopropelustowanttopossessdesirableobjectsandpersonal attributes.Egocentrism,desire,blindnessandhatredfantheflameofcraving, keepingusinaconstantstateofunrest. Buddhistsbelievethatitisattachmenttotheeightworlddharmasthatcreates suffering.Fourpairsofoppositesmakeuptheeightworldlydharmas: Pleasure/pain,gain/loss,fame/disgrace,andpraise/blame.Weputouremphasison gettingpleasure,gain,fameandpraisewhichfeelgoodandthusavoidthenegative poles. Sufferingisdifferentfrompain.Painisthephysicalsensationsinthebodyandbrain fromassaulttothebody.Sufferingisofthemindgeneratedbyourbeliefs.Weall haveattachmenttofeelingsofloss,grief,betrayalandfeelingabandoned.Suffering isoftheegoseeingthelackinthelifeandwantingsomething.TheBuddhataught thatwearebornandwesuffer.Weliveandwesuffer.Wedieandwesuffer.Toget ridofsuffering,letgoofattachment.Releaseallattachmenttothingsthatarenotof thegreaterSelf. TheBuddhatoldusthatitisthenatureofhumanbeingstobeaddicted.Thehuman conditionistoclingandtoattachwewanttofeelpleasureandavoidpain.We attachtothosesubstances,thingsandexperiencesthatmakeusfeelgood.Weseek theendorphinrushthatcomeswithpleasure.Weclingtothepositivethingsto avoidfeelingtheinnerdeeppainandshamethathideswithintheShadow.We attachtoformertimesandrelationshipsthatbringusasenseofnostalgiaand happiness. Wedesirethosefeelingsthatcreatetheahhhrelaxationofthebodyandmind.Over attachmenttothefeelingsofhappinessandpastlove(positivearousalwhich stimulatestheendorphinsandincreasesselfesteem)canalsokeepindividualsfrom movingforward.TheseegodesiresarebasedongainingpleasuretheIwantto feelgood!Livinginthepast,nostalgiaandattachmenttohappyfeelingsthat accompaniedasimplertimeinlifecanariseduringtimesofstress.Attachmentto fame,fortuneandbeingseenasspecialintheeyesofothersareotheregotraps

SufferingEqualsAttachment

126

Wesufferbecausewefeelincompleteandlackinginsomeway.Muchofthe confusioninourlivesistheinterplaybetweenegofears,attachmentsanddesireand thewill.Sufferingcomesoutofignoranceandholdingontoacertainperspective. Thetrapisdesireandattachmentineitherwantingsomethingorwantingtoberid ofit.Insuffering,weareseparatedfromsomethingthatisvalued.Itmaybealoved onewhoisnolongerwithus,health,orpossessions.Theseexternallackingsreflect theseparatenesswefeelinternally.Unityiswhatweseektoachieve;sufferingisan opportunitytoachievethishealing.MysticAldousHuxleyexpandedonthisthemeof movingthoughtheattachmenttotheideasofseparationandsuffering: Thecapacitytosufferariseswherethereisimperfection,disunity,and separationfromanembracingtotality;andthecapacityisactualizedtothe extentthatimperfection,disunityandseparatenessareaccompaniedbyan urgetowardstheintensificationofthecreativeconditions.Fortheindividual whoachievesunitywithinhisownorganismandunionwiththedivine Ground,thereisanendofsuffering. Wearestuckwithourtraumasfromthepastbecausewedonotknowhowto releasetheenergiesthatsurroundthem.Fearbindsenergyinanunusablestateand robstheindividualofenergythatcouldbeusedforjoyfulliving.Addictions,self centeredthoughts,quarrelingandworryingoverissuescausepersonalenergytobe boundup.Rejectionsetsupanenergyfieldofitsown.Fearofabandonmentandof beingalonekeepusinsituationsandemotionalstatesthatarepainfultobear. Judgingoneselfandothersandbeingindecisiveorclingingtoonedesired expectationforanoutcomefostersastateofdisequilibrium.Emotionalbaggageleft unresolvedcreatespsychicconflictbetweentherepressed,subconsciousmindand theaware,consciousmind. AttachingtotheStoryofVictimhood Whenthreat,stressorsandtraumastrike,itcanbeveryeasytoseeourselvesasthe VictimofAllTimes.Thisunfortunatemindsetisattachmenttothetraumaand dramaIamavictimorIamthevictimofalltimesbecauseIvesufferedgreatly. Thebuildingupoftheselfastheleadingcharacterinatragedyplaycanplace misguidedemphasisonthemelodramatic.Castinthehelplessrole,weareseparate. Thetragedymayberelatedtothefalsebeliefthatitisprestigioustohavesomething seriouslywronginoneslife.Somepeopledefinethemselvesonlyintermsofthe currentcrisisintheirlife.Theremaybesecondarygainsofgarneringattentionfrom othersasyourepeatyourwoes.
127

Victimwordsrelatedtotheharrowingfeelingsofhelplessnesssuchascant, impossible,never,andunableshowthelimitsthepersonplacesonhimself.By acceptingthepassiveviewofhelplessness,thepersonsworldisdistortedwith conflictbuildingupandchoicesbecomelimited.Thestoryofincompetenceand passivitycanbecomeyouridentity.Thefearsandtearsfunctiontodistractfromthe truejourneyoffindingtheTrueSelf.Andyetitisinsufferingwherewegainthe mostdepthofunderstanding.Welearnthroughourpain.AphrasefromtheGreek playAgamemnon,describesthispatheimathosmeanslearningbythemeansof suffering. Challengingthejudgmentsofthecriticalegoanditsattachmentsisanongoing process.Togooutsideofpolarityistoreleasetheneedtojudgeorwantanything. Movingthroughoutattachmentstogainourtruthispartofthespiritualpath. Healingissuppressedwhenyouareinthoseegostatesofsuperiorityorinferiority whicharetunedintofieldsoffear.PsychotherapistCherylCookasks,Whatfields areyoutunedto?Youcantunetothosemiraculousarchetypicalfieldsofhealing. Withanopenheartandgoodintention,youcanasktostepbackfromyour attachmenttoyourstory.Hereisherexerciseongainingaperspectiveon addressingthemenotmepolaropposite: InnerFocus:OpeningtoSpaciousness CherylCook Oftenwhatweattachtoarestoriesaboutourselvesthatcreatesaconstrictionof thinking.Youcanopenyourmindtoagenerositythatgoesbeyondfearwhichalways contractsnotonlythemindbutalsotheenergyfield.Thespaciousnessoftheheartis inclusivewantingonlythebestforyou. Thinkofastoryaboutyourlifethatyoutellyourselfthatsmacksoflimitation.Justfor amoment,focusonyourattachmentto: THEbody THEbodysensations THEmind THEthought THEfeeling THEego THEstoryyoutellyourself
128

Learntodistinguishbetweenyourstoryaboutwhatyoutellyourselfandwhoyou trulyareasaspiritualbeing.Chooseoneoftheabove(body,bodysensations,mind, thought,feeling,egoorstory)andinsertitinthisexercise.Chooseadifferentaspectto focusoneachtimeyoudothispractice. WhatdoyounoticeinTHE(body,bodysensations,mind,thought,feeling,egoor story)? MeetTHE(body,bodysensations,mind,thought,feeling,egoorstory)without judgmentoropinion. MeetTHE(body,bodysensations,mind,thought,feeling,egoorstory)withopen curiosity. MeetTHE(body,bodysensations,mind,thought,feeling,egoorstory)withgreat kindnessandcompassion. Ifyouthinkthisishardtodo,meetthatthoughtofitbeinghardtodowithopen curiosityandgreatkindness. Openintospaciousness.Breatheintocuriosityandgreatkindness.Whatdoyounotice? Allowashift.Notethatshiftwithopencuriosityanddeepgratitude. Tellyourself,IamnotTHE(body,bodysensations,mind,thought,feeling,ego,story). Ivea_____butIamnotTHE_____.Iammuch,much,morethanthe_____. Openintogratitudeanddeepcompassion.ThankTHE(body,bodysensations,mind, thought,feeling,ego,story).Takeadeepbreath.StepbackfromTHE(body,body sensations,mind,thought,feeling,ego,story).NoteyouarenotTHE(body,body sensations,mind,thought,feeling,ego,story). AllowsomespaceinTHE(body,bodysensations,mind,thought,feeling,ego,story). Allowwithopencuriosityanddeepgratitude.Justforamomentbethistimeof StillnessasyouallowSpaciousnessinbeingmorethanthe_____. AwaketothemomentofStillness.AllowStillness.

BecomingtheNeutralObserver

Clingingtotheideathatwehavebeenorarebeingharmedinsomewayresultsin neuroticbehaviorsandreactivedefensemechanisms.Wearesometimestooclose toourproblemstobeabletoseethemobjectively.Theegoinvestswaytoomuch


129

energyinthem.Observingsomethingimpartiallyfromadifferentvantagepointcan changetheperceptionofhowyouseeit. YouengagetheObserverEffectwhenyoustepoutoftheegotoalteryour perceptionsoftheproblem.Takewhatupsetsyoutoaneutralposition.Trythis stepbackapproachofjustviewingyouremotionsinsteadofreactingtothem. Visualizethesituationthatbothersyouandmoveawayemotionallyfromit.Then taketwogiantstepsbackwhereyousimplywatchobjectively. SteppingBackBehindYourMind Gotoaplacebehindyourmind.Feelyourselfpullingbackuntilyouarelookingat thingsfrombehindyourmind.Disengagefromyourfeelingsandobservetheaction withamildcuriosity.Ifafearcomesup,justwatchhowitshutsyoudownortakesyou intohostilethoughtsthatkeepyoufrominterpretingsituationscorrectly. Observeanydefensesthatarisethatmakeyouwanttolashoutinanger,pullbackin confusionorstewinselfrighteousness.Observingandexperiencinganemotion insteadofreactinginstantlytodefendyourselfgivesyoutimetoregainyour composurewhenyoufeelathreat.Slowingdownthathairtriggerresponsegivesyou morepersonalpowerbyhelpingstophabitualdefensepatterns. Stepawayfromyourattachments,MaamorSir.Juststepaway! Putasituationthatdisturbsyourmindonalargepicturescreen.Youarethewriter, directorandactorofastoryabouthowyouangerorfrightenyourself.Giveyourmovie aname.Sitwatchingthepicturefromthefrontofthetheaterasthestoryunfolds. Breathedeeplyandwatchquietlywithoutemotion.Thentakeanotherpartofyourself tositinthemiddleofthetheaterthatwatchesthepartofyouthatgoestositinfront watchingthepictureonthescreen.Thentakeanotherpartofyouthatsitsintheback ofthetheaterthatobservesyouinthemiddlewatchingyouinthefrontstudyingyou onthescreen.Takeanotherpartofyouthatsitsinthebalconywatchingyouinthe backofthetheaterwatchingyouinthemiddlewatchingyouinthefrontwatchingyou onthescreen. Feelthedetachmentanddissociationasyoumovebackfromtheintensityand emotionalityofthesituation.Rememberthatasthewriter,youcanchangethescript anytime;choosetorewritetheendingintoahappierone.Seeyourcharacterinthe moviegrowingandchangingthroughobservinginsteadofdefensivereactingto threateningevents.
130

Theillusionoftheydidthistome,thereforeIamdevaluedandmustlivemylife beinglessthanwhoIambecomesbroken.Youcanstarttorememberwhathas beenforgottenIamintact.Iamwhole.Whenyourealizetheabsurdityofthe dualitiesofpain/pleasure,right/wrong,good/evil,sick/wellandselfasseparate fromothers,youcanexperienceinterconnectionwithall.Bymovingpasttheneed tomakethingsrightorwrong,youcancometotheplacewheredefensesnolonger serveanypurposeandemergeintothespiritualrealm. ThemysticpoetKabirsaid,Betweenthepolesoftheconsciousandunconscious mind,therehasthemindmadeaswing.Thereonhangallbeingsandallworlds,and thatswingneverceasesitssway.SothisisnotonlyatimeoftheGreatShift,thisis atimeoftheGreatSwing.Rememberwhatfunitwastojustswingwithabandon whenyouwereachild?Itistimetoreturntothechildlikestateofknowingand joyfullyswinging.

