The Cherry Creek News
& central denver dispatch
With News of the Heart of Denver
Hilltop • Belcaro • Bonnie Brae • Glendale • Country Club • Cherry Creek
Volume 11 Issue 4  April 2010
Bicycle share comes to
Denver in a big way
The community benefit grant will sup-
by the Cherry Creek News port Denver Bike Sharing, the non-
Getting around Denver alterna- profit organization that owns and oper-
tively just go a whole lot easier and ates the program. In addition, Kaiser
healthier. Permanente, the state’s largest non-
When the system launches on profit health plan, will provide in-kind
Earth Day, April 22, Denver B-cycle support, expertise and resources for
will feature more than 375 bicycles research and evaluation, community
Donna Lynne, DrPH, president, Kaiser Permanente Colorado (left) and Denver
Mayor John Hickenlooper
and worksite outreach, and volunteer
at 38-40 stations around downtown
support for special projects.
Denver, Cherry Creek North, and
“We are very excited to be a part
the University of Denver campus. By
of this ground-breaking program that
the end of June, Denver B-Cycle will
promotes a healthy lifestyle and an
feature 50 stations and 500 bicycles.
active mode of transportation for our
From running errands to commuting
city’s residents and employers,” said
to work, Denver B-cycle is a quick,
Donna Lynne, DrPH, president, Kaiser
easy and healthy way to get around
Permanente Colorado. “With metro
the city.
Denver ranking as the third-fittest city
Kaiser Permanente’s three-year
in the United States, it is the perfect
$450,000 sponsorship is a critical dis-
play of confidence in the long term see BIKING on page 5
promise of the Denver B-cycle system.
Fix your roof before its too late—
deadlines approaching for storm claims
With 2009 gone with the turning of
U.S. POSTAGE
the calendar, its hardly forgotten. The
DENVER, CO
PRSRT STD
PERMIT NO.
*** TIME SENSITIVE MATERIAL *** POSTMASTER PLEASE DELIVER BY APRIL 26
year was one of the worst for severe
PAID
353
storms in memory, with serious hail-
storms leaving their wake in May, June
and July, including storms powerful
enough to damage homes and storm-
water systems.
What many homeowners don’t
know, is that storm damage is covered
by your homeowners policy, but only
if you act quickly. So while leaks and
the like may be slow in appearing,
you have to be quick to report it to the
insurance company, and just as quick
to fix damage before it causes real, per-
manent damage to your home.
There are companies that specialize
in both detecting and repairing storm
Central Denver Dispatch
damage. Many roofers are effectively
insurance restoration specialists, and
they know how to get your insurance
company to recognize your issues, and
Denver, CO 80246
how to fix them as well.
P.O. Box 460142
Here’s a short check-list of how to
tell if your home has suffered storm
damage:  Leakage in Attic after Driving
Rain.   Possible causes: Roof shingle
damaged by hail;  Dented or Cracked
Siding, Fascia, Window Wraps and
Gutters.  Possible cause: Hail damage,
Lowry
News p12
Lowry Steam Plant Re-Energized
special to the Cherry Creek News benefit as planting 9 acres of trees each
year, or, not driving 76,000 miles each
Lowry’s Steam Plant neighbor-
year in a typical gas-powered vehicle.
hood has taken an additional step to
Over the anticipated 40 year life of
generate renewable energy, support
these systems, the benefit is the same
Colorado’s New Energy Economy and
as planting 360 acres of trees (20% of
help achieve the national goal of more
Lowry’s entire area), or, not driving
energy independence.
3,040,000 miles.
Seven Steam Plant homeowners
 The Steam Plant Loft building now
and the Steam Plant Lofts HOA have
generates the most renewable energy
installed solar power systems totaling
of any building in the entire 1,800 acre
48.81KW of power. Those systems pro-
Lowry Community.
duce the same annual environmental   The award winning Steam
Plant building was Lowry’s original
“PowerHouse”, but generated ener-
gy using coal-fired boilers. The Steam
see SOLAR on page 4
Vandalism, Fire and Tree Damages;
Inside the
Stains on Interior Ceilings and Walls.
Possible cause: Roof leaks from hail
Cherry Creek
impacts to the shingles witch put hair
line cracks and make bruises to the
shingles; 
  Missing Shingles. Possible cause:
News &
Wind damage to the roof;  Damaged
Screens and Cracked or Broken
Central Denver
Windows. Possible cause: Hail Damage
or Vandalism;  Dark, dirty-looking Dispatch
areas on your roof. Possible causes:
Environmental pollutants; vegetation,
fungus or algae growth; loss of granules •Getting Fit, part 4
due to age of shingles;  Excessive ener-
gy costs.  Possible cause: Insufficient page 3
attic ventilation causes heating/cool-
ing systems to run excessively. • Recession real, not mental
A good roofer will meet with a rep-
page 2
resentative of your insurance compa-
ny, and negotiate for you. Even if you
don’t think you have storm damage, a •Locks for Cancer page 11
quality roofer can inspect your home,
from the roof. Since most insurance
require that you make a claim within • Parenting coach
one year, you need to act quickly, as
our last major storm was in July.
page 12
Find a quality roofing com-
• Tesla’s remarkable coupe
pany—
Go to theCherryCreekNews.com Crossover page 14
Page 2 Cherry Creek News & Central Denver Dispatch
Opinion and Comment
Recession real, not mental
John Hickenlooper, Denver Mayor
and candidate for Govenor said a while
back “a recession like this really is
driven by people’s mental state.”
But let’s get this clear. This is no
mental recession. And no, I’m not talk-
ing about the bad politics of missing
the real pain and suffering in millions
of households, and the unemployment
rate, which is nominally ten percent,
and shows no likelihood of meaning-
fully abating in short term. Things are
tough for lots of Colorado families,
as there are ample reminders in every
economic report.
No, this recession is very, very struc-
tural. The mayor probably doesn’t read
our newspapers, but many remember
our series “Apex and Foundation,”
two years ago. Or our reporting on the
collapse of the auction rate securities
market, which presaged the financial
collapse ten months later, in the fall
of 2008. The news since then has been
loud and clear. The economy shows few
long-term prospects for strong growth.
And as the effects of the Obama stimu-
lus package, now a year old, fade, there
is not enough private sector growth to
sustain a job producing recovery. As
the Federal Reserve ends its role as the
principal buyer of home mortgages,
and home-buying tax credits conclude,
we risk another leg down on home
values, crippling the principle asset of
millions of American families. We are
in a “limp-home” mode, yet where we
are heading is as yet unclear.
Mayor Hickenlooper might have
missed all those columns by Paul
Krugman in the New York Times and
the comments of Elizabeth Warren,
chairperson of the Congressional
Oversight Panel for the TARP pro-
gram. But myriad voices, including the
hearings on the economic collapse, the
testimony of Ben Bernanke, or remarks
before the Congress by Alan Greenspan
describe a not pretty picture of the
future.
Let’s get some economic basics
down. Wages are flat for a decade,
adjusted for inflation. We have had
bubbles in equities, commodities (think
oil) and housing. All three have sapped
the productive strength of our economy.
Worse, yet productivity has become
decoupled from wages. Workers can do
more, make more, innovate, but they
won’t be compensated more, on the
whole. Our economy has become dan-
gerously unbalanced (google “Apex
and Foundation”). Finance, Insurance
'#'!&'$

$
!