131

Chapter17 TuningintotheChristConsciousnessHealing
HehealeththebrokeninheartHetelleththenumberofthestars. Psalm147:3,4

Manypeoplearerespondingatthistimeofgreatchangetotheirsoulgenerated urgingforchangetotheChristConsciousnessenergythatsurroundsourplanet.The ChristConsciousnessisafeminine,compassionateenergybeingbroughtintoour planetbytheHigherForcesofLoveandLight.Itisheretoassistourevolutionand growthasithaspersonalloveforallhumankindandishelpingtotransformour planet. Christiancontemplationhasbeenatimerespectedpracticeforhealingforthose whofeeladeepconnectionwiththehealingpowerofJesusChrist.Christwasa wonderfulmodelofcompassionforthosewhowereinpain.TheChrist Consciousnessenergiesthatarecomingintoourplanetareconsideredtobethe benignvibrationsofloveandacceptancewherehealingcantakeplace.Youhave beengivenpermissiontodogreatworksinHisname.RememberHisimmortal words,"EventheleastamongyoucandoallthatIhavedone,andgreaterthings." ConnectingwiththeChristConsciousness Thinkofanegativeemotionorbeliefyouwishtoheal.Bringthepalmsofyourhands togetherrubbingthemgently.Focusonthewarmthofyourpalms.Allowthewarmth toincrease.Placeyourhandsonyourheartasyouthinkofthegreatcompassionof Christ. ConnectnowwithyourInnerHealerwhichisconnectedtotheChristConsciousness spiritthatpartofyouthatseekshealthandwholenesstoactivatethosehealing forcesthatarewithinyou.Seeandfeelacolorthatrepresentsthehealingenergyto youandpictureaspiritualimageofJesusorMarythathasmeaningforyou.Breathe intothecolorandletitgrow.Surroundtheentireareaofyourbodywiththatcolor. Allowthathealingenergytosinkdeeplyintothatrootcauseofyourproblem. Breathedeeplyasyouaskthattherootcauseofyouremotionaldiscomfortbereached. Thinkdeeplyonwhatyouwanttohavehappenwiththenegativeemotion.Feelwhat
132

youreallywant,whatyoulongformostofall.Focusallofyourattentiononthat longingtobewholeandwell.AskGodtoreleaseyoufromthatoriginofyourproblem. Knowthatwithenergies,thereisalwaysmovement.Nothingstaysthesame.Thereis alwaysmovement.Everythingisinconstantvibration,constantmotionandconstant evolution.Visualizeyournegativeemotionsinmotionandallowthattheywantto move. Forgivenesscantaketheplaceofanylimitingthoughtorfearthatyoumayhaveheld. Feelyourselfsurroundedinlovingforgiveness.Ifyouareupsetwithsomeone,askto holdtheminlovingkindnessandcompassion.Whenyouforgive,youreleaseyour separatesenseofselfinthatmoment.Lovebidsusreleaseourselfjudgmentsand thoseprojectedoutonothers. Thinkaboutotherspiritualhealingsyouhavehadandhowyourfaithhashelpedyou inthepast.Recollectthevibrationoffeelingaliveandvibrant.Surrendernow. Surrendertoloveandasktoletgoofthatwhichyounolongerneedtokeep.Feel deeplytheconnectiontoyoursoulasyoutouchintodeepsurrender.Surrendertothe healingenergiesoftheChristConsciousness.BeawareofhowtheHolySpiritis workingthroughyou. Nowgotothatholyspaceofgratitude.ThankyourInnerHealerforitsassistanceand beingthereforyou.Focusonappreciationandjoyforhealthandfeelingsofwellbeing. ContemplateontheBibleverseofJohn1:9:ThatwasthetrueLight,whichlighteth everymanthatcomethintotheworld.Giveyourselfallofthetimeyouneedtosink fullyintogratitudeandcelebration.TheChristConsciousnessisalwaysthereforyou. Allyouneedtodoistostopandtune,tostopandaskthatitworkdeepwithinyou. BecomingPureofHeart Healingoftheprogrammedegobeliefs,feelingsandunhealthycopingchoicesisnot adestination;itisacontinualjourneyofthesoulwhichseeksjoining,connection andunion.Themeasureofprogressisyourbecomingmorecontented,aliveand morepresentasyouprogressinyourjourney.Delusionalthoughtsbecomeeasierto budge.Afflictiveemotionsholdlesspower.Selfcenterednessdecreasesanddaily decisionstolivewithmoralbehaviorandhighintegritybecomesapriority. Kindnessabounds.ThisisthecompassionofChristConsciousnessandthosehigher vibratoryenergiesthatareflowingintoourplanet.

133

MakingourheartpurehelpsprepareforAscension.Thesepracticaldailychoices havehelpedmethemostasIconnectinwiththosespiritualforcesthatguidemy development. (1.) Usingtheenergypsychologytechniquestochallengenegativethoughts andcleanoutthoseselfcentered,narcissisticwaysofthinkingandacting producedbytheegoself.Catchingmyselfishthoughtsandinterrupting themtimeandtimeagainhashelpedmebecomeabetterperson.Wecan stretchandgrowwhenweacceptthechallengesinourrelationshipsand vowtobecomeamorelovingperson. (2.) UsingtheHeartMathideasandfocusingongratitude,loveandappreciation forwhatIvebeengivenandwhatIveexperienced. (3.) FocusingonthecompassionastaughtbytheBuddhistconceptofloving kindnessandastheChristtaught. (4.) Makingthedailydecisiontobekind,lovingandgenerous.Makingthis decisionoverandoveragainespeciallywhenImfeelingoverwhelmedor crosswithsomeoneormyself. Experiencinglovemanytimesadayisameanstogoingbacktothespontaneityand freedomthatyouexperiencedbeforeyouregoicdefensesdeveloped.Thechoiceto becomeOneHeartedisadecisiontomakeoverandoveragain.

134

Thelightofthebodyistheeye;iftherefore,thineeyebesingle,thywholebodyshallbeoflight. Matthew6:22

Chapter18 IlluminationandtheAscensionProcess

Wearebeingsofthelight.Hiddenawayinancientspiritualtraditionsarenumerous referencesandpracticesregardingbecomingilluminatedwhichmeanstolightup andbesuppliedwithlight.Theprocessofbecomingenlightenedisthedropping awayofegoandofignorancetobecomefilledwithlight.IntheAnalytical ConcordancetotheBible,alistingandcountingof311,000referencesofitstopic contents,thereareovertwohundredandfiftylistingsonthewordlight. Ascensionreferstotheactofmovinguptoahigherlevelwhichmanyofthehuman raceareundergoingatthistime.AnthropologistMirceaEliadestudiedmany indigenousculturesandconcludedthatascensionwasacommonarchetype: Whateverthereligiouscontextandwhatevertheparticularformtheymaytake (shamanisticorimitation,mysticecstasy,dreamvision,heroiclegend)ascensionsof allkinds,suchasclimbingmountainsorstairsorsoaringupwardsthroughtheair, alwayssignifythatthehumanconditionisbeingtranscendedandthathigher cosmiclevelsarebeingattained.Visionsgivesymbolsandmetaphorstoimparta sourceofknowledgeandmeaningfulnesstowhichwecanaspire. Intheseventeenthcentury,theFrenchopticalscientistReneDescartesdrewfrom ideasfromtheancientGreekswhodescribedthepinealglandastheseatofthe soul.Thepinealisabioluminescentorganthatholdsphotoreceptorcellstoreceive lightandhasthecapacityforbiophotonemission.Thisilluminationisshownbythe shininglightthatemanatesfromsaintlypeople.Repeatedspiritualawakening exercisesboostsserotoninandactivatesabright,innerlightintheThirdEyeand thebrowchakra.Figurativelyandliterallypeopledrawntotheprocessofascension arebeingcalledbytheirsoultoriseaboveoneself,tobecometransparentand lightenup!

135


ThePinealGlandandtheThirdEyeCenter

ThePinealGlandandtheThirdEye

Thepinealglandisdescribedasthepointatwhichthemindandbodyare connected.Theglandispeasizeandisshapedlikeapineconethatislocatedinthe centerofthebrainbetweenboththeleftandrighthemispheres.Itsnocoincidence thatitissurroundedbythelimbicsystem,amajoremotionalareaofthebrain. ScientistRobertBeckstatedthatthepinealglandistunedintothemagneticnorthto giveusasenseofdirection.