and Real Estate, the FIRE sectors, which
frequently add little value to the over-
all economy, far overshadow the pro-
ductive sectors of the economy. And,
energy has become dangerously vola-
tile, vulnerable to speculation, while its
fundamentals worsen. Health care was
the fastest growing part of the econo-
my for most of the last decade, while
manufacturing shriveled. Making stuff
is now a smaller part of the economy
than government. Can America live
with less than 15% of GDP attributed
to making stuff? And less than 10% of
the jobs?
This is not good news. And it cer-
tainly isn’t mental. It’s structural. The
way our economy is structured is out
of whack, disadvantages the middle
class and working families and limits
opportunities. It concentrates wealth
in a few hands, in a few sectors, and
pushes the consequences of reckless
financial risk broadly, and weighs upon
future generations.
If we fail to understand the real ori-
gins of our economic distress we can’t
create policies to address them, and we
can’t budget with an eye to future.
It means that Congressional
Democrats who fought to limit the size
of the Obama stimulus couldn’t do
basic arithmetic (output gap - stimulus
size > 0). It means that we continue
to pursue economic objectives that
don’t create wealth, and don’t spread it
broadly enough to leverage that wealth
into improving the lives of all people.
It means that we are clueless when it
comes to the economy.
The sooner we can face up to the
consequences of failures to regulate
finance, the off-shoring of manufac-
turing, the metastasizing of a bubble
economy and the failure of monetary
policy over the last twenty years, the
sooner we can restore America’s prom-
ise. And Colorado’s.
FIVE SMART THINGS YOU CAN
SAY ABOUT THE ECONOMY:
1) Our economy should be about
creating value. Value creation equals
job creation and economic growth.
2) Economic regulation should place
speculation in its rightful place in the
regime of economic activity. Trading
markets create winners and losers with
every trade, but we can’t subsidize los-
ers and over reward winners.
3) We’ve got to get health care and
energy right if we are to be competitive
as a state and a nation. The rest of the
developed world is ahead of us in both
areas. Preserving the middle class is as
much about these two critical areas as
anything else.
4) Making stuff matters. Adding
Opinion and Comment
The Last (Sad) Laughs
How much longer will America’s
‘gravest recession’ last? Of course, no one
knows for sure, but a table produced by
the Bureau of Labor Statistics, which since
1939 has tracked the changes in non-farm
jobs as reported in its monthly Employer
Survey, offers a very cautionary note.
From its post-Great Depression base
of 29.2 million, America added 109.6
million non-farm jobs until reaching the
peak figure of 138.8 million in 2007. Since
December 2007, when this Great Recession
started, non-farm payrolls have declined
by 11.2 million, and employment overall
has declined by 13.0 million jobs.
Replacing these millions of jobs and
adding the 140,000 a month needed in
order to keep pace with growth in the
labor force must be our nation’s highest
priority. And yet, sadly, it isn’t.
The White House and Congress seem
wildly disconnected from the jobs crisis,
perhaps because they spend so much
time aiming a strobe light on health care
reform, Iraqi elections, a new START
treaty, financial industry reform, climate
change, an amended No Child Left Behind,
Afghanistan and a balanced budget.
The BLS non-farm payroll table offers
a focused summary of job creation in
the past and a strong sense of what may
be possible in the future: America’s best
three-year job creation total was 10.3 mil-
lion, which occurred from 1997 to 1999;
its second best effort produced 9.4 mil-
lion jobs, 2004-2006; and the third-best
performance was 7.7 million new jobs,
1984-1986.
But America needs to find at least 11.2
to 13.0 million jobs right now just to get
us back to December 2007’s employment
level, which itself was no great shakes,
and 22 million new jobs if we want to
have, as morally we should, near full real
employment. For every month we delay
further, the total increases by 140,000 jobs,
if measured over three years, would total
a further 5.0 million jobs.
Yet not once in seven decades have we
BC.qxd 11/24/04 5:09 PM
Full Circle Wellness
'
$
!%%
Acupuncture • Herbal 

Medicine • Massage Therapy
Runners • Cyclists • Skiers

*(%&$


Full Circle Wellness center can help your
April 2010
ever added more than 10.3 million jobs in
three years.
Economists can debate which single
‘lever’ can best add millions of jobs a
year for the next several years but, to
date, we have used almost none of the
arrows in the nation’s job recovery quiver.
Meanwhile 18 to 20% of America’s work-
ers have been unemployed or extremely
underemployed for 27 months. The levers
which we have ignored most consistently
are programs modeled after FDR’s Works
Progress Administration which from 1938
through 1940 employed 5.8 million job-
less Americans. That’s roughly 17% of the
then entire non-farm workforce, a figure
comparable to the task confronting our
nation today.
This White House and this Congress
seem intent on proving that history
repeats itself, first as tragedy and then
as farce. Their initial jobs programs have
been ‘missing in action’, and their use of
phantom ‘jobs saved’ versus ‘real jobs not
created’ is beyond misleading.
Like the “unemployables” of the
Great Depression before FDR came along,
America’s jobless today face the cruel-
est of choices: hunger, homelessness and
declining heath. Their anxiety and anger
are growing as their hope fades.
But the jobless are not completely des-
titute in a democracy. They still own their
votes which can be ‘spent’ on election
days -- or not. Given their sheer numbers,
the jobless can determine the outcome
of any election. Their decision to go vote
-- or to boycott an election -- make them a
power block to be courted and convinced
that “jobs, jobs, jobs” is more that cheap
political rhetoric.
If the BLS total non-farm payroll his-
tory is any indication, the jobless will have
at least three election cycles - 2010, 2012
and 2014 - to spend those votes, and then,
as embittered as they will be, theirs will be
‘the last (sad) laughs’.
Rick Sloan is the Acting Executive
Director of “Ur Union of Unemployed.”
Page 1
 
%&
 $

(!'
#
value to raw material is the tap root
of economic activity. The other sectors athletic performance...
!($






 

matter, but at the end of the day, add- For performance enhancement, speed recovery times,
)))'$
'#'!&'$"
Additions & Renovations ing value is what makes everything decrease healing times, achilles, rotator cuff, plantar fasciitis,
else possible. Acupuncture is your answer.
Kitchens
Bathrooms 5) We can’t get the jobs problem
Sports medicine acupuncture and massage
Basements fixed unless we are intellectually hon- therapy works!
Porches / Pergolas / Decks est about the rest of our challenges. We
didn’t dig this hole in a day, and there’s
no miracle waiting to rescue us now.
3 03- 250 -59 11 But we can fix this by being smart, bold
and persistent.
Rachael Rose MS, LAc.
Anne Carruth, LAc, M.S.
—Guerin Lee Green
the Cherry Creek News 303-480-0080
Owned & operated in North 2931 W. 23rd Avenue
Denver www.FullCircleAcupuncture.com photo by Jeff Navarro
April 2010 Cherry Creek News & Central Denver Dispatch
Getting fit in 2010: Models of
fitness
by Guerin Lee Green
What is fitness?
That is an extremely difficult ques-
tion. The core of the difficulty lies in
the adaptable nature of the human
body. The body adapts to the demands
we place upon it in widely differing
ways— and it even responds to obesity
and starvation (anorexia) in divergent
manners. Anorexics, when they add
weight, are so metabolically screwed
up that almost all the weight they add
is fat— their bodies won’t put on lean
muscle mass, a strange survival mecha-
nism that makes the disease even more
difficult to treat. And the obese can
have a very hard time adding lean
muscle mass that would speed their
metabolism, because the adipose (fat
tissue) they have in abundance is meta-
bolically inert.
Consider some models: The elite
endurance athlete, who trains to com-
pete in events of a duration longer than
thirty minutes, turns their body into a
highly efficient-fat burning machine.
It’s a well-documented “interference”
St James Row
in historic San Rafael
2200 Emerson Denver CO
Page 3
OMG. PLANNED PARENTHOOD IS OFFERING
GYT 10 STD* testing on
$
April 23rd & 27th
S.
GET YOURSELF TESTED! AT ALL OF OUR HEALTH CENTER
Call 1.800.230.PLAN or
visit pprm.org for the health
center nearest you.
* This applies to gonorrhea/chlamydia tests and HIV
pprm.org
tests. Coupons cannot be used and some additional
fees may apply.
fielding tree and shrub care
llc.
effect, that high levels of endurance
training will interfere with putting on
muscle, pretty much without regard to
ISA certified arborist
the time spent in a weight room. The licensed and insured
Olympic weight lifter, in the 170-lb class
will have tremendous power, lifting expert tree trimming, tree
three times their body weight, coupled
with great flexibility, but not the showy removal, shrub pruning, and
muscles of a body builder (women
Olympic weight lifters can lift 2.5 times tree planting
their body weight). The bodybuilder
might compete with 6% body fat, and for a free estimate
eat five thousand calories daily. Look at
the Olympic sprinter, the human stick
gabe @ 303 667 5004
fieldingtreeandshrubcare.com
of dynamite, or an athletic NBA player,
the very definition of explosive power.
Or the master yoga practitioner, who
combines non-explosive strength with Eleven years in the business, Gabe Fielding is a personal
great balance and supreme flexibility. arborist that knows your trees.
Which of these models, or archetypes
represent fitness?
Spring is a great time to take care of your trees!
Each of the models above represent
an extreme adaptation of the human
form to repeated stress. In each case, Take care of your trees, give Gabe a call today
the body will change its form, rewire its
see FITNESS on page 4
URBAN LIVING AT ITS BEST!!!
! ! Do You want ...
CLOSE to Everything - Downtown, City Park, Restaurant Row?
to be
a cool NEIGHBORHOOD with big trees, beautiful homes and great neighbors?
ROOFTOP DECKS with KILLER VIEWS of the City and Mountains?
DUMBWAITERS that make multilevel living and entertaining a pleasure?
Visit us at stjamesrow.com pa
broadway
rk CITY
av
SIX STUNNING TOWN HOMES
3 Bed 4 Bath | 2600 - 3400 sqft | $679K - $850K
e
17th ave restaurant row
PARK
timeless architecture | designer finishes | dumbwaiters
rooftop decks | deck houses | wet bars colfax
Lindsey Wiseman Jim Wiseman
303.859.3864 303.250.8091
!
Page 4 Cherry Creek News & Central Denver Dispatch April 2010

Defining fitness
continued from page 3 This less extreme HIT method may
nervous system and adjust its metabo-
work well for people (the older, less
lism to meet particular demands. The
fit, and slightly overweight among
body will even convert fast twitch
us) whose doctors might have worries
muscle fibers to slow twitch, and vice
about them exercising “all-out.” We
versa. That adaptation to stress is ulti-
have known for years that repeated
mately the measure of fitness.
moderate long-term exercise tunes up
Recent research says that muscles
fuel and oxygen delivery to muscles
actually determine how the body uses
and aids the removal of waste prod-
fat. Muscle energy levels affect the cre-
ucts. Exercise also improves the way
ation of proteins that instruct the body
muscles use the oxygen to burn the
how to use the fatty acids we consume.
fuel in mitochondria, the microscopic
It’s another argument as to why exer-
power station of cells.
cise matters far more than diet.
Running or cycling for hours a week
Making it personal
widens the network of vessels supply-
I’ve been trying the Tabata intervals
ing muscle cells and also boosts the
mentioned last month (check it out on-
numbers of mitochondria in them so
line at northdenvernews.com). They
that a person can carry out activities of
are definitely trying— I hit a peak heart
daily living more effectively and with-
rate of 187 BPM while doing them.
out strain, and crucially with less risk
I don’t know if they have had a big
of a heart attack, stroke or diabetes.”
impact yet. I’ve been trying a Suunto
But the traditional approach to exer-
TC6 watch and heart monitor during
cise is time consuming. Martin Gibala
some of my workouts, which is inter-
and his team have shown that the same Detox Your Body for Spring
esting. I’ll have more about that next
month.
results can be obtained in far less time Inside & Out!
with brief spurts of higher-intensity
As I suggested last month, go to

C l i n q u e D e Lav i t a ’ s E l i t e
exercise.
Youtube.com and search for Tabata to
Keeping it personal, that 225-pound
get some examples— I’ve been doing

Detox
bench press goal is looking better. I lift-
dumbbell thrusters, perhaps the goofi-
ed 320lb. on a flat bench press machine
est named exercise ever.

Spa
at the end of a workout last week. Now,
Research from McMaster University
in Canada has broadened the argument
for interval training. “The authors have
that isn’t the same as actually bench-
pressing that weight, as the machine :: Spring Cleanse Packages ::
$70 5
provides some leverage, plus moves
already shown with young healthy
only in a single plane, so you don’t  Colon Hydrotherapy Treatment

college students that this produces the

$12
have to stabilize the bar. So while I’m
same physical benefits as convention-
still well short of my goal, I’m clearly  Cellulite Elimination Body Wrap

al long-duration endurance training, in
stronger. I have made personal bests
despite taking much less time (and using the Alpha 2010 System PLUS Cherry Creek
in back and tricep exercises as well,
amazingly, actually doing less exer-
cise!). However, their previous work
which is both gratifying and encourag- Microdermabrasion Facial Treatment East
ing. I’m hoping to easily bench press
used a relatively extreme set-up that
over 200lb by my 43rd birthday this 9925 S. Niagara St. Suite 310 :: Denver, CO 80224
involved “all out” pedaling on a spe-
month. I also saw my inspiration this
cialized laboratory bicycle. The new Call for more Information :: 303-780-0003 or 303-472-3554
past month, a fairly ordinary looking
study used a standard stationary bicy- w w w. E l i t e D e t o x S p a . c o m
guy who I judged to be a few years
cle and a workload that was still above
older, and maybe an inch taller than I.
most people’s comfort zone —about
Bespectacled, without showy muscles,
95% of maximum heart rate — but only
he incline pressed 175lb easily, about
about half of what can be achieved
20 times. ***
when people sprint at an all-out pace.

Solar key at Lowry

redevelopment
continued from page 1
Plant’s renovation and renewable
energy systems symbolize Lowry’s
transition to a “green” community.
The Steam Plant’s initial 10KW solar
power system was the first phase of
the Lowry Energy Initiative.
The Steam Plant’s solar energy sys-
tems and many other energy events
throughout the Lowry community
since 2007 have been important cata-
lysts to raise community awareness
and support for renewable energy,
energy efficiency and electronics recy-
cling. Numerous other Lowry hom-
eowners have decided to install solar
power systems since 2007, making
Lowry one of Metro-Denver’s leading
renewable energy communities.
If you are interested in “green”
improvements for your home, office
or school, please contact Greenprint
Denver greenprint@denvergov.org
April 2010 Cherry Creek News & Central Denver Dispatch
Biking around Denver now a
shared affair
continued from page ONE
place to help pave the way for more
Americans to lead active and healthy
lifestyle. We are proud to support such
an innovative program that aligns with
our nonprofit mission to build healthier
communities.”
Users can sign up for 7-day ($20),
30-day ($30) or annual memberships
($65) online. Users can also purchase
the $5 24-hour membership at the
B-cycle station with his/her credit card.
Discounts are offered for students and
seniors. With membership, every time
a member checks out a B-cycle from
a station, the first 30 minutes is no
charge. Escalating usage fee charges
apply for longer rides. Simply check
The Preference of Civility
by Lucía Guzman
There is something wonderful
about these two quotes: “All poli-
tics is local,” in the words of former
Speaker of the House Tip O’Neil, and,
“All politics is personal,” attributed to
House Speaker Nancy Pelosi. These
statements articulate the essence of
the political process. An issue may
be debated and legislated in DC or in
Colorado’s Capitol, but it is lived out
in our homes and our communities.
In our recent national dialogue
about health care, many citizens have
taken action by showing up at rallies,
writing letters, mak-
ing phone calls, talk-
ing with their neigh-
bors and reading the
paper to learn more
about the issues. This
citizen engagement
should be acknowl-
edged and celebrat-
ed.
However, there
is another side to
the engagement that
is less positive. It is
disturbing. Name
calling, disruption,
disrespect, the spread
of un-truths, threats
of violence and threats of inaction
are bullying tactics – and should be
swiftly confronted and stopped. Rocks
thrown through windows, slanderous
name calling, violent words and dis-
torted pictures of political leaders, and
threats have become commonplace in
this discourse. It is a destructive and
ugly turn of events, and one we the
people should not tolerate. Incivility in
our public dialogue must stop.
Page 5
out a bike from one of the many Denver
B-stations and return it to a B-station
near your final destination.
“Denver is the ideal city with its 350
miles of trails and 300 days of sunshine
to launch the nation’s first city-wide
bike sharing program,” Denver Mayor
Conditions: PreͲ & PostͲ
John Hickenlooper said. “Denver Tendonitis Surgery
B-cycle will offer our residents and
Rehab:
visitors an alternative form of pub- Muscle Strains
lic transportation that eases conges- Bursitis
Joint
Replacement
tion on our roadways and promotes
sustainability. We are very grateful to Plantar
Fasciitis
Ligament
Reconstruction
Kaiser Permanente for its support of
Denver B-cycle and encourage others Ligament
Sprains
Fractures
to embrace this new era of fun, sustain- Arthroscopies
able and healthy transportation.” Neck Pain
Osteotomies
Back Pain
Laminectomies
Joint
Instabilities
Discectomies
Our kids understand bullying. Sports Injuries
Bullying is aggressive behavior that is Spinal Fusion
Arthritic
intentional and is repeated over time. Conditions
Bullying can take many forms, such
as physical bullying; teasing or name-
Incontinence
calling; intimidation using gestures or
social exclusion; and sending insulting
messages by mail or e-mail. When slowing down is the last thing you want to do,
How can we, as adults, teach our
children that these behaviors are unac-
Active Motion is your preeminent choice.
ceptable, and then go out onto the
streets and become bullies ourselves, 1325 S. Colorado Boulevard, Building B, Suite 206
or watch as someone else does and Denver, CO 80206 303Ͳ394Ͳ3356
do nothing to stop it? How can we
support a political leader who is a www.activemotionpt.com
bully? We cannot. Kids
are smart, and they see Attention You Deserve...Results You Desire
our actions and inac-
tions and learn from
them. As the old say- For FirstͲTime Clients, MENTION THIS AD & Receive
ing goes, our actions A FREE Gift Card for YOUR FIRST VISIT!
speak more loudly
than our words.
Discourse and
debate are the
American way. While
debate has often been
violent and ugly, the We debate in kitchens while mak- of disrespect from my colleagues or
current bi-partisan ing dinner for the family; we discuss fellow citizens. One of the best ways
rancor weakens us. issues in community meetings as we to stop bullying is to publicly address
The late David Foster prepare to give thanks for what we and denounce it.
Wallace argued that have. Discussion brings us together Being a representative of the people
today’s political shills, and allows us to hear each other. The is a position that carries many respon-
strict partisanship and shallow think- words I hear today are pulling people sibilities. I welcome the privilege to
ing “alters democratic discourse from apart, closing doors – not opening represent you and will bring to the
a ‘battle of ideas’ to a battle of sales them. office the deep respect and honor that
pitches for ideas.” As a candidate, I pledge to partici- it deserves. I will also work with my
I agree. I come from a culture of pate in an open dialogue throughout colleagues to build a collegial body
debaters as a Latina, a woman and a the race and while in office, if elected. I that deserves your respect – one that
pastor. Taking on ideas, examining all pledge to hear from and listen to voic- debates issues and examines ideas,
sides of the issue and arguing for a es from many sides of each debate. I in the end creating laws that support
particular path is part of my DNA. But also pledge to not stand idly by if I see and nurture the American Dream for
I also learned to do this with respect. bullying actions or hear a discourse every citizen.
ADD
ADHD
TRAUMATIC BRAIN INJURY
ANXIETY
For more information please contact:
Kerri Honaker, LPC, Clinic Director LEARNING DISABILITY
303-417-1797 | KHonaker@neuroAgility.com
www.neuroAgility.com ASPERGERS
Kerri Honaker, M.S., M.A., LPC
Earle Shugerman, MD
2501 Walnut Street, Suite 205, Boulder, CO 80302
3773 Cherry Creek Way,
495 Uinta No Dr/Suite
Suite120,
690W/ Denver
Denver, COCO/ 80209
80230 ATHLETES
TALENTED AND GIFTED
We accept most major credit cards. Insurance coverage may apply
Page 6 Cherry Creek News & Central Denver Dispatch April 2010