136

TheTaoistscalledtheareaofthebrainbetweenthepinealandthepituitary"the CrystalPalace."Thepinealisacrystallizedstructurethatrespondstolightandto darkness.Itreleasestheimportanthormonemelatonin,thehormoneofdarkness toregulatesleepandwakepatterns,moodandgrowthdevelopmentandcontrols therhythmsofthebody.Melatoninproductionisstimulatedbydarknessand inhibitedbylight.Sleepinginapitchblackroomisrecommendedtoachieve maximummelatoninproduction. Babiesandchildrenhavelesscalciumintheirpinealglands.Aroundpuberty,the pinealcalcifiesanddiminishesasdoessomeoftheinnocenceandchildhoods creativeimaginationandplayfulness.Shrinkageandcalcificationinthepinealgland insomeskullxrayshasbeenlinkedtoaging.AccordingtoDr.BhagatSinghThind, thepinealglandgetsgummedupinoldageandstimulatingithelpswith constructivethinkingandinnerreflection.Headded,Avitalbodyneedsthisvital gland. Melchizedeksaysthatourpinealglandshaveatrophiedastheyhavenotbeenused effectivelyfor13,000years.ThepinealglandisconnectedtotheThirdEyeorthe BrowChakraCenterwhichhasbeencalledTheSubtleEyeofInsightmakingita vehicleforachievingenlightenment.Awakeningofthisglandhasbeenlinkedby manyspiritualtraditionstocreativityandtoseeingbeyondtimeandspace, prophecyandincreasedpsychicawareness. Theancientmysteryschoolstaughtthatthepinealistheconnectinglinkbetween thephysicalandspiritualworlds;someconnectittotheTreeofLife.IntheBible, JacobsaysinGenesis32:30,"IhaveseenGodfacetofaceandIwillcalltheplace Peniel."HinduyogisconsidertheThirdEyeaportaltotheHigherSelfcallingitthe CrystalChamber,theEyeofKnowledge,theThousandPedaledLotus,theCaveof BrahmanandtheHouseofGod.ThemetaphoroftheopeningoftheThirdEyeisa journeyintoluminance. Someancientspiritualliteratureexplainsthatthesubstancesecretedbythepineal grantsalonglife.Someancientalchemyteachingsalludethatthispinealsecretionis partoftheformulafortransformationofthebasemetalintogoldandthebaser aspectsofthehumanintospiritualawakeningwiththegoldoftheilluminationofa thousandsuns. SeveralauthorsincludingE.C.ChaneyinTheBirthoftheThirdEyerelatehealing abilitytochakradevelopmentofthehealer.OnceadisciplestimulatestheThird Eye,heautomaticallybecomesahealer..Hecancreateatremendouspowerwhich, flowingfromhisbrowintothehandsandonoutward,alonganethericcordtoreach
137

thepatient,caneffectamiraculousandinstantaneoushealing.Thismayberelated tothevibratorypoweremittedfromthebrowchakrainthosewhoarehighly developedspiritually. Caution!PinealActivationToolsareDangeroustotheEgo Illuminatingthepinealglandtoraisethefrequencyofyourvibrationhelpsspeedup theascensionprocess.Thissixthchakraorbrowchakraisthoughttobetheseatof theChristConsciousness.Itsactivationnegatestheegoscorebeliefsof unworthinessandbeingunlovableandhelpsintegratethefragmentedselves.It enhanceshumility,clearvision,saintlinessandthewishtoserveothers.Thesixth chakraisalsoassociatedwithincreasedintelligence,insight,mentalclarity,wisdom, extrasensoryperception,deepdreamingandclairvoyance. Repeatedspirituallyawakeningexercisescanhelpawakenthehormonesofthe glandsofthebodyandthechakras.Naturalmethodstostimulateandenlargethe pinealincludetimehonoredspiritualpracticessuchascontemplation,meditation, visualization,deeprepetitiveprayer,mantrasandbreathingwhilefocusingonthe gland.Extremesofstressfulsituationsthatcauseshocktothebodycansometimes triggerchangesforthespontaneousopeningofthechakra. Spiritualdevelopmentisongoingandasaprocessitshouldnotbeforced.Doyour spiritualhomeworkandaddressyouregoicdefensesbeforetryingtocoercethe pinealglandtoopen.Toorapidopeningsbeforeyouarespirituallypreparedcanbe devastatingand,accordingtotheTranspersonalPsychologyliterature,caneven driveyoumad.Sowiththatdirewarninginmind,travelforwardatyourownrisk. PinealstimulationmethodsgivenbydifferenttraditionstofloodtheThirdEyewith lightinclude: Lyingdownwithaquartzcrystalonthecenterofyourforeheadwhile visualizingspiritualenergycominginasyoumeditateonthevibrationof thecrystal.Clearwhitelightandvioletarethecolorsrepresentedwiththe Crownchakra.Purpleorbluecrystalsarealsorecommendedsuchas amethyst,lapislazuli,sodaliteorsugaliteasthecolorsvioletandindigo blueareassociatedwiththeThirdEyechakra.Alternately,youcanask yourintuitionwhichcolorofgemstoneisvibrationallybestforyou. MeditatingontheThirdEyeopeningwhileusingaromatherapyoils suchasFrankincense,Myrrh,Sage,Mint,JasmineandLavender,long

138

associatedwithdifferentspiritualtraditions.Oraskyourintuitionto chooseanaromatherapyoiltoassistyou. Listeningtoandvibratingwithharmonicsoundssuchascrystalbowls, andovertoning,activatestheautonomicnervoussystemwhichregulates bodyfunctionssuchastheheartrate,gastricanddigestivereactions, stimulatesthechakrasandbalancestheglandsandorgansinthebody.The theoryisthattoningcounteractsoutofsynchvibrationsinthebrain.The sacredsoundsassociatedwiththebrowcenterareAUMorOM. Squeezingtheinsidesofthebigtoesstimulatesthepinealglandwhile pushinghardontheballofthebigtoestimulatesthepituitaryglandas taughtinReflexologytrainings. RepeatedlayingonofhandsapproachessuchasReiki,Therapeutic Touch,HealingTouchandCranialSacralWorkcreatecalmingbrainstates. Doingdeeprepetitive,abdominalbreathingcreatesalphaswavesand hyperventilationandincreasedoxygeninthebrain.TheBreathofFire exerciseandotheryogicortantrictoolsteachthismethod. SpinningandwhirlingasdonebytheSufiWhirlingDervishesofthe MevleviorderandtheTibetanmonksstimulatethepinealandpituitary glandstoopentodeepstatesofconsciousness.ThepopularbookbyPeter Kelder,TheTibetanFiveRites,describesdailyspinningasoneofthefive ritestostimulatethepinealandthechakrasforoptimumhealth. CarlJungdrewandmeditatedonmandalasseeingthemasrepresenting thesymboliccenteroftheSelf.Themandala,foundinallancientcultures, andotheresotericsymbolsareusedformeditationbythealchemistto internalizetheunconsciousarchetypicalmeaningsbehindthem.Jungdrew artworkinhisjournalsincludingintricatemandalaswhichhefeltwould facilitateopeningtheThirdEyeandacceleratehisspiritualjourney.Draw yourownmandalaormeditateonJungsmandalaoftheThirdEye ThousandPetaledLotusfromhisRedBookJournal. Andwhatslowstheprocessofspiritualdevelopmentdown?Addictivesubstances suchasalcohol,prescriptionandstreetdrugsandexcessivesugar,meat,refined foodandfastfooddietswithpreservativescontributetotheatrophyofthepineal gland.Lackofinterestinspiritualdevelopmentorfocusingonthedogmaofa religion(manmadelaws)asopposedtofindingadirectconnectiontoyoursenseof
139

thedivinealsocankeeptheglandinanatrophiedcondition.Somewritersbelieve thatfluorideisdetrimentaltothehealthyfunctioningofthepineal. DMT:TheSpiritMolecule TheglandalsoproducesotherlifeenhancingchemicalscalledDMT,harmineand pinoline.Buddhistpsychiatristandresearcheronpsychedelicsubstances,Rick Strassman,MD,wroteabookcalledDMT,TheSpiritMolecule.DMT (Dimethyltryhptamine)isapowerfulneurotransmittermadebythepinealgland andbraintissues,cerebrospinalfluid,lungsandredbloodcells.Strassmantiesthe productionofDMTinthepinealglandtomomentsofhighintensity:birth,death, neardeath,highfevers,prolongedmeditation,sensorydeprivationandmystical experiences.DMTisalsoanaturallyoccurringchemicalmadeincertainplants whichwhenimbibedcausevisionsandhallucinations. StrassmanexplainsthatDMTisachemicalcarrierwithreceptorsinthehuman brainthatcanbeusedasatooltotakeustohigherstatesofconsciousnessand otherrealmsofexistencetocommunicatewithotherformsofconsciousness includingplants,primordialandarchetypicalimages,geometricshapesandother beings.HespeculatesthatDMTisakindofchemicalinterfacethatreleases serotoninandothermoodelevatingmoleculestoopenthemind'seyetorealitiesof otherworldsmakingitaportaltootherdimensions.Inthisstateofheightened consciousness,apersonsspiritcanleavethisearthlyexistenceandpassthroughto otherrealms.UndertheinfluenceofDMTtherecanbeadissolutionoftheego allowingforatranscendentsenseofUnity.TerenceMcKenna,whospenthislifetime researchingandwritingaboutmanypsychedelicdrugs,calledDMTtheegocrusher ofchoice. Thehormoneharmineisamildantidepressantwhichprotectsagainstgamma radiationthatconstantlybombardsouratmosphere.Pinolineisapotentialfree radicalscavengerinthebrainthatprotectsagainstoxidativedamageandsevere neurologicaldiseasessuchasParkinsonsandAlzheimersdisease.Inadditiontoits antioxidantqualities,itisanantifungalandantibacterialandfunctionsasan antidepressant,affectingbrainreceptorswhichreleaseserotonin. Likemelatonin,pinolineisproducedduringdarkness.Lackoftheseimportant hormonesdisturbsthecircadianrhythmsresultingindepression.Onescientist calledpinolineadooropenertohigherbraincorticalfunctioningindicatingthatit increasesbrainfunctionfromourmeasly10%maximumpotentialto40%.
140

Lightisabasicunderlyingprinciplethatbringsforthorderfromchaosaccordingto alchemicalsymbolsandshamaniclore.Pinolineresonateswith8hertzpersecond whichisThepulsetheDNAusestoreplicate.Severalresearchershaveshownthat thehandsofhealersemitthiswaveentrainmentat8hertz(Hz)levels. Coherentheartrhythmsareencouragedthroughmaintainingthecircadianrhythms, meditationandfocusingoncompassionateloveenhancingthepinealgland. Accordingtoresearchersinthefield,cardiorhythmsofcoherencearesimpatico withalphabrainwaveentrainmentof8Hertz.HeartMathresearchshowsthat twentyminutesspentcontemplatingcompassioncreatesacardiorhythmwhich induces8HertzlevelsinthebrainwhichelevatedthemotherhormoneDHEAto moreyouthfullevels.Extendedmeditationalsoswitchesonthepituitarygland.The suppositionisthatjoiningtheessenceswithinthepituitaryandpinealglandsinthe thirdventricleofthebrainwillopentheThirdEye. Onetheoryisthatthegland'sreleaseofthemoleculesofDMT,penolineand harmineactsasDNAlightreceptorswhichcanpickuplightsignalsfromtheZero PointField.Thehypothesisisthatthesemoleculespickupanduse8Hzwave signalsfromthebodyasanantennadrawingforththeresonantelectromagnetic frequenciesoftheearthtocombinewiththeUniversalLifeenergieswhichcarry requiredinformationforhealing.The8HzsignalstheDNAtocorrectgenedamage andtoreplicate. Kundalini:TheThreeFootJourneyfromAscenttoEnlightenment