Secrets of successful women

and quieting self-doubt
By Angela Sasseville, MA, LPC, NCC
He wasn’t sure how long it had
been going on but he felt as though his
wife was drifting further and further
away from him. Many of their interac-
tions now seemed cordial and perfectly
uneventful. But what had happened
to the chemistry? And when had she
stopped becoming enthused about
spending time with him? She seemed
so indifferent about his presence now.
He could recall a time, back before
Medical • Surgical • Cosmetic
want to spend the next 40 years of their
lives together.
Little did he realize that every part-
ner has undeniable and legitimate emo-
tional needs that only their spouse can
meet. In other words, he wasn’t being
“whiny”, as she had once accused him
of being. He was ready for their rela-
tionship to evolve and become stron-
ger, more connected.
Reconnecting with your partner can
be difficult and complex. Why stumble
through it alone when you can enlist

&
the kids were born, when he felt closer
to her. Life was lighter then, easi- the help of a relationship expert who
er. Connecting with her was fun. knows the terrain and can guide you
is pleased to announce
Our board certified physicians offer
He missed that light-hearted sense of towards the destination that you both
being in sync with one another, of want?
the opening
the most of their treatments
current new practice
and being happy to see one another at the
end of the day.
Flourish Counseling specializes in
strengthening adults and couples. Angela’s
procedures available to ensure that Their sex life had become quiet monthly articles highlight common and
in the Lowry area.
you get the best results.
and dull these days as well. He had
waited patiently when their physical
prevalent issues and are never written about
anyone in particular. For more information
intimacy decreased for months when on therapeutic support call 303-455-3767
each of the kids was born. Inside his or go to www.FlourishCounseling.com.
mind he fumed, but she isn’t pregnant
now so why did she think a marriage
without sex was acceptable? It was
becoming increasingly frustrating to

Dr. Alexandra Theriault try to resolve the issue. The tension in

their bedroom had been going on for
so long that a nonphysical relationship
had become their new norm.
There were moments in which he
secretly wondered if she was having an
affair. At least that would explain why
her focus was always on something
else, he thought. She assured him she
simply had a lot of work to do that
pulled her away from home. He didn’t
know what to believe. Yet the longer
their disconnection from one another
continued, the more peripheral he felt
in her life, and the more fragile the
marriage felt to him.
He dreaded bringing this stuff up to
her. He was no relationship expert and
sometimes he struggled to find a way
to spit out what was bothering him.
Other times he just felt pissed when
she ignored him! But he knew that
this wasn’t a way that anybody would

For Breaking News

Dr. Juliann Wallner
Treatment for:
Throughout the Month, Visit
www.theCherryCreekNews.com
• Acne • Aging Skin • Eczema • Hair Loss
• Hyperhidrosis (Excessive Sweating)
• Skin Infections • Lesion and Cyst Removal
• Melanoma • Nail Disorders
Lowry Apex Dermatology Office
• Nail Fungus • Pigmentation Disorders

Trust In Stellar!
• Rashes of All Types • Psoriasis
will be open November 2, 2005.
• Scalp Conditions • Scars and Keloids
• Skin Cancer

Plus Cosmetic Dermatology l

Specia
Spring
• Botox • Juvederm • Radiesse
Featuring Interior & Exterior Painting Kitchen & Bath Specialists

• Obagi 125
• MD Rampart Way • Latisse Faux Finishes & Mural Art Basement Finish
Forte • Prevage Stain & Finish Work Exterior Carpentry
Suite 220 Stucco Repair & Coating Systems Window Replacement

130 Rampart
Denver, Way
CO 80230
Wallpaper Removal Tile Installation
Drywall Repair & Texture

Suite 250
303.795.2030
$400 off all Painting Services minimum $1,000 or
10% off Labor on all Interior Home Remodeling minimum $2,000.
In Lowry Coupon cannot be combined with other offers.

303.261.1525 720-981-STAR (7827)

www.StellarPaintingAndRemodeling.com
April 2010 Cherry Creek News & Central Denver Dispatch
The benefits of strength training
By James Thompson, physician
assistant, Denver Health
When people think of strength train-
ing they think of some over-muscular
brute. In actuality, you don’t have to
look that way to attain the benefits of
strength training.
The benefits of strength training
can be felt in just the first few weeks
of beginning a workout program.
Working out focusing on the same
body part two or three times a week
can have a positive effect on a per-
son’s energy level. This gives the par-
ticipant the ability to increase or keep
their independence while being able
to perform activities of daily living
easier, and can give an athlete better
performance in their sport. As you
grow stronger you will not get tired
as quickly.
In addition to accomplishing tasks
with greater ease, the strength trained
individual is able to control their
weight by being able to burn more
calories. This is due to muscle hyper-
trophy (an increase in muscle mass)
which requires more energy when at
rest.
Improvement in physical appear-
ance and sense of well-being are com-
mon characteristics in strength trained
people and can actually lessen the
severity of depression.
Due to muscle hypertrophy with
strength training, joints are better pro-
7th Annual Five Points Jazz Line-
up Announced
Join DOCA and the Five Points com-
munity in celebrating the history, cul-
ture and MUSIC of the Five Points
neighborhood during the 7th Annual
Five Points Jazz Festival. This FREE
event takes place on Saturday, May 22
from 1:00 p.m. to 8:00 p.m. along Welton
Street in Historic Five Points. The festi-
val has it all: 13 bands on 5 stages; food
and arts vendors; activities for kids;
engaging talks about jazz history; and
free museum days! Take the RTD Light
Rail line D to get there; a shuttle is avail-
able to get you around the festival. It’s
sure to be “Cool, Crazy and Hot!”
KUVO In-Studio
11:00 AM Five Points Jazz Legacy
Combo
1:00 PM Leonard Barrett, Jr.
KUVO Main Stage
1:00 PM Legacy Jazz Orchestra
3:15 PM City Park Jazz
4:45 PM Five Points Jazz Festival
Tribute Award Presentations
5:15 PM Cleo Parker Robinson
Dance
6:00 PM Elevation Jazz Orchestra
small business
accountants!
-full charge bookkeeping
- payroll
-sales tax
Be ready for tax time!
QuickBooks® experts
law & equity ltd
www.lawandequityltd.com
4450 tennyson st.
720.201.4975
established 1996
Page 7

tected which results in a decreased 
risk of sustaining an injury as well as
increased flexibility. With this, balance

and coordination can also be increased, 
decreasing the risk of falling especially 
in older individuals.
In addition, strength training can 
reduce the effects of osteoporosis by
increasing bone density, essentially 
making bones stronger. 
And of course, once you are in a
regular exercise regimen you will be

able to sleep much better decreasing 
the risk of insomnia which in turn 
decreases the risk of heart disease,
obesity, cancer and diabetes. 
Some key points to strength train- 
ing include the following: 
A strength training program lasting
20 to 30 minutes a session, two to three 
times a week is all that one needs to
attain these benefits.
Resting a day or two between work-
outs is essential to let your muscles
recover.
A proper diet, including eating the 
right amount of protein, is essential 
for building muscles. An appointment 
with a registered dietician would be
very beneficial if one has doubts about 
their nutrient intake. 
If you have any concerns with your
health then an appointment with your

primary care physician is a great place 
to start before beginning an exercise 
program.




 
Five Points Plaza
2:00 PM Dr. Tone & The Notes
4:15 PM Manuel Molina
5:45 PM Willie Houston and Advertise in the Cherry Creek News from
the Blues Prowlers
just $89/month
Crossroads – Pianorama
1:00 PM Jeff Jenkins & Eric
Gunnison No other paper delivers Cherry Creek North, Lowry,
2:30 PM Ellyn Rucker & Vlad Hilltop, Country Club, Bonnie Brae and the Polo
Girshevich Grounds DIRECTLY BY MAIL every month.
4:00 PM Purnell Steen & Hank
Troy
Page 8
Cyndeth Allison
Denver Notions
Every autumn elm bugs invade
the house. Just a few – ten or twenty.
Friends are taken aback, but to me,
that’s a livable number; when I lived
in the country, hundreds
would darken my picture Bugged
window to the point where
I couldn’t see out.
As winter draws on, I begin to
find their little Halloween-colored
carcasses. I’m always relieved when
the last are gone. For all that I don’t
fight the invasion, I am not happy
about sharing space with them.
This year, all winter long and
into spring, one surviving insect has
stalked my kitchen. For days at a
time, he will disappear, then he reap-
pears on the counter, on the floor.
Every time I see him, I say, “Die!”
I can’t imagine that he wants to
live like this, in a hot house, far away
from sun and wind and fresh green
things to eat. I can’t imagine that he
wants to live at all, solitary, like an
old man in a nursing home, all of
whose friends have long since died.
Yet I do not put him out in the
snowy yard where he could come to
a natural end. And when I find him
legs up on the far side of the kitchen
from his usual haunt by the window, I
flip him over gently, and inquire how
on earth he ended up on his back. I
ask if he walked all the way around
the counter, or whether he flew. He
does not answer, but limps away, gait
dignified, almost huffy, toward the
66\UDFXVH6WUHHW

6XQ¿OOHG KRPH ZLWK EDPERR ÀRRUV YDXOWHG FHLOLQJ
FXVWRP EXLOWLQV JDV ¿UHSODFH  RSHQ ÀRRU SODQ
2SHQ *RXUPHW NLWFKHQ Z 66 DSSOLDQFHV  JUDQLWH
0DVWHUVXLWHZEDOFRQ\ ODQGVFDSHGEDFN\DUG
-RUGDQD/HERZLW]
ZZZ % U DGI R U G5HDO(VWDWHFRP   WK 6WUHHW'HQYHU 
Cherry Creek News & Central Denver Dispatch April 2010
Redwine Piano Tuning
I have had thoughts like this
before, about how all beings fit into Musician’s Ear
the universe on their own scales,
sink, as if he knew his way.
blind to fractals larger and smaller
As I watch him go, I say, as usual,
– atoms or galaxies. Here is a living
“Die!”
example.
The next day at breakfast I am star-
Bug walks back along the lower
ing absently in the direction
side of the handle. It’s as if his job Artist’s Touch
of my big-bellied samovar.
is to measure every millimeter of
Movement catches my eye.
My bug is climbing patient-
my kitchen. Perhaps he cannot leave
until he has fulfilled his purpose and
$80 Piano Tuning
ly up the shiny side.
Attention drawn, I really look at
made his report.
Bemused, I watch his progress. I
$25 OFF!
the urn. I see that it reflects the whole
room, as if it were a surreal stage set
forget to say, “Die!” *** Call Mike Redwine
– a cross between Escher and Dali. 303-818-6316
Distorted by the curved side, the
cupboards and stove bulge large, the
-Offer ends May 31-
door is a mere slit, center stage, back.
Those lines you always draw to show
perspective, wide apart at the bottom,
narrowing as they rise up the paper,
are clearly marked – where floor joins
cabinets, where counter joins wall –
but are wavy and softened.
Bug reaches the top, traverses the
Your neighborhood Nostalgic cupcake bakery
lid, goes back along the handle in the offering 30 flavors daily.
front, as if he were a stagehand on a
catwalk adjusting lights for the next
performance. He makes me think
about proportion in a different way. Voted best cupcake store in Denver 2009 –
To that bug my house is as vast as Editors choice 5280 Magazine
New York City, my kitchen as big as Voted best cupcake and chocolate butter cream
a neighborhood. These spaces must - Cupcake Challenge 2009 – Gabby Gourmet
be invisible to him by their sheer
volume, while the shining, distorted
stage kitchen is only a few sizes
too big. If he were on that stage, he Free Delivery (limited area)
would be able to understand its form 1st and Adams in Cherry Creek (129 Adams Street)
in a way he cannot that of the larger 303-322-CAKE
room.
www.bigfatcupcake.com
%U R NH U D J H IR U %X \H U V
D Q G 6H O O H U V6L Q FH    
+XPEROGW6WUHHW +ROO\6WUHHW ()DLUPRXQW'U
%UDGIRUG5HDO(VWDWH
2IIHULQJ5HQWDO
0DQDJHPHQW6HUYLFHV
  
4XDLQWEXQJDORZRQVROLGEORFNFORVHWR:DVK3DUN 7KH DLU\ PDLQ ÀRRU RSHQV WR D SULYDWH EDFN\DUG Z )DQWDVWLF KRPH LQ /RZU\ 9DXOWHG FHLOLQJV GUDPDWLF %UDGIRUG5HDO(VWDWH

5HFHQWO\8SGDWHGNLWFKHQDQGEDWKPDNHWKLVKRPH SRQG JUHDW IRU HQWHUWDLQLQJ 7KH VHFOXGHG PDVWHU UDGLXV VWDLUFDVH JUPW NLWFKHQ Z LVODQG  HDWLQJ
OLYDEOHQRZZLWKGHYHORSPHQWSRWHQWLDOLQWKHIXWXUH VXLWH KDV D SULYDWH EDOFRQ\  SF EDWK 2I¿FH RQ VSDFH)RUPDOGLQLQJUPOJPDVWHUVXLWHIXOO\¿QLVKHG
6T)WORW JUHDWDFFHVVWROLJKWUDLO'RQ¶W0LVV PDLQIRUZRUNLQJDWKRPH PHGLDURRPLQEDVHPHQW EVPWZKLJKFHLOLQJV7RQVRIVSDFHJUHDWEDFN\DUG
%UDG/HZLV 3DXO+HEHQVWUHLW -RUGDQD/HERZLW]
April 2010 Cherry Creek News & Central Denver Dispatch Page 9