Kundaliniisbestdescribedastheenergyofournaturalphysicalbeingnessthe lifeenergyofeachcellofthephysicalbody.Kundaliniispranaorenergyrisingina
141

spiralfashiontomoveandunifycosmicenergyinthehumanbody.Itisconsidered tobeafemininepsychicenergythatiswithinallpeoplethatawakensasspiritual developmentisachieved.JanaDixon,themajorwriterinthefieldwhohas undergonetwoawakenings,describesitasamixingofthefeminineandmasculine energiesofthebody: Kundaliniisapsychospiritualenergy,theenergyofconsciousness,a concentratedfieldofintelligent,cosmic,invisibleenergyintrinsicandvitalto life.Reputedlybeginninginthebaseofthespinewhenamanorwoman beginstoevolveaswisdom/Presenceisearnedthroughspiritualsurrender. Kundalinihasbeendescribedasliquidfireandliquidlightandisanaspectof Shakti,thedivinefemaleenergyandconsortofShiva.Theultimateoutcomeof kundaliniistheunionofWill(shaktikundalini),Knowledge(pranakundalini) andAction(parakundalini).Theinnerfireisthemostpotentofallforces,for itknowsnolimitsandpenetratesthefabricofspace,matterandtime. Thereareimpuritiesandblockagesintheglandsandchakraswhichhaveresulted fromoldtraumas.Thesetoxinsandblockagesbecomeburnedawaybythe oscillatingkundalinienergythatflowsupthespinewithanaccompanyingspiritual metamorphosis.Roadblockstothekundaliniflowareheldinthechakrasandastral bodywhichcarriestheemotionalandmentalconditioning.Thesebarriershavekept usfromconnectingwithourdeepestsenseofself,withothersandour multidimensionalaspects.Therisingofkundalinibreaksthroughknotsinthe chakrasorspinalcolumnthatcontainandrestricttheflowfrommovingupwardto reachthethreehigherchakras.Ofcourse,thefewertheblockages,theeasiertime thepersonwillhavewhenthekundalinistartstoflow. Asthekundaliniascends,itstimulatestheendocrineglandsincludingthepineal whichreleasesDMTandotherhormones.Itactivatesboththesympatheticand parasympatheticnervoussystems,oxytocin,sexualhormones,thyroidand parathyroidwithhyperstimulationofthecardiovascularsystem. Energetically,thisrisingenergyhelpsbreakintothepoweroftheegostructure.The hugetraumahitsinalifethatsignificantlyimpactedtheenergysystem(meridians, chakrasandsubtlebodies)helpedtosolidifytheegostructure.Nowwithkundalini rising,theremaybeperiodsofpurgingtheegorelatedemotionsandthrowingout oldtraumaimprints. Theprocessistiedtotheheartrhythms.ItzakBentov,aCzechoslovakian mechanicalengineer,studiedpeopleundergoingthekundaliniexperiencefroma scientificperspective.Hetheorizedthattheheartaortarhythmpulsationresonates
142

inthebrainandafeedbackloopispulsedthroughtheelectricalandchemical systemsofthebodystimulatingthepleasurecentersinthebrain.Hedescribesthis heartandaortapulsationgivingrisetotheecstasyandblissexperiencereportedby thosewithkundaliniawakenings. NotfortheUnstableorArrogantMind! Kundalinisometimesoccursspontaneouslywithintenseshockstothebodyofheat andcold,duringchildbirth,andduringexperiencesofdangerandevenfallingin love.Thisexperiencehappensmoretosensitive,mysticalpeople.Thisvibrational shiftisusuallyattributedtospiritualworkdoneinotherlivesalthoughitcanbe forcedthroughintensepractices.Thegeneraladvicegivenbymosttraditionsisto awakenthekundalinienergygraduallyandgently.KundaliniYogaisalong practicedHindutraditionofbodypostures,spiritualbreathingpracticesand meditationtechniquestoawakenthekundaliniforce. Warning:artificialkundaliniawakeningshouldnotbeattemptedbytheweakof heartorbypeoplewhohavenotdoneconsiderablespiritualwork.Therearestrong cautionsintheliteratureaboutforcingthekundalinienergyawakeningwithoutthe necessaryspiritualdevelopmenttosupportit.Therecanbeaseriouselectrical overloadtothecentralnervoussystemandresultingseveresymptoms. TheTranspersonalPsychologyliteraturereportsthatsomementallyillpeoplein institutionsmaybemanifestingkundalinisymptoms.Mostpsychiatristsand psychologistsarecluelessaboutthisextremeenergyoverloadcalledtheKundalini Syndrome.Therecanbeserioussymptomsofmoodswings,psychosis, uncontrollableagitation,continuingsexualarousal,depression,anxiety.Forthe spirituallyunready,thisistoomuch,toosoonandallatoncewheresensory informationisamplifiedandconstantchargesofelectricitysurgethroughthebody. Sothekundalinirising,forgoodorillofthoseunpreparedspiritually,isanopening ofpowerfulenergies.Whentheindividualispreparedwithyearsofstudyand devotion,thereisareleaseofthefeminineenergywithin.Thisgetstheflowmoving toallowunresolvedpsychologicalcontentfromtheunconsciousmindtosurfaceto becleansed.SufimasterPuranBairexplains: Thecoiledanddormant'feminine'energyreferstothevastpotentialof psychicenergycontainedwithinusall.Itisnormallysymbolizedasaserpent coiledintothreeandahalfcircles,withitstailinitsmouth,andspiraling aroundthecentralaxis(sacrumorsacredbone)atthebaseofthespine.The
143

Whenthekundalinirisestothecrownorseventhchakra,thereisdetachmentfrom illusionfromthismaterialworldmovingtowardunionwithGod.Thefinalopening oftheThirdEyetakesplaceinthepinealchakraofpureconsciousnessofthe thousandpedaledlotus.Oftenblissisfeltasanopiatesubstanceissecretedfrom thepinealglandduringitsopening. TheWingedSerpentsoftheCaduceusandtheDNADoubleHelix Theparallelsbetweentheancientculturesoftheworldandmodernscienceare fascinatingwhenyoufollowthesymbols.Didtheancientshaveaconceptofthe DNAdoublehelix?Intertwinedserpentsareauniversalarchetypeandthissymbol hasbeenfoundinmanydiversecontinentsandculturesfromtheGreeks,Egyptians andearlySumerianson.Thecaduceus,theancientalchemicalmotifoftwoserpents coilingaroundthestaffofHermes,representsthedoublehelixstructureofourDNA. Itrepresentsthealchemicalconceptsofinterconnectionandevolutionarygrowth: heavenandearthbeingcombined,dualisticopposingforces,ideasofgoodandevil andthecounterbalancingofmasculineandfeminineenergies.Thestaffrepresents thebalancingpowerbetweentheopposingforces:theunionoftheopposites.

imageofcoiling,likeaspring,conveysthesenseofuntappedpotentialenergy thatwillspringintoactionsoon.Fornowwerememberinsmalldoses.The conceptofthisrisingenergycanalsobeexaminedfromastrictly psychologicalperspective.Fromthisperspectivekundalinicanbethoughtof asarichsourceofpsychicorlibidinousenergyinourunconscious.

144

KundaliniandthePhysiciansCaduceus

InTantricBuddhism,thistwistedserpentssymbolrepresentstheforceofkundalini coiledupatthebaseofthespinewhichwillmoveupthespinalcolumnintothe centralnervoussystem.Thetwowingsstandforthedualhemispheresofthebrain. Abovethestaffisasmalldiscorcirclethoughttorepresentthepinealgland. Thecolumnofenergyextendsfromdownintotheearth,throughthebodyand reachestoseveralfeetabovethehead.Energycomesupfromtheearththroughthe bottompartofthecolumntoconnecttothelowerchakras.Thecolumnconnectsto higherdimensionsallowingenergy,lightandinformationtoflowintothebody. TheComplexityoftheAwakeningProcess Thisebookgivesonlyarudimentarydiscussionofthiskundaliniprocess;itisa muchmorecomplicatedprocessonthebiological,physicalandspirituallevels.Jana Dixonhaswrittenanexcellentbook,BiologyofKundalini,muchofwhichshehas postedontheinternetatbiologyofkundalini.comdescribingtheintensityofher awakeningexperiences.Shedescribesherwritingsasascienceandprotocolof spiritualalchemyandgivesthecomplexityofthekundaliniprocessandhowto copewiththeaftermathoftheongoingpowerfulpersonal,mental,emotionaland socialramifications.HeresDixonseloquentandpassionatedescriptionofflowing withtheprocessinsteadoftryingtoresistit: Sincekundaliniistheuniversebecomingmoreconsciousofitself,whenthe miracleofmetamorphosishappenstousweshouldlearntogowithit,not justforourownsalvation,butfortheentiretreeoflife.Everytimeweresort toouraddictionstobackdownfromtherawedgeofourexistenceandfull selfresponseability,themoreweinterfereandresistthespiritualplanfor humanity.Inmetamorphosis,thebodysouldoesmostofthework,including thetransmutationofelements.Allwecanreallydoistogetoutoftheway andjustdoingthattakesallourcourage,allourintelligenceandintuitionand allourrespectandlove.EvolutionjustIs.Halfthebattlewouldalreadybe wonifwejuststoppinggettinginourownway.Totheextentthatwechoose energyincreasingchoicesinanysituationistheextenttowhichwecreate oursoul. Tothealchemists,thismeansembracingthetensionofopposites...the marriageofmatterandspirit,formandEmptinesstheheartofthetantric tradition.Compassionatelyembracingshadowandlightandtheupandthe
145

downoftheTao.Totakethebrakesoff.Tostophidingunderourshellof conformity.Tostoppretendingwearelimitedanddeficient. Spiritualalchemyissoulproddedbutstillwehavetodoourmostnecessarypart toshowup,suitupanddothealchemicalwork.Inneralchemyisaboutchoice;we havetodailyrefusetolivewiththegraspoftheego.Theprocesstrulyisabout surrenderingoursmallsenseofself.Theexercisespresentedinthisbookcanhelp toconfrontthefearbeliefsandembraceboththeshadowandtheSelfuntilwe realizethatweareherenowonearthtobeengagedintheevolutionaryprocessof becomingspirituallyawake.Thetimeforlivinginignoranceispast. Ourevolutionarygoalistobecomeawakesothatwecanconsciouslybehereto assistinplanetarychangeatthisuniquetimeinhistory.Inordertodothis,wemust combattheliethatwehavebeenabandoned.Theconflictandconfusionare abandonmentissuesaboutyourtrueidentitythatcanbeaddressedbychallenging theseemotionsdirectly.Againitcomesdowntopersonalchoiceand determinationyoucancontinuetolivewiththegraveerrorofthinkingthatyou arelackingortoshifttoahighervibrationbeliefthatyouareworthyofloveaspart ofUniversalConsciousness.Dixonexplains: Theoppositeofabandonmentisconsciousincarnation.Kundaliniisthe miracleoflifeitselfquickenedandamplified.Metamorphosismustbemade increasinglyconsciousinordertoreachandstabilizehigherhomeostasisand metaadaptationtospirit.Awakeningorspiritualaccelerationdemands consciousincarnation TheMerKaBaandtheLightbody DrunvaloMelchizedekdescribesthelightbodyorMerKaBaasthecombinationof allyourenergychakras,thecolumnfromthebaseofyourspinalcolumnthat extendsdownthroughatubeintotheearththroughwhichearthenergyrises.The lifeforceenergiesdescendfromtheuniversalenergiesthroughyourchakrastothe meridiansandthecellsandsubtlebodies.Itincludesallthosesacredenergiesthat enfoldyouthattranscendtimeandspace.TheMerKaBaisacounterrotating energeticgridworkoflightandsacredgeometrythatcarriesvibrational informationfromotherdimensions.Itisalivingformthatrequireslovetoremain alive. ThewordMerkabahmeanschariotorascensionvehicleandismentionedfortyfour timesintheOldTestament.Itisavehicleofhigherconsciousnesswhichmerges
146

feminineandmasculineenergiestoassistyourmovementintootherdimensions.It isbothwithinyouandoutsideofyourbodywhichincludesyoursoulenergythat reachesintootherdimensions. MelchezidekteachestheMerKaBameditationwhichactivatesthehuman lightbodybasedonsacredgeometrytoprepareforascending.Thismeditation raisesthefrequencyofapersonslightbodyandcarriestheharmonicsofthe Creationenergies.Itisdescribedinhisbook,TheAncientSecretoftheFlowerofLife, VolumeIIandistaughtalongwithaUnityBreathMeditationwhichconnectsyouin lovetotheearthandplanetaryenergiesinTheFlowerofLightworkshops.These twomeditationsdoneregularlyhelptoprepareusfortranscendenceoutofour thirddimensionalworldtothenextstateofbeing.Melchizedekstatesthatforsome peopletheMerKaBacanbeactivatedbyloveandfaithalone.