Fran Schroeder
Denver Icons
1936 on the old foundations
St. Elizabeth of Hungary is a Catholic by the May Bonfils Trust. The
community composed of both Roman and friary is decorated by a colon-
Byzantine Rites under the nade, Stations of
authority of the Ordinary of the the Cross, and a
Archdiocese of Denver. Saint shrine to St. Francis.
The Roman Rite Mass is cel- Elizabeth After more than a century
ebrated at 9am every Sunday, and of service to Colorado, the New
has over 300 families and single of Jersey Franciscans left in 1983.
participants. The Byzantine Rite
Divine Liturgy is celebrated every
Hungary The Capuchins, another order of
Franciscans, took over the parish
Sunday at 12:00pm. The liturgy is duties. In later years the parish
in English and follows the Russian tradition. became a mission of Holy Ghost parish with
HISTORY the Vincentian priests as caretakers.
St. Elizabeth’s
began in 1878
with a handful
of German fami-
lies who lived on
the west bank of 53"$*
,3*4

,3*45&/
5)&
."5$).",&34
0'
,3*4
,&//:
$0//&$5*0/4

Cherry Creek.
Nine years later
'BMM
*O
-PWF
the Franciscans
5IF
QSFNJFS
NBUDINBLJOH
TFSWJDF
GPS
$PMPSBEPµT
UPQ
TJOHMFT

from New
$"--
64
50%":
'03
"
13*7"5&
$0/46-5"5*0/
"5


Jersey accepted KRIS KENNY CONNECTIONS

care of the par- Very personal matchmaking.
www.kriskennyconnections.com
ish from Bishop
Machebeuf. The
#06-%&3
%&/7&3
7"*-

present church,
1IPUP
DPVSUFTZ
PG
-BVSB
%PNCSPXTLJ
1IPUPHSBQIZ
XXXMBVSBEPNCSPXTLJDPN
]

8BSESPCF
DPVSUFTZ
PG
4XBOL
#PVUJRVF

Homesitter - Available to live in

dedicated in
1898, is the sec-
ond building. It
became famous
in Colorado his-
tory when Fr. Leo
Heinrich, then In the event of an emergency! Will take
care of your home & pets.
pastor, was assas-
sinated while
distributing Holy
Communion at
early morning Bus. Consultant, handyman. Great local References
720-980-8989
Mass on February
23, 1908.
In the 1960s,
after the Second
Vatican Council ruglobal@gmail.com
introduced sweeping changes in Catholic lit- St. Elizabeth’s was turned over to the
urgy, the church interior was completely reno- Archdiocese of Denver in the 1990s. In 1999
vated to its present form. The beautiful stained the community of SS Cryil and Methodious
glass windows were installed at that time. Russian Catholic Byzantine Community was
Next to the church is the friary, rebuilt in added.*** Central Denver
Dispatch & Cherry Creek
News
P.O. Box 460142, DENVER, Colorado 80246
Phone: 303.458.7541

• The Central Denver Dispatch & Cherry Creek News

is published MONTHLY free of charge to its readers. It
is mailed to more than 8000 residences in Denver, and
nearly 300 area businesses.
• The Central Denver Dispatch welcomes news releases,
calendar events, photos and letters.
• Send releases and other information to
submit@thecherrycreeknews.com
We do not accept press releases or calendar materials
by fax.
More advertising information, along with additional
editorial content, can be found on-line at:
www.thecherrycreeknews.com
Letters to the editor must be signed. We reserve the right to
edit letters and other contributions for space. Publisher assumes
no responsibility for return of unsolicited manuscripts or art. We
attempt to verify all matters of fact but hold contributors liable
for the content, accuracy and fairness of such contributions.
The Cherry Creek News is a legal, independent newspaper
of general circulation in Hilltop, Crestmoor, Belcaro, Bonnie
Brae, Glendale, Virginia Vale, Cherry Creek, Lowry and
surrounding neighborhoods.
For advertising information, call 303.458.7541. Discounted rates
for new advertisers with special promotions.
Guerin Lee Green, Publisher and Editor
Page 10 Cherry Creek News & Central Denver Dispatch
Owning fixed income in various
interest rate environments
There’s been growing concern about
the possibility of rising interest rates.
While no one can predict what interest
rates might do, it’s important to under-
stand how rising rates might affect your
fixed-income investments. Then you can
better prepare your portfolio today for
the possibility of rising rates at some
point down the road.
For much of the past 30 years, bond
rates have generally declined. In fact,
it’s been awhile since bonds have been
through a rising rate environment:
• The last instance of rising bond
interest rates occurred from October
1998 to January 2000.
• The last multiyear period of rising
bond rates took place from 1976 to 1981.
As a result, you may not be familiar
with or have forgotten what it feels like
to be in that type of environment. We
believe there is little near-term risk of
rates rising significantly due to current
economic weakness and lack of inflation-
ary pressures. Therefore, there is nothing
immediate that should cause you to
anticipate plummeting bond prices.
Bond Prices and Interest Rates
Most investors own bonds for the
income they provide as well as the
diversification benefits when combined
with stocks. However, you enjoy those
benefits only if you continue to own
the bonds. In general, you shouldn’t
sell your bonds just because their prices
have fallen due to rising interest rates.
Don’t sell based on price changes
– Bond prices will rise and fall – some-
times considerably – due to changing
interest rates. Price declines are a normal
part of owning bonds. But remember,
even if a bond’s price changes, its inter-
est payments stay the same. In addition,
you can expect to receive your principal
back at maturity, assuming the issuer
doesn’t default. Selling prior to maturity
only ensures you lock in your loss.
Understanding interest rate risk –
With short-term fixed- income invest-
ments at historically low rates, more
investors have been buying longer-term
bonds with higher rates to get more
income. That’s not necessarily a bad
idea, and in some cases it may be appro-
April 2010
Finally. Doors That Match the
priate. However, owning too many long-
term bonds can increase your portfolio’s Style and Quality of Your Home.
interest rate risk, because bond prices
will tend to decline as interest rates rise.
Maturities offer different trade-offs
and can work together to help balance
out swings in price and income in your
portfolio. This relationship can be illus-
trated with a teeter-totter. The farther
you move toward the ends of the teeter-
totter, the more you swing up and down.
Similarly, the longer the bond’s maturity,
the more its price can change. As you
shorten the maturi- ties of your fixed-
income investments, the price swings
tend to decrease. There are other bond
features that may affect this relation-
ship, including call features and credit
quality.
Price declines due to rising interest
rates are separate from declines due to
concerns about credit quality. With cred-
it quality issues, there’s a greater risk
the bond issuer might not make regular
interest payments or repay principal
at maturity. Remember, at some point
a bond’s price will go down – maybe
quite a
bit – but that’s usually due to inter-
est rate changes and not credit quality
concerns. Even prices of U.S. Treasury
bonds change due to changes in interest
rates.
The first step is to discuss your fixed-
income investments with your financial Quality Door Replacement
advisor. Together you can determine Service For Your Home
what, if any, changes should be consid-
ered. Remember, the trade- off for the
higher income that longer-term bonds
provide is greater price volatility. The Call or visit our website to schedule
reverse is also true: Shorter-term bonds a complimentary design consultation
will have less dramatic price swings,
but you receive less income. Make sure
you are aware of the risks and prepared (866) 322-8312
for any potential consequences. If your www.transitionsbytrustile.com
portfolio is properly balanced based on
your needs and risk preferences, and
interest rates rise in the future, you may
not need to adjust it after bond and bond Replace Your Doors
fund values have already declined. In Three Easy Steps!
Contact Eric Jasper at the Highlands
Edward Jones office at 303-458-6655, to Complimentary in-home
schedule a review to discuss opportunities to design consultation, at
help move your retirement forward.*** your convenience
Fast and accurate
measurement using
cutting edge technology
Painted doors installed
in one day – with no mess
Achieve Dramatic
Results in Your Home
• Unlimited style options for
every taste and design need
• Sharp architectural details
and crisp clean lines
• Solid construction with
superior sound control
Receive $1000 off your
order of 10 or more doors*
*Must schedule design consultation within seven days and order by April 23rd, 2010
April 2010 Cherry Creek News & Central Denver Dispatch Page 11

World War II vet shaves locks for

childhood cancer research
At an age when many are stepping nearly seven decades later.
back, World War II vet Glen Spaur After the war, Spaur went on LA for
is stepping up. Joining with others, photography school, but found his way Over 30 yrs experience in treating veins and
and raising money from his Denver into the food and beverage industry. He Board Certified in Phlebology.
neighbors, Spaur shaved his hair high setup grocery stores for Safeway, worked EXPERT TOTAL VEIN CARE:
before after
and tight for St. Baldrick’s foundation, for Gallo wines, sold heavy equipment • Spider Veins • Large Blue Veins (Varicose Veins)
the largest funder for childhood cancer and then worked for Budweiser. Along • Swollen or Discolored Legs • Leg Ulcers, Lymphedema
research grants outside the U.S. govern- the way, he lived in Seattle, Portland,
ment, more than $12 million in 2009 married, divorced and remarried. The WE USE THE MOST ADVANCED TREATMENTS:
venous Laser Treatment for Varicose Veins
• Endovenous
(Less side effects and downtime)
• Ambulatory Phlebectomy
FREE
Consultations before after
• Laser Spider Vein Treatment
• Sclerotherapy 303.355.4772 ✓Insurance Accepted
V E I N & AE
A E S TH
T H E T IC
I C CEN TTER
ER OF DE
DENNVV ER a
att LA FON TAI N E A EST
TA IN HE TIC S
ESTHETICS
Ken Oleszek, MD Renald Bernard, Board Certified Phlebologist
2774 East 2nd Avenue • Cherry Creek • Denver, Colorado • 303.355.4772
w w w .Vei n Cen t er Den ver .com
3ȢMǣӰ
ǑOȠ
3ȪOȪӮ

ӭ̢Ư
ΝOȺ
έ

ΝӅS

7ǑMȪͩҿ̢OȺ


Spring
3ȢMǣӰ
ǑOȠ
3ȪOȪӮ

ӭ̢Ư
ΝOȺ
έ
8Ȣ͝͝Oɺ


1BD͕BHɚ



ΝӅS

Glen Spaur with neighbors Gabriel and Todd Daily
&ӱSǑөBHǑ͸[ǣ
Romance! ǣ
HSFǑӂ
H̢̐

˪ΝS
U̙Ⱥ




8Ȣ͝͝Oɺ


1BD͕BHɚ
ǣ
HSFǑӂ
H̢̐

˪ΝS
U̙Ⱥ

alone. St. Baldricks’s raises a substan- retired teamster returned to Denver after
)ͽ͝JEBӲT
$ΝӅѻMɚ
1BD͕BHɚ
)ͽ͝JEBӲT Wellness Center & Spa
tial part of its funds from supporters, his working days concluded. Like so
who contribute on behalf of volunteers many Colorado boys of his generation, (̢̐
$ȪSҿ̢mDǑUɚ

$̙ɂ
͛
ΝӅӂ
ΝӅS
ǑNǣ[̢OH

$̙ɂ
͛
ΝӅӂ
ΝӅS
ǑNǣ[̢OH

who shave their heads. he still loves the outdoors, hunting and
For Spaur, who raised some $1500, fishing. ͳȪӮ
MΕDǑҿJΝ͸
ǑOȠ


ͳȪӮ
MΕDǑҿJΝ͸
ǑOȠ

%Ȣ̢͝WȪSFȠ
ӭ̢Ư
'MΝXȪST
its part of a long story. In 1933, his When it came time to raise money ̉
PǑUǑҿJΝ͸
DȪͩUȪS
̉
PǑUǑҿJΝ͸
DȪͩUȪS
father brought his family to Colorado for St. Baldrick’s, he sent out 53 letters,
from Nebraska. They settled in Lyons,
but by 1937 his father had died. Spaur
and pitched the venture on his Facebook
page, and asked his church for help.



graduated from high school in 1942, and In twenty years in Denver on Julian 
ǑOȪXTѵ̢̢҅ӂD΍ͨ

ǑOȪXTѵ̢̢҅ӂD΍ͨ
like so many of his generation, enlisted Street, Spaur, dressed in a naval avia-
in World War II immediately. He fol- tors flight jacket, is full of life’s lessons 
8
Ư
"WȺ


8
Ư
"WȺ
ǑOȪXTѵ̢̢҅ӂD΍ͨ

ȒMΕD͕T
Fǚґӂ
έ

4̙Ȫ҅JEǑ͸

lowed brother, a Pearl Harbor survivor and passions. “I’ve had one sensational %ȪͩWȪS
$0


8
Ư
"WȺ
of the California, into the Navy. Spaur life. I don’t think I’d change anything I 
ȒMΕD͕T
Fǚґӂ
έ

4̙Ȫ҅JEǑ͸

won his wings, becoming plane Captain
at just 19. Flying DC3 to carry supplies
to frontline troops in the Pacific, he
bounced along makeshift runways on
islands he scarcely could have imagined
back in Colorado. For 3.5 years, he flew
out of Australia, and placed he says he
loved, but doesn’t want to return to
More evidence for talking to
your baby
Staff
Northwestern University research-
ers have found that even before infants
begin to speak, words play an important
role in their cognition. For 3-month-old
infants, words influence performance
in a cognitive task in a way that goes
beyond the influence of other kinds of
sounds, including musical tones.
The research by Alissa Ferry,
Susan Hespos and Sandra Waxman
in the psychology department in the
Weinberg College of Arts and Sciences,
will appear in the March/April edition
of the journal Child Development. In
the study, infants who heard words
provided evidence of categorization,
while infants who heard tone sequenc-
es did not.
Three-month-old infants were
have ever done.” He rattles off his three
daughters, seven grand daughters, one
grandson, with great grand child on the
way.
Of his fundraising, he says “I have
never done something that I so much
appreciate” as the support he’s received
for the St. Baldrick’s.
and tone groups saw exactly the same
pictures for exactly the same amount of
time, those who heard words formed
the category fish; those who heard
tones did not.
"For infants as young as three
months of age, words exert a special
influence that supports the ability to
form a category," said Hespos, associ-
ate professor of psychology and one
of the authors of the study. These find-
ings offer the earliest evidence to date
for a link between words and object
categories."
Participants included 46 healthy,
full-term infants, from 2 to 4 months
of age. Half of the infants within each
age bracket were randomly assigned to
the word group. All infants in the lan-
guage group were from families where
Rec Center site secured— Church in
the City site purchase complete
The City of Denver finalized its pur-
chase of the Church in the City site on
March 9, 2010.
The land, located at 1530 Josephine
Street, was acquired for $6 million and
will be the future home of the central
Denver recreation center. Numerous cen-
trally-located sites were considered for
the central Denver recreation center, with
the Church in the City eventually being
identified as the most feasible after sev-
eral public meetings.
The purchase includes approximate-
ly 2.56 acres, which will eventually be
developed into a recreation center and
may also allow for additional retail pos-
sibilities. In the interim, Denver Parks
and Recreation will fence off the site for
safety during the assessment process,
which will last a few months. Denver
City Councilmembers Jeanne Robb and
Carla Madison, along with Denver Parks
R CLU
FO $
NK
CASH
and Recreation, are meeting with area
neighborhood organizations and East
High school representatives to determine
interim uses for the property.
In 2006, Denver Parks and Recreation
completed a Recreation Center Needs
Assessment, which identified Capitol Hill
and Stapleton as two areas not served by
a recreation center. In 2007, both loca-
tions were included in the Better Denver
Bond package that was passed by Denver
voters.
Voters specifically approved $11 mil-
lion in bond funding for land purchase,
planning and design of a new recreation
center in central Denver. A portion of the
bond funds remaining after acquisition
will be used toward demolition of the
current building and planning of the new
center. Separate funds must be raised for
construction of the facility.
—City of Denver

shown a series of pictures of fish that English was the predominant language
ERS

were paired with words or beeps.
Infants in the word group were told,
for example, "Look at the toma!" –-- a
made-up word for fish, as they viewed
each picture. Other infants heard a
series of beeps carefully matched to the
labeling phrases for tone and duration.
Then infants were shown a picture
of a new fish and a dinosaur side-by-
side as the researchers measured how
long they looked at each picture. If
the infants formed the category, they
would look longer at one picture than
the other.
The results, say the authors, were
striking. The researchers found that
although infants who heard in the word
spoken in the home. The remaining
infants were in the tone group.
"We suspect that human speech,
and perhaps especially infant-directed
speech, engenders in young infants a
kind of attention to the surrounding
objects that promotes categorization,"
said Waxman, a co-author and profes-
sor of psychology. "We proposed that
over time, this general attentional effect
would become more refined, as infants
begin to cull individual words from
fluent speech, to distinguish among
individual words and kinds of words,
and to map those words to mean-
ing."***
$
$
EXTRA DOLLARS FOR YOUR OLD BLINDS & SHADES
Replace your old blinds with new energy efficient
Hunter Douglas blinds & shades and receive an
additional $10 per window off our SALE price!
Pictured: Duette® Architella® honeycomb shades reduce energy loss by up to 50%.
FAMILY OWNED FOR OVER 40 YEARS
303-355-4223
2438 East 6th Avenue
YOUR EXPERTS IN ENERGY EFFICIENT WINDOWS SINCE 1979!
 Lowry News
Cherry Creek News & Central Denver Dispatch