TheGeometriesoftheMerKaBaandtheHumanlightbody

AccordingtoMelchizedek,thereareelectricalchargesofpositiveandnegative polaritiesinsidetheheadthatconnecttothepinealgland.Thesebeamsareshown comingforthashalosoflightinRussianicons,picturesofJesusandsaintsandin someHopiKachinas.Hesaysthatunhealthypeoplehaveunconnected,fuzzy electricalchargescreatingfragmentedthinking.Negativeemotionssuchasanger andfearcreateenergeticbeamsthatarechaoticandoutofbalance. MelchizedekexplainsthatloveneedstobepresentfortheMerKaBatobecome alive:LoveistheexactvibrationthatmatterrespondstoThefemaleaspectof lovemustbepresentinlovetobalancethemaleorlifewillnotbe.Hefurther explainstheconnectionbetweentheMerkabaandtheascendingprocess:
147

Thepurposeistogivealloftheinformationandknowledgeofthehuman energyfield,theMerKaBa;themissinginformationaroundthebeamsof lightcomingfromthepinealgland,andtheinstructionsofhowbothofthese humanenergyfieldsareintimatelylinkedtothesacredspaceoftheheart,the placeofcreation.Theplacewhereallnewworldsareborn.Oncethis informationispracticedinunison,anewEarthemergesfromone'sinner vision.Awayofseeingwherethisouterworldthatseemssochaoticand crazy,beginstorecreateitselffromdeepwithinyourownheartbya dreamingprocesslong,longforgotten.Together,wewillremember.Fearwill turntolove.Hopewillemergeoutofdesperation.AndtheWorldcanhavea secondchance,ifonlyyoucareenoughtorevealthetruthofwhoyoureally are.RememberyourintimateconnectiontoGod. UppingtheEvolutionaryAnte

Changesinourindividualandcollectivevibrationandawarenesswilltakeour planetintoitsnextincarnation.Thecleaneryourenergycolumnandchakras,the morelightthatcanbeinfusedtogotoyourcells.Throughtheconsciousdecisionto speedupyourevolutionarygrowthyouwillmanifestmoreclarityasoldtrauma imprintsrelease.Therewillbenumerousawakeningmoments,bothbigandsmall. Thisrefinementprocessofclearingyourastralbodyoftheshadowsmentaland emotionaldisruptionsisspiritualalchemy: Breaksintothestrongegostructure Clearstheastrallayersofnegativebeliefs,emotionsanddefensemechanisms Releasesegobeliefsanddefensesofsuperiority(excessiveselfesteem)or inferiority(lowselfesteem) Balancesbrainhemispheres Balancesthepolaroppositebeliefs Integratesthefeminine(Ying)andmasculine(Yang)energies IlluminatestheThirdEye Releasessexual,kundalinienergymakingitavailablefortransformation Incarnatesthelightbodyfortheascensionprocessinordertomoveintothe nextdimension. Asyourlightbodybecomesmoreintegrated,themaleandfemalepolaritiesmerge totransformyoursexualenergies.Yourentiremolecularstructurebecomes

148

reorganizedandlessdensesothatyoucanopentothehighervibrationsofUnity Consciousness.

149

Chapter19 ChoosingtheEvolutionaryProcessinTimesofAmbiguity
Letusbeginthisveryday,thisveryhour,theGreatHealingtocome. LeonardPeltier

Thisisanexcitingtimeinwhichtoliveforthoseofuswhoareintheopeningup processoffindingourtrueidentity.Weareinthemidstofapotentialupheaval.We arefacingaspiritualearthquake.Theoldgroundonwhichwehavebeenstandingis shifting.Themediashoutsabouttheearthsvolatilityandtheheadlinesare daunting.Herearesomerecentexamples:Heaviestmonsoonsonrecord,worst floodsindecades,landslideskillingthousands,massiveglaciericebreakingaway, summermeltsofvastproportions,worldwidetemperaturesatrecordhighs, biggestincreaseinheatwavessince1950.Thepossibilitythatmagneticpoleshifts andplanetarychangeswillhappenisunprecedented.Riotsandrevolutionsand warsincrease.Rumors,mythsandrampantspeculationsfly. Theseareambiguous,unsettlingtimesaswedonotknowwhatishappeningtous asaspeciesonthisplanet.Wewanttoknowhowtostaysafeinanunsafeworld.No onehasthecrystalballthatgivestheexactknowledgeastowhatwillhappen.There isareconsiderationofthefundamentalswithwhichwevebeenprogrammed.We aremovingintoThisWorldAsYouveNeverSeenIt! Humanshateuncertainty;itbringsfeelingsofhelplessnessandhopelessness.But thesedisturbingfeelingsthataccompanyournotknowingwhatishappeningare onlyfeelingstobeconfronted.Thisdiscomfortaboutnotknowingwhatwillhappen isasignaltowakeup.Itswakeuptimeboysandgirls.Anditsgrowuptime! Is122112anarchetypefortheendoftimeorasDanielPinchbeckbelieves,a cosmicdeadlineforourspeciestomakeanevolutionaryjumpinconsciousness? SomespiritualtraditionssaythatweareintheFourthAgeofManalready;thatwe arecurrentlybetweenworlds,sayingthatwearemovingtowardstheedgeofchaos. Sowhatistheantidotetosurvivingthebigflood,thebigcollision,thebignuclear explosionorthebiginfrastructurebreakdown?WhatistheescapehatchforHomo sapiens? Dismantlingtheego? Alteringbrainwavestomeshwithhighervibrations?
150

Alloftheabove?Ortoputthequestiononamorepersonallevel,Whatisyour particularescapehatch?Orhatches?Doyouhaveaplan? Thesequestionsareaboutyourpersonalidentityandyourpersonalalchemy.How doyouconstrueyourself?Areyoustilloperatingfromthethreelowerchakras caughtupinfear,addictivebehaviorsandneedforpower?Orareyoumovingto highergroundoftheheart,thirdeyeandcrownchakrasthatwillenhanceyourlife energy? ThinkEvolution,Evolution,Evolution! Onetrapfosteredbytheegoisthefalsebeliefthatyoujustwanttogohome.This longingtobesomewhereelsetoescapethepainofMotherEarthandyourown personalpainisbutanotherdistractionkeepingyouawayfromcontinuingsoul growth.Thislongingtoprematurelyescapebeforedoingyourimportantalchemical workisadistorted,distractingbeliefthatkeepsyoufrombecomingthebestyoucan be. Ofcourseweallwanttogohomeagain,whereeverthatmaybe,butthatsneither thepointnortheplacetoputyourenergy,asitdistractsyoufromfocusingonyour processofgrowingandevolving.Therealityisthatyouareherenowonplanet earthandyouarehereforareason.Thesetimesareaboutintensifyingthecollective consciousnessofourspecies.Wethecollectivehaveadestinytodecidehere. Youareheretohelpwiththetransitionofhumanconsciousnessintothenextlevel, dimensionorwhateveristohappen.Thisrequiresyoutobeherecompletelyand fullytakeresponsibilitytoassistintheelevationofhumanitysconsciousness throughraisingyourownvibration. Wakeup!Yoursouliscalling.Getreadyduringthisspeeduptimebytuninginto yourobserving,openheartedself.Stayingawakeisanecessityduringtheshiftsthat arehappening.MarcusAureliusgavegoodadviceseveralthousandyearsago:"Live notasthoughtherewereathousandyearsaheadofyou.Fateisatyourelbow;make yourselfgoodwhilelifeandpowerarestillyours."
151

Speedingupthealchemyprocess? UnleashingDMT? Lightingupthepineal? Movingontounseendimensions?

Sowhetherwehaveworldcataclysmornot,youarestillgoingtohavetolivewith yourselffortherestofyourlifesoyoumightaswellbecomethebestpossible personyoucan.Rumiexplanationofthisresponsibilityofemptyingyourself exquisitelyfollowsinatranslationbyColemanBarksofRumisversesinFeelingthe ShoulderoftheLion: YouAretheOnlyStudentYouHave Youaretheonlyfaithfulstudentyouhave. Alltheothersleaveeventually. Haveyoubeenmakingyourselfshallow withmakingothereminent? Justremember,whenyou'reinunion, youdon'thavetofear thatyou'llbedrained. Thecommandcomestospeak, andyoufeeltheocean movingthroughyou. Thencomes,Besilent, aswhentherainstops, andthetreesintheorchard begintodrawmoisture upintothemselves. ThesearetheNecessaryTimesofPreparation Weasaspeciesareundergoingsignificantchangesatadeep,deeplevel.Youcan makethewholeunnervingprocessmucheasierifyouclearoutasmuchofyour emotionalblockagesasyoucanbeforetheshifttimecomes.Youdonthavetoknow whatdistortionsandfragmentationsneedtobehealedasyoursubconsciousmind knows. Atthistimemoreandmorepressureisputonourastralbodiestospeedupthe growthprocess.Aspresentandoldkarmicmemoriescomeuptobeexaminedand released,theremaybeburstsofoverwhelming,chaoticenergywithinyou.Youmay seeminglyfallapartattimeswithdisorientation,anxietyandpanic.Theegoprotests loudlywhenitisthreatenedbygrowingawareness.Itstartstoreverberatemightily
152