Interested in a Small Landscaping Sue Weinstein

Grant?
The Lowry Community Master
Association is awarding grants for
landscape-related projects. The intent
of the Landscape Grant Program is to
redirect funds into the community for
landscape and other outdoor beauti-
fication projects that will benefit the
quality of life for people who live and
work at Lowry.
Landscape Grants will only be con-
sidered for common-area property that
is owned by the Master Association, the
City of Denver, HOA sub-associations,
or property owned by a non-profit
organization. Requests for landscape
grants associated with private resi-
dences or for-profit businesses will not
be considered.
At a minimum, landscape projects
must address issues like improving
landscape beauty, conserving water,
enhancing recreational areas, preserv-
ing Lowry history, or promoting out-
door safety.
Grants are awarded twice a year in
amounts ranging from $250 to $2,500.
The LCMA values collaborative efforts
and strongly favors applications that
clearly demonstrate how they serve the
Lowry community. To download the
grant application, visit www.lowrylink.
com and click on the LCMA tab.
Applications are due on April 21st
or October 1st.
As the LRA completes the redevel-
opment activities and approaches the
sunset of the organization the staff cre-
ated a “Lowry Story Book” a pictorial
journey of the creation of the Lowry
community is available for sale.
 We are so proud of what Lowry has
become and your part in forming this
wonderful community.  There are so
many elements that contribute to the
unique character of Lowry.  We want
to leave behind this memento of our
appreciation and respect for the history
of Lowry and show some of the fun
times, challenges and hard work that
took place. We also want to show what
exists today that will stand as a legacy
of how this community went from
vision to reality.
 
Thank you for whatever form of
participation you have had over the
past 15 years.  The conversion of a for-
mer military base to a thriving commu-
nity could not have been accomplished
without a team effort that involves
thousands of people.  The LRA appre-
ciates the engineers, masons, heavy
equipment operators, land developers,
employees, home builders, merchants,
sod layers, land planners, home buy-
ers, architects, boards and committee
members, employers, governmental
officials and everyone who spells out
the success of Lowry.     We hope you
enjoy reminiscing and maybe learning
some new facts as you go through the
book.  in the midst of escalation?
 If you would like to place an order,
please fill out the form below and
send a check  made out to the Lowry
Redevelopment Authority to 555 Uinta
Way Denver, Colorado 80230.  Pre-sales
order deadline is March 18, 2010.  The
cost is $50 each that must be paid by
the ordering deadline.  Don’t miss out.  your child’s feelings empathetically. For cal activity, change of scenery (inside to
This will be the final printing so get
your order in now.  A sample book will
be on display at the LRA office.
Oleanna  and now we have to go home and cook
From master playwright David
Mamet comes an embittered power
struggle between a college professor
and his seemingly innocent young
female student. What starts as a simple
miscommunication quickly spirals out
of control leaving all to wonder who
decides where the lines between favor-
itism, sexual harassment, and assault
really lie, and what happens when the
two parties disagree?  As the lines of
communication break down and then
are obliterated altogether a single ques-
tion remains-- once the line is crossed,
can you go back?
John Hand Theater
In the Colorado Free University
Campus
7653 E. 1st Place
Denver, Colorado 80230
Runs April 9 - May 8
Fridays and Saturdays @ 7:30
2 Sundays, 4/18 & 5/2 @ 6:30
Call 303-562-3232 for reservations
Denver's Parenting Coach
Tantrums are inevitable as the help them strategize when needed. Teach
weather, by mastering de-escalation and them a technique or two like breathing
methods for teaching self-soothing to or taking space to calm their bodies
your (sometimes) explosive child is a down when they have gotten frustrated,
key parenting skill. angry, or anxious. You can
There are many model for them, or help
things to pay atten-
Handling them try it the first few
tion to before your Tantrums times. “I see you get very
child explodes— his upset and end up throw-
temperament, her nap ing your books around
time, transitions, crowds, and numerous whenever you start your math home-
other triggers that you know set your work. We don’t throw books at home or
child off. But what quick methods work at school. I have an idea, how about we
best when trying to help your child calm try some other ways, like breathing, to
down when the inevitable occurs? How help you calm down instead. Here I will
can you teach your child to self-soothe demonstrate for you”. Teach a relaxation
breathing method, or encourage your
For young children, a parent must child to take some space and very short
realize (after they are calmed down breaks to keep the frustration manage-
themselves) first and foremost, that able. Reinforce the new behavior when-
their child is having a tantrum for a ever they make an effort to use it.
reason or a need—even if it is a reason Other quick techniques to soothe may
the parent dislikes or disapproves of. come in handy in the midst of a tantrum
Find out what the reason is and address or an explosive bout of emotions: physi-
example, “I know you want to stay at outside or vice versa), tactile or sensory
the park and you are enjoying yourself, play/activity (warm bath, cold towel
but I gave you a five minute warning around the neck, using clay). Sometimes
these are just enough to take down the
dinner otherwise we will get hungry”. intensity of the emotion for your child
Or, “I am sorry play time is over and just a notch, enough for you to try some
you are disappointed, but we can come other techniques or even distract your
back another day when we have more child when appropriate.
time and you can stay longer. I know The idea for all these steps is to
you will enjoy that.” A simple feel- help soothe or calm your child first
ing statement like this helps identify and not to be punitive. Once the inten-
and reflect for your child his feelings. sity and stress of the situation has been
Children cannot learn to regulate feel- lowered, then you could intervene to
ings until they can clearly identify them help teach, use positive discipline, or
in themselves. We help teach them how encourage them to get through what
to identify and regulate when we use they are struggling with. We must lower
empathetic statements. the intensity of the situation and work
Once you think you understand towards teaching our kids to learn how
what you child needs, and empathize to handle intense emotions themselves
with her, sometimes an added level of without harming themselves or others.
attention like getting down at eye level, We are there to teach our children how
and looking your child right in the face to handle their distress, not punish them
while calmly addressing her feelings/ for feeling it.
needs helps your child to feel connected Susan Weinstein MA, MSW, LCSW, The
and understood. Sometimes, this simple Denver Parenting Coach, for more information.
tactic is the beginning or just enough to The Denver Parenting Coach provides free par-
help defuse the child’s frustration and enting consultations and presentations please
stop further escalation. call 720.240.7070 or visit the website theden-
Monitor you child’s emotions and verparentingcoach.com for more information.

Learning struggles?
We can help.
Guaranteed!

www.learningrx.com/denver-cherry-creek
(303) 284-6105
88 Steele Street, Suite 50
Denver, CO 80206

50
S ome kids struggle through school. Homework is frustrating. Focusing is difficult. Grades are

% *
disappointing. And it seems no matter how much harder they try, the problem persists. But if you act now,
it doesn’t have to be that way forever.

LearningRx specializes in helping students overcome learning struggles. Our program starts
with a personalized “Cognitive Skills Assessment” that pinpoints deficient learning skills. Then, we customize a
12 to 24 week program to strengthen your child’s deficient skills.

If your son or daughter has weak cognitive skills, no amount of tutoring, medication or trying harder will
COGNITIVE SKILLS TEST
off
achieve the results that LearningRx brain training can. The potential for good grades, a positive attitude (Regularly $199)
and long-term success exists in every child. Unlock your child’s learning potential today! Expires 3/31/2010