asanunresolvedlargetraumastartstoemergefromthesubconsciousmindtobe workedthrough.Thisagitatedenergycanpropelthereleaseofnegativityfromthe solidifiedegostructure.Youmaybecomeextremelyfrightenedastheintensityof theemotionsamplifyandbuilduptopreparefortheinversionshift.Itmayeven lookasifyouarehavinganervousbreakdown. Itwouldhelpifyouremindyourselfthatyouaremerelyfallingaparttocome togetheragain.Thisispartoftheshamanicmodelwhichsaysthatapersonmustdie forcertainaspectsofhimorherselftobeputbacktogether.Thiscanbeatemporary stateifyouworktheissueeitherbyyourselforwithanotherhealer.Tellyourself thatthefearthatyouexperienceisonlyyouregotryingdesperatelytoholdontoits statusquowhichnolongerworks.Distressingsymptomsprovidethegreatest opportunityforhealing,asRumisaid,Thewoundsarewherelightenters. Theenergiesbehindprocessedemotionsbuildtoprovidetheimpetusforchange. Remembertheintensityprocessofinversion.Tryingtostoptheprocessorholding onordistractingyourselfwithaddictivesubstanceswillcreatemoreanxietyand pain.Resistanceiscounterproductive;totrytoholdbacktheprocessisfutile.Work withthealchemicalconceptofinversionofheatingupsothattheenergybuildsso thatitcanshift. Soleterrip,feelthefeelingsnomatterhowpainfultheyare.Findtheemotions experiencedduringtheoriginaltrauma.Thendoanexercisetoreleasethefeelings orfindsomeonewithhealinggiftstohelpyouwiththem.Andthenpickyourself up,dustyourselfoffandstartalloveragain.Asyoureleasetheenergeticand emotionalblocksanddeconditiontheprogrammingofthemind,youwillmoveinto deeperawareness.Asyoutransformyourpersonalenergiesthroughfreeingthem, youhavemoreabilitytoaccessotherdimensionsofconsciousness. Ourgroupunconsciouspsycheisbeingpreparedforatremendousvibrationalshift. Somespiritualteacherssaythatcertainvibrationalfrequencieswillbebrought forthtobringorderfromchaosinoursubtlebodiesforustorememberthatweare partofthetotality.Extremelypotentenergiesthataredeeplyaffectingusare pouringintoourplaneatthistime. Remindyourselfthatyouarenotaloneandcanalwayscallforhelpfromthose spiritualforcesthatworkwithyouasasoul.Connectwithyourangels,guidesand othernonphysicalbeingsthatactinourbehalf.SpiritualteacherGurdjiefftaught thatcosmicenergieswillassistinourgainingatranscendentsenseofunity.As shownbytheongoing,everchangingprocessofprogression,lifewantsto transformitself.HermesTrismegistus,theGreekgodThoth,thefounderofalchemy
153

toldus,Thesoulpassesfromformtoform;andthemansionsofherpilgrimageare manyfold.Thouputtestoffthebodiesasrainmentsandasvesturedoesthoufold themup.Thouarefromold,ohSoulofman,yea,thouarefromeverlasting.Thisis thenoblestgoalwecanponderthatofreturningtoSpirit. Wewillgoon.Itsalltakencareof. ManyPossibleFutures Lifeisverymuchlike"Let'sMakeADeal"withyourbeliefsystemsanddailychoices determiningwhetheryougetDoorNumberOne,TwoorThree!Whatyougetis whatyoubelieveyouareworthyofgetting.Youdrawthatparticularfuturethatfits withyourtotaloverviewofhowthingsmustbe.Aslongasyouremainstuckinself defeatingbeliefs,yougettheboobyprizepovertyconsciousness.Ifyouarenot happywithwhatyouarebeingofferedinliferightnow,thenyoucanchangethe dealbychangingyourthoughts,perceptionsandbeliefsatthatcorelevel. Wecontinuallydefineourownpersonalrealitybyourthoughts,wordsandactions. Youcanlearntochangethosedecisionsmadeearlyinyourlifewhichwere influencedbyasocietythatwasbasedonfear.Withinthoseearlydecisionslayan identitythatyoucarvedoutforyourselfandthedefinitionofafutureacreation whichyouarelivingout.Nowyoucanlearnsomethingdifferent. Oldpatternsofactingdictatedbythematerialisticegoarenotonsolidground.As theearthchangesinshiftsofenergy,youarebeinggivennewwaysofbeing.Reality shiftsdailyasyoulearntoseethingsdifferently.FritjofCapraremindsusinTheTao ofPhysics,thatconsciousnessnotreality,isthefundamentalstuffoftheUniverse. Realityatanygivenmomentisonlyhowyouperceivethingsdictatedbyyour programmedbeliefs. LelandKaiser,adesignerofthefuture,talkedaboutthetheoryofparallelfutures. Hesaid,Realityisagreatuniversalpharmacyandyouaretheprescriptionwriter. Thereareallkindsofprobablefuturesthatcouldexistforyou.Probabilitymeans thatanythingcanhappen.Whathappensdependsonwhatyouthinkandwhatyou do.Themenuofmanypossiblefuturesistherebeforeyouwithchoiceslimitedonly byyourrestrictivebeliefs. Kaisergaveapowerfulmetaphorofrealityasaprescriptionwaitingtobewritten forwhatyouwant.Whateveryouwrite,thepharmacyfills.Ifyouwritethewrong prescription,youwillreceivethewrongmedicine,anditwillnotbethefaultofthe
154

pharmacy!"Becomingtheconsciousresponsibleplannerofyourrealityistheway ofbecomingthepersonyouwanttobe.MetaphysicalwriterStewartWhite,inhis bookAcrosstheUnknown,eloquentlymakesthesamepoint: Ifyouaregoingtofaceagreatandshiningfuture,youmustuseanewand brightapparatuswithwhichtoexpressyourgreatercapacities.Youcant thinkbrightandshiningthoughtswithatiredoldbrain.Sostepasidefromit Itisonlyaprotectivecoveringnowforthethingthatcounts,whichiswhat generatesyourbrightandshiningthoughtsthenewconsciousnessborn withinyou. Themanypossiblefuturesmetaphorremindsusthatwecanbecomewhowe choosetobe.Actingasifyouhaveallthewisdomthatyouneedisanartformthat youcanskillfullycreate.Actasifandmakeithappen.Actasifyouhavetheabilityto movefromwhatyouarecarvingoutinthispresentrealitytothatwhichyouwantto become.Yourlifeisthemostimportantcreationthatyouwillevermake.Youhave allthewisdomrightwithinyoutochoosethebestpossiblefuture.Howartfullycan youactonthis?Thisistheheartofittoactartfullyonwhatyoualreadyknow. Withpositiveactionandlettinggooflimitingbeliefsystems,thatoldgrayfuture ain'twhatsheusedtobe! Thethingtodoistoprograminthepossiblefuturethatisconsistentwithyoursoul growth.Letyoursouldothechoosingfortheloveandlightthatcomesfromthe HigherIntelligenceoperatingintheuniverse. HearttoBrainDuringChaoticTimes:Coherence,ComeinPlease! Theevolutionaryprocessseekscoherenceandyoucandevelopthosecoherent brainwavepatternsthatenhancewholebrainpotential.Atatimewhenthereis greatestdisorderwithout,youcanlookfororderwithin.Meditationandcheckingin withyourinnerwisdomalongwiththeactiveprocessesofworkingyourfears,both oldandpresent,aretimehonoredapproachestodealwithanxiety,agitationand depression. Feelingoutofcontrolwithfear,helplessnessandhopelessnessasdictatedbyyour egowilllikelybeyourgreatestenemy.Changesbeyondyourcontrolcanbe accompaniedbyfeelingsofterror.Duringthosetimesofupheaval,rememberfear andterrorareonlyfeelings,veryuncomfortablefeelingtobesure,butintheend, onlyinternalsensationsandfeelings.Theyaretobeexaminedandgoneintoand breathedorworkedthrough,notgiveninto.
155

Fearandotheremotionsarecontagious.Weareallinthistogetherandpeoplewill tapintotheirdeepestfearsofbeingannihilated.Ifyourfriendsorfamilybecome caughtinfearandpanic,offertodosomeoftheexercisesinthisbookthatwillbring thembacktoacalmplace.Spiritualsurvivalwillbevastlyimportantforyouduring thosetimesifothersseemtobelosingtheirheadsandtheirreason. Youcanserveasaresonantbeaconsendingoutpositiveenergies.Groundyourself toofferalovingentrainmenttobringothersthroughturbulencebacktotheir center.Seethisasyourmissiontobeastableforcethatotherscandrawfrom. Deepestfearmomentswillemergetobeaddressed;thesearethevortexesand whirlpoolsoftheshadow.Dontfightthementalfabricationsoftheshadow;expose themtothelight.Staywise.Staypractical.Dropintoyourheartoftentoproduce thoseEurekamomentsthathappenwhenyouareinthebrainwavestatesthat allowhealing.FindthoseSpiritualWarriororAdventurerArchetypesthatare intriguedbythepotentialsthataretherewithinyourself. Ifdarkthoughtsofsomethingnegativeattackingyouemerge,dontgivethem power.Itssomedeepprimevalfearsurfacingwithinyourselfdonotgiveenergy tofeedingitbutchallengeitinsteadasjustbeingabelieftobehealed.Thisisatime tokeepaconstantvigiloveryourruminating,fearthoughtsgeneratedbytheego. Challengethoughtsofevil,negativespiritsorimplantstakingoveryourbody.If thereissuchathing,theyfeedonfearenergies.Interruptthosethoughtsthatwill freezeupyourmindinconfusionandterror.Stayawayfromwebsites,booksand peoplecaughtupinnegativitywhotrytofrightenyoutogetyourallegianceand yourmoney.Getagripdontsurroundyourselfwithnegativity.Ifyouhavetimes offallingapart,getyourselfbacktogether. TheEpiphanyPlanandSpiritualSurvival ThoseofyouwhoaredrawntothesewritingsarererememberingyourChrist Consciousnessvibration.Youhavelivedcountlesslifetimes.Youarethecarriersof thememoriesoftheCosmos.TheAhamoment,thegreatepiphanyoftotally knowingofthispurityofwhoyouareandsurrenderingtoitiswithinyou.Onceyou rememberthisandliveitdaily,survivalisthereforyouautomatically. Thisisarerememberingtime.Theknowledgeistherewithinyou.Whatever happensduringaperiodofquantumchange,goinsideandseewhatyoucan
156

rememberfromothertimes.Youhavevastamountsofinformationwithinthatyou candrawfromifyouputthevoiceoffeartorest.Whenyouhavetimesofgreat claritythosesuddenlyIseemoments,perhapsyouaredrawingfromthose quantumaspectsofyourconsciousnessthatexistinotherdimensions.Youhavethe AkashicFieldandtheZeroPointFieldtodrawfrom.ThinkofyourselfasInfinite Potentialityunfoldingintoitself. Rememberyourbreathingandtappingandtheotherexercisesthatenhanceacalm mind.Usespirituallygroundingapproachestokeepyourmindstrongandthe circuitsofyourbodyinbalance.ListentobinauralbeatentrainmentCDstocalm yourfears.Meditateoftentotakeyourbrainwavestothehealingvibrationsof alphaandtheta.Ifyoufeelungroundedandfloatingaboveyourbody,usethebeta waveCDstohelpfocusyourmindtothetaskathand. Formaspiritualsupportgroupifyoudonthaveonealready.Surroundyourself withpositive,likemindedpeoplewhoshareideasaboutmovingintothenext dimension.Groupritualsandmeditationthatopensuptolovewillhelpyoustayina solidplace.

Lovingisallowingthesimpleactsofkindnesstoyourselfandothers.HenryGoudge, fatherofthepopularEnglishauthorElizabethGoudge,gaveacleardirectiveonhis deathbed,Intheenddear,whatmattersistheloving.Asmydaughter,Karen Petersen,says,Livesimply,lovegenerously,caredeeply,speakkindly.AndI wouldadd,begrateful,tickleyourfunnyboneandlaughloudlyandoften. IftheLightsDoGoOut


157

WeCanCultivateNumerousActsofKindnessastheManyPetalsOpeningontheLotus

Buddhistreligionprophesizesthatonlywhenutterdarknesshasshroudedthe worldwillthenextrealizedBuddha,calledtheMaitreya,come.DonAlejandroCirilo PerezOxlaj,PresidentoftheNationalCouncilofEldersMayas,XincaandGarifuna, saysthattherewillbealongperiodoftotaldarknesswhenthereisachangeinthe sun. Theamountoftimeofdarknessvariesaccordingtodifferenttraditions.Don Alejandrohassaiditwouldbethirtysixhours.Thismayormaynothappen,butit standstoreasontoemotionallyprepareforit.TheEgyptianMysterySchoolsand othershadthetraditionofdoingseveraldaysofinitiationincompletedarkness,so shouldthesunbeblockedout,usethistimetopreparetogointoadimensionthatis lifesupporting.Shouldthishappen,thinkofthetimeasyouropportunityfor initiation.Shifttoanenergeticsensitivitywhereyoucaninterfacewiththe vibrationsthatHigherIntelligenceprovides. Turnwithinshouldourworldbecomesdestabilizedthroughearthquakes,tidal waves,politicalupheavalorevenawobblingoftheplanetonitsaxis.Inmidstof darknessorutmostexternaldisequilibrium,findthehigherinformationthatis beingcommunicatedtoyou.Breathethroughfearandterrorandlistentothe teachingsthatarebeingprovidedfromahigherSource. TheFeatherofMaatAMetaphorforJustice

HathorEgyptianStoneCarving

TheHathorsareagroupofinterplanetarydimensionalbeingswhospeakthrough soundhealerTomKenyontogiveinformationontheAscensionprocess.The Hathorsaremastersofloveandsoundfromanascendedintergalacticcivilization. Theyreportthatthepinealoperateslikeacosmicantenna,allowingimpressions,


158

informationandenergyfromthelightrealmsofbeing.TheHathorsgive visualizationsonhowtoelevateyourenergybodyandmoveintootherspiritual dimensionswhichtheycalltimelinesatthewebsitetomkenyon.com.Theyalsogive soundtuningsforhealingavailableforMP3playersorasCDs. Wehumansdefinitelyareafeelingspeciesandmostofusaretryingtofigureout ourfeelings.TheHathorssaythatthroughfeelingsandchoice,humanscanfollow theirintuitiontolockintoadimensionwherealllifeandtheeartharehonored. Livingalifeoflovingkindnessandgratitudeisthebestassurancetotakeyouinto thatdimension.TheTalmudhaslongsaid,Thehighestformofwisdomis kindness. TheHathorsremindusthatwehavefreewilltodowithaswechoose.They describeanancientEgyptianpracticeofMaat,thegoddessoftruth,moralintegrity andcosmicorderfortheUniverse,calledtheweighingoftheheartafterdeath whichtookplaceintheHallsofJudgment: therewasagoddesscalledMaat,whoheldasetofscales,andupondeath, theheartofanInitiatewouldbeplaceduponthescales,andafeatherwould beplacedontheotherside.Iftheheartwasaslightasafeather,theInitiate wouldbegivenentrancetotheheavenlyworldsmeaninghigherstatesof consciousness.Butiftheheartwasladenwithnegativity,regretandsorrow, theInitiatewouldhavetoreturntothelowerworlds.

ValleyoftheQueens,Egypt. DynastyXIX1270B.C.

GoddessMaatkneelswithwingsextendedpayinghomagetotheGoddessHathorseatedonathrone. MaatistheGoddessofTruthandJusticeestablishedbytheCreatorGodatthebeginningoftime.

159

AccordingtoEgyptiantradition,thespiritofMaatappearsnowandtheninour worldtoreestablishorder.TheScalesofJusticeswingbackandforthwiththe balancing.Sodoapersonalassessment.Howmuchdoesyourheartweigh? Heavinessistransformedintolight(anothermeaningofthewordlight)bythe qualityandquantityofyourloving.Ifyourheartisheavy,youhavesomeworkto do.Itsnottoolate.Stepuptheconstancyofintentionalprayersandritualsthat increasetheilluminatingPresencewithin. Astheworldheatsup,hurriesupandragesup,youhavetheopportunitytodecide howheavyyourheartis,howclearyourconsciousisandwhatfutureyouwantto liveout.ThequoteofThechoiceisalwaysyours,fromAldousHuxleyyearsago remainsevenmoretruetoday.Wehumanhaveanexactingattributewhichcanlead ustodestructionorsalvation.OurDNAprogrammingallowsustheabilitytothink, decideandactfreewillcanbeabaneoraboonaswemoveintothefuturewhich isratchetingupinspeedandintensity. RobertCoxquotestheEgyptianPyramidTextswritten2400BCEassaying,A stairwaytotheskyissetupformethatImayascendonittothesky.Whether yourAscensionprocessisastairway,intenseprayer,thesipapuni,theMerkabaor aninterdimensionalportal,gotothatarchetypeasahealingvibrationthatwilltake youthere.Youvebeenworkingforit,towarditformanyincarnations.Youare beingcalledtosomethingyouneverimaginedpossiblebutthatisalreadywithin you;thatportalisalreadyinyourprogrammeddestiny. Forwhatisascensionbutconsciousnessreturningtoitself? CoherenceistoMakeWholeAgain Doingaceremonytofindcoherencewillbehelpfulifthereisaperiodwherethesun appearstobedark.Callinyourguidesandaskthatallthathappenstoyoubeonlyfor yourbestandhighestgoodandforallconcerned.Calmlyputintentionsofprotection fromanydarkenergyaroundyou.Rememberthatyouareanopeninformational systemcapableoftakinginlight.Lightdispelsthedarkness. Thinkofhowthepinealglandproducesmelatonin,harmine,pemolineandDMT, beneficialhormoneswhichwillspeedyourspiritualgrowthduringtimesofdarkness. Nomatterthechaosthatensuesintheoutsideworld,spendsometimeingratitude eachday.Disentanglefromfearthoughtsandotherchaoticinformationthattheego triestoforceonyou.Soften,opentothelovingPresence,andsendyourintentionfor

160

evolutionarygrowthtothepinealarea.Allowanintentionforyourbodyandauric fieldtobecomemoreluminescentthroughtheopeningofthepinealgland. Focusonsomethingorsomeonethatyouloveandfeelgratefulfor.Letthelovefor creationexpandasyourecognizehowfaryouhavecomeinspiritualgrowth.Remind yourselfofyourchoicetobecomeabeingofpurityandlove.Repeatedlysendout healingintentionsbringingyourselfbacktocoherenceusingtheloveinyourheart. Remember,theenergiesoflovearealwaysstrongerthanfear. Concentrateonlightbeingturnedonbetweenyoureyebrowsthatlightinand aroundtheheadshownasahaloinpicturesofsaints.Crossyoureyesslightlyandgaze inwardatyourpinealvisualizingitbecomingluminescent.Bemindfulwhilepaying attentionacknowledgingthatallisinGod.Holdthatgratitudeattitudeofknowingat adeeplevelthatyouhavetheintelligenceandconsciousnesstoweatherwhatever comes.TalktothatinformationstoredinyourcellsthatisconnectedtotheDivine Blueprint.Fireupthosememoriesalignedtoyoursoulthatlieburiedwithinyou waitingtobecalledforth. Drawpranafromotherdimensionstosupportyourbodytakingonthefrequenciesof thelight.TheZeroPointFieldwithitslifesupportingpranaiseverywhere.Theprana comesdirectfromthesun;evenifyoucannotseeit,knowthatitisstillthere.Callto theOnewithinyouyouandGodareOne. Exercisessuchasthisonechargetheenergeticcircularloopbetweenheartand headchakras.WeareluminousbeingsasdescribedbytheBuddha,Themindis luminous,butispollutedbythetoxinsthataredumpedintoit.Healingexercises helpcleartoxicenergyofthisandotherlifetimessothatwecanreturntoourtrue state.Theopeningoftheheartchakraleadstotheopeningoftheluminancewithin theThirdEyeandthisinturnincreasesthevibratoryopeningoftheheartas Proverbs15:30remindsusThelightoftheeyesrejoiceththeheart. TheHathorsspeaklovinglygivingusreassurancefortheseuncertaintimes, Asalways,eveninthemidstofsuchgreatdifficultiesasyounowface,we holdahighervisionforyou,thehumanfamily.Weseeyourhiddengreatness, eventhoughyoumaynotseeifforyourself.Weholdalightinthishourof darkness.Itisjustareminderofthegreatlightthatyouholdwithinyourself. Itistimetofreethislightwithinyou.Futuregenerationswillbeblessedby yourascent.Mayitbeso.

161

AndthebibleversewrittencenturiesagofromEphesians5:8statesthesame message:Foryeweresometimesdarkness,butnowareyelightintheLord;walk aschildrenoftheLight.Findtheradiancethatlieswithinyouandsenditout,first toyourauraandthentotherestofthewordandtheUniverse.Wearemeanttobe luminousbeings.Luminosityisthewaytogo!

TheHumanBodyasEthereal,LuminanceEnergy

WeareNeverAlone

Therearemanyinterplanetaryforcesworkingwithyouandwithourspeciesoverall butyouaremakingchoiceswhichaffectthegroupcollective.Profound opportunitiesaboundduringthisbridgingtimeasthefeminineenergybreaks throughintoourplanet.Readyornot,heretheycome!Foritisatthetimesofchaos thatgreatcreativityinthehumanpsychecancomeforth.MarciaWhiteexplains, Whenthesechangescome,youwillhavemoreteachablemoments.Themost teachabletimesmaycomewhenpeoplearefearfulandlost,whenthereis chaosanddissolution.Attheseallislostmoments,peoplemaybebetterable tolisten. Iftheworldsinfrastructureshouldfail,therewillbecountlessteachablemoments! Nomatterwhatthestateoftheworld,youarestilllefttochooseandcreatethose principlesthatwillguideyourlife.Whetheryoumakechoicesoutoffearorloveis uptoyou.Thepracticalthingseemstobetogettheresultingconfusionandfree floatinganxietyclearedoutsothatyoucanmakemoreefficientandlovingchoices.
162

WeareMultidimensionalBeings

AspeopleoftheOneHeart,wefollowthelight.ThebibleversefromJob38:19asks, Whereisthewaywherelightdwelleth?Andasfordarkness,whereistheplace thereof?Bothoftheseplacesarefoundwithinthesacredspaceofthehumanheart. Wehavethegreatcapacitytotranscendthedarknessrenderedbytheshadowand findourpurity.Ourbodieshavethephysiologicalandchemicalabilitiestoproduce light.Again,fromthebible,thistimefromProverbs4:18:Thethepathofthejustis theshininglight,thatshinethmoreandmoreuntotheperfectday. Weareunderinstructiononhowtoprepareforthisimportantstageinworld historybymakingourheartspure.Perhapsweareinanincubationstage,awaiting instruction!Wearenotalone.Therearetrueteachersofgreatlightandlovehereto guideus.Youcanfindthemastheyonlyspeakwordsoflove.TeachersofTruth followtheintentionofthebibleverse,1Corinthians16:14,"Letallthatyoudobe doneinlove."Releasingoldfears,rigidthinkingandprejudicesthroughcultivation ofselfgrowthandspiritualdeepeningwillhelplightentheshadowloadonour psyches.Thisreleasecanbeasloughingoffprocessasyourinnervibrationschange. Cultivationofthecoherencethatisinherentinourheartswilltakeustothoseother dimensionsthatarewaitingforus. ManypeoplebelievethatthereisnotimeornospacebutjustaMatrixof Consciousnessofwhichweareapart.Thereisabeliefthatotheraspectsofour beingarealreadyexistinginotherdimensionsunknowntousthatweare multidimensionalbeingslivinginnotonlythisreality,butinothers.Ifso,the destructionofthephysicalearthwouldmeanthatyouasanenergeticforcecould movesomewhereelsecalledhomesotospeak.Insteadofthatoldtimereligion, giveusthatoldtimeportalinordertoreconnectwithmultidimensionalityand incarnateintootheraspectsofourselves. Withourinherentlyevolvinggenes,wehavetheelectromagneticandchemical meansforthehumanDNAtocontinue.Wearebeingassistedthrough interplanetaryforcestoconnectwiththevibrationthatsupportslovethrough remembranceofwhoweare.WearechildrenofHeavenandEarth;ofaboveaswell asbelow.Wecanlearntoopenourhearts,crownchakraandconsequentlyour ThirdEyetoconnectintotheinformationweneedforchoosingourfuture.Thatis ourhealing.

163

CoCreationistheascentofmatterincorporatingbackintoSpirittoreturnto Source.AsaPureHeartbeing,youareaconsciousparticipantinthisexcitingtime astowhatwillcome.AsMelchizedeksays,Loveisourwayhome. SpiritualLonging,CoCreationandOpeningyourPotentiality Putyourselfinaquietspaceanddropintothelongingofyourhearttoberealand whole.Focusoncreationandputyourenergyintothejoyousevolution.Keepthe illuminationofyourThirdEyepresentinyourmindwhileyoudropintothelongingof thelovingenergyofyourheartofhearts. Inthepast,mythoughts,beliefsandegodefenseshavedefinedwhoIam. Iamnotmythoughts. Iamnotmyfear. Iamnotmyjudgments. Iamnotmymind. Iamnotmybody. Iammuchmorethanmythoughts,beliefsandegodefenses. Iammorethantheemotionalchargesaroundanyproblem,issueorpattern. Iopenmyhearttowhatisbeingpresentedtomeateachmoment. Iaccepttherealitythatispresentinmylifeatthisevolutionarytime. Iamthankfulforfreewillandfreedomofchoice. IamasoulinprogresspropelledbymyDNAchanges. IrerememberwhoIamandclaimmyDivineBeing. IopentotheUniversalLifeForceofhealingenergy. Iopentotheinfinitesourcesofwisdomandguidance. Iasktobefullyconsciousandcompassionatetowardsallothersandmyself. Iaskthatallmychakrasbesetatthecorrectvibrationofmysoul. IacknowledgethatIamaCoCreatorwithSource. IopenmyheartfullyinlovetomyselfandmyconnectiontotheDivine. IembracethewholenessofallandtheGodwithin. IamgratefulforthislifeandthisprocessofevolutionthatleadsmetoGod. IgivethanksthatIAMapartofthesingle,unifying,allencompassingUnity. Seeradiantlightmovingoutfromyourbodyasaglowingaura.Holdyourawareness onopeningthefloodgatesoflightlettingitflowandcirculateoutfromyourbody. Connectyourheartwiththeglowinglightofthesun.Feeltheconnectiontothepower
164

oftheradiantsunbeatingwithinyourheart.Youaremorethanthislittlelifenegating egoanddefensebodymass,youaretheconnectionbetweenheavenandearth.Youare Creationitself. Picturepiercingthedarknessandliftingyourselfuptoanewdimension.Seethe biggerpicture:youarehelpingcreateanewcollectivefuture. ThisistheEleventhHour Weofthepureheartscanresonatewiththewordsofthebiblicalprophetfrom Proverbs4:18whosaid.Butthepathofthejustistheshowingoflight,thatshineth moreandmoreuntotheperfectday.Wearefindingourpathtothenext dimension.HerearesensiblewordsgiventousbytheHopiEldersofOraibi, Arizona,HopiNationtoprepareusforupcomingevents: "YouhavebeentellingthepeoplethatthisistheEleventhHour. NowyoumustgobackandtellthepeoplethatthisistheHour. Andtherearethingstobeconsidered: Whereareyouliving? Whatareyoudoing? Whatareyourrelationships? Areyouinrightrelation? Whereisyourwater? Knowyourgarden. ItistimetospeakyourTruth. Createyourcommunity. Begoodtoeachother. Anddonotlookoutsideyourselffortheleader. Thiscouldbeagoodtime! Thereisariverflowingnowveryfast. Itissogreatandswiftthattherearethosewhowillbeafraid. Theywilltrytoholdontotheshore. Theywillfeeltheyarebeingtornapart,andtheywillsuffergreatly. Knowtheriverhasitsdestination. Theelderssaywemustletgooftheshore, Pushoffintothemiddleoftheriver, Keepoureyesopen,andourheadsabovethewater. Seewhoisintherewithyouandcelebrate. Atthistimeinhistory,wearetotakenothingpersonally. Leastofall,ourselves.
165

Forthemomentthatwedo,ourspiritualgrowthandjourneycomestoahalt. Thetimeofthelonewolfisover.Gatheryourselves! Banishthewordstrugglefromyourattitudeandyourvocabulary. Allthatwedonowmustbedoneinasacredmannerandincelebration. Wearetheoneswe'vebeenwaitingfor." Oursisnottheonlyreality.Therearevastdimensionsofconsciousnessout thereandasahuman,youarealreadyexistinginseveralofthem.Youarehere nowtorememberthevibrationsofyourhigherinterdimensionalaspects.To findtheselovingrealities,keepintouchwiththelongingofyourheartwhichis connectedtoyoursoulspurposeandtheGreaterMystery.Loveisthewayto ascend.

166

Bailey,Alice.EsotericHealing.NewYork:LucisPublishingCo.NewYork,1953. Buber,Martin.IandThou,CharlesScribnersSons,NewYork,1958. Brodie,Renee.TheHealingTonesofCrystalBowls:HealYourselfwithSoundand Colour.AromaArt,Ltd.Vancouver,Canada,2000. Cherry,Joanna.AscensionforYouandMe.Mt.Shasta,CA.AscensionMastery International,1985. Childe,Doc.FreezeFrame:OneMinuteStressManagement.PlanetaryPublications. BoulderCreek,CA.1998. Church,Dawson.TheGenieinyourGenes:UsingtheStunningNewBreakthroughs inDNAResearchtoGeneratePeakHealth.EnergyPsychologyPress,SantaRosa,CA, 2009. Cirlot,JuanEduardo.ADictionaryofSymbols.NewYork.PhilosophicalLibrary. 1971. Cox,RobertE.,TheFinalEvent:DawnofaNewAgeofTruth.1stWorldPublishing. Fairfield,Iowa,2009. Cox,RobertE.,ThePillarofCelestialFire:TheLostScienceoftheAncientSeers Rediscovered.Fairfield,IA:SunstarPublishing,LTD.1997. Craig,Gary.EFTforPTSD.EnergyPsychologyPress,SantaRosa,CA,2009. Dixon,Jana.BiologyofKundalini:ExploringtheFireofLife.LuluPublishing.2008. Eden,Donna.EnergyMedicine.(2ndedition)NewYork:Tarcher/Putnam.2008. Feinstein,David,Eden,DonnaandCraig,Gary.ThePromiseofEnergyPsychology: RevolutionaryToolsforDramaticPersonalChange.NewYork.Tarcher/Penguin. 2005. Gallo,Fred.(Ed.)EnergyPsychologyinPsychotherapy:AComprehensiveSource Book.NewYork,Norton.2002.
167

Resources

Gendlin,Eugene.Focusing.NewYork,BantamBooks,1978. Goldman,Jonathan.HealingSounds:ThePowerofHarmonics.Rockport,MA, ElementBooks,Inc.1992. Lane,Jim.Theneurochemistryofcounterconditioning:Acupressuredesensitization inpsychotherapy.EnergyPsychology:Theory,ResearchandTreatment1(1).2010. Lansdowne,Zachary.TheChakrasandEsotericHealing.YorkBeach,MA.Samuel Weiser.1986. Laskow,Leonard.HealingWithLove.1992,2008. Namka,LynneYour Quick Anger Make Over Plus Twenty Other Cutting-Edge Techniques to Release Anger, Tucson, AZ. Talk, Trust and Feel Press. 2009. Narby,Jeremy.TheCosmicSerpent:DNAandtheOriginsofKnowledge. JeremyTarcher/Putman,NewYork1999. Radin,Dean.EntangledMinds:ExtrasensoryExperiencesinaQuantumReality.New York:Paraview/PocketBooks/Simon&Shuster.2006. Spigarelli,Jack.CrisisPreparednessHandbook:AComprehensiveGuidetoHome Storage,UpdatedSecondEdition.Alpine,UT.CrossCurrentPublishing.2002. Thind,BhagatSingh.ScienceofBreathingandGlands.SpiritualScienceFoundation, Malibu,CA.2009. Waters,Frank.BookoftheHopi.NewYork:Penguin,l977. Wesley,Rowels,James.HowtoSurvivetheEndoftheWorldasWeKnowIt.New York.PenguinGroup.2009. Zahourek,Rothlyn.Intentionality:TheMatrixofHealing.Verlag:VDMDr.Muller Akiengesellschraft&Co.,KG,Deutschland.2009. WebSites Alchemywww.alchemywebsite.com/
168

AskandReceivewww.askandreceive.org/ JannaDixonbiologyofkundalini.com/ TheHathors:PinealDimensionalAttunement,AscensionCodes,sacredChantsand WhiteGoldAlchemyCDs.www.tomkenyon.com/ ChristineHoeflichActivating2012:APracticalGuidetoNavigating2012with ConfidenceandClarityebookwww.WhatEveryoneBelieved.com/ InstituteofHeartMathwww.heartmath.org.Researchonheartintelligencethelink betweenemotions,heartbraincommunicationandcognitivefunction. LeonardLaskowwww.Laskow.net BruceLiptonBrucelipton.com DrunvaloMelchizedekwww.spiritofmaat.com/archive/maglist.htm/ EllieCrystalMetaphysicalandScienceWebsitewww.crystalinks.com. JefferyThompson.AlphaRelaxationSystem,ThetaRelaxationSystem2.0,Gamma MediationSystem2.0,AwakenedMindSystemandHealingMindSystem therelaxationcompany.com/ EvanVorleywww.AlchemyRealm.comwww.multidimensionalbeing.com/ SpiritualAudioCDsandtapeswww.soundstrue.com/ JamesWesleyRawlesSurvivalblog.com/ KenWilberwww.integralinstitute.org/

169