You are on page 1of 295

MANUAL DE EJECUCIN

PENITENCIARIA

J Rios_

PRLOGO
PrimerofueAprenderadefenderseenprisin.Luego,hacepocomsdedosaos,llegelManualparala
defensadelaspersonaspresas.PrologaronrespectivamenteaquelloslibroselFiscalAntoniodelMoralyelProfesor
FranciscoBuenoArs,hombresbuenos,buenosjuristasyhumanistas,maestrosdemuchos,tambinmos.staltima
obra,porahora,deJulinCarlosRosMartnenraizaenaquellasperolassuperaencalidadyriquezadecontenidos.La
notoriamenorvaladelprologuistaesdefectoquesabrperdonarellector,sobretodosi,sensatamente,optaporrehuir
elprlogoypasardirectamentealcaptuloprimero.
Porsialguienpiadosoodespistadocontinaleyendo,quedeaquelogiodelautoryelescrito.Sehadichoquela
bondadesunaformasuperiordeinteligencia.Labondadtrasciendeencadapginadeestelibroquetienesubrilloysu
gloriaenlaconscienterenunciaabrillarygloriarse.Alolargodedieciochocaptuloselautorsesitaenellugardel
preso,ensusmiedosytribulaciones,ensupielysepregunta,sepregunta,sepregunta.Luego,consingularlucidez,
responde.Latcnica,quevagamenterecuerdaladelosviejoscatecismos,puedeparecersencilla.Sialguienlocreeas,
pruebeaformularsecercadecuatrocientaspreguntascomolasqueaquaparecenyacontestarlas,conrigor,concitasy
altiempointeligibleaunparalosmenoscultos,ydesuerteque,sinmenguadetodoello,enlasrespuestavibrela
esperanzaylaapuestaporelhombreyporlavida.EsohahechoJulin.Enlaspginasquesiguenestlaentradaenla
prisinylasalidaytodalavidaolamuerteentreesosdosmomentosyaunmsalldeellos:recuentosysanciones,
permisos y recursos, trabajo y maternidad, enfermedad y droga, traslados y comunicaciones, excarcelaciones y
supervivencia...Uncentenardeformulariosomodelosdemuyvariadosescritoscompletanlaexposicinypueden
servirdeguaalospresosensusquejas,peticionesyrecursos.
Porqueellibro,tilparatodos,necesarioparamuchos,estescritoparalospresos.Personassobreelpapelyenlas
grandesyvacuasdeclaraciones.Seresolvidadossalvoparaquieneslosamany,quiz,parajuecesyfuncionarios,que,a
veces,losrecordamosporquenonosquedaotroremedioy,conmsfrecuenciadeladeseable,loscomplementamos
comofuentedeinsomnioyamargura,comolosquetandurotornannuestrosalario.Lejanosquiznoajenosasu
desgracia,anlesreprochamosquesudesgracianossalpique.Personasdecarneyhuesoparaelautor,quesufrecon
ellas,queapuestaporellasyconellaspierdeypierdeypierdeygana.Queridasyrespetadasporpersonas,msanpor
presas,enlavidayencadalneadeestelibro,que,sinembargonoestescritocontranadie.Sinunabriznadeodio,sin
unreproche,sinunadescalificacinounapalabraofensivaestaobraparecelimitarsusobjetivosodulcificarelsistema
de prisin imperante. Pero en la desnudez de la exposicin, en la sencillez de las reflexiones y los datos, en la
representacindelanormalidaddetodoslosabsurdoshayunacargadeprofundidadquerevientaesesistema,que
cuestiona la congruencia de su aplicacin prctica con sus pretendidas races ideolgicas, que lo denuncia como
estrilmentecruel.Alautorlesobramodestiayalosdemsnosfaltaperspectivaparavalorarloquehahecho.Creo,sin
embargo,noequivocarme,siauguroparalospresosylosnopresosunantesyundespusdelosestudiosdeJulin
CarlosRos.Yeldespussermejor.

Arturo Beltrn Nez


Noviembrede1998

NDICE

PRLOGO
CAPTULO1.INGRESOENLAPRISIN.FUNCIONARIOSYRGANOSDEGESTIN
CAPITULO2.LUGARDECUMPLIMIENTO,TRASLADOSYCONDUCCIONES
CAPITULO3.OBSERVACIN,CLASIFICACINYTRATAMIENTO
CAPTULO4.TIPOSDECRCELESYRGIMENDEVIDA
CAPTULO5.LIBERTADCONDICIONALYBENEFICIOSPENITENCIARIOS
CAPTULO6.LOSPERMISOSDESALIDA
CAPTULO7.LASCOMUNICACIONES
CAPTULO8.RGIMENDISCIPLINARIO
CAPTULO9.REDENCINDEPENASPORELTRABAJO
CAPTULO10.CACHEOSPERSONALESYREGISTROSENLASCELDAS
CAPTULO11.MEDIOSCOERCITIVOSYRECUENTOS
CAPTULO12.ELTRABAJOREMUNERADOENLAPRISIN
CAPTULO13.ASISTENCIASANITARIA
CAPTULO14.LOSFICHEROSDEINTERNOSDEESPECIALSEGUIMIENTO(FIES)
CAPTULO15.INFORMACIN,QUEJAS,PETICIONESYRECURSOS
CAPTULO16.MECANISMOSDEDENUNCIADEVULNERACINDEDERECHOSANTEORGANISMOS
INTERNACIONALES
CAPTULO17.CUESTIONESPENALESYPROCESALESRELATIVASALAEJECUCINDELAPENA
DEPRISIN
CAPTULO18.EXTRANJEROSENPRISIN
FORMULARIOS

Captulo 1

INGRESO EN LA PRISIN. FUNCIONARIOS


Y RGANOS DE GESTIN

1. Por orden

de quin se realiza el ingreso

en una crcel?

a)Siunapersonahasidocondenadaylasentenciahaadquiridofirmeza1,esnecesarioqueelJuzgadoo
Tribunalsentenciadordicteunaorden(mandamiento)deprisinparaqueingreseenlacrcel.Paraproceder
asuliberacinsernecesarioqueelJuzgadooTribunalsentenciadorapruebelalibertaddefinitiva.Paraello,
el director de la crcel deber proponer al Juzgado o Tribunal sentenciador una fecha para la libertad
definitivaquecoincidirconlaqueconsteenlaliquidacindecondena.Estapropuestadebehacersedos
mesesantesdeldadeextincindelacondena.Siquincedasantesdelafechapropuestanosehubiese
recibidorespuesta,eldirectordebervolverapedirlapropuestadelibertad,advirtiendoquedenorecibirse
ordenexpresaencontrario,seprocederaliberaralreclusoenlafechapropuesta(art.24RP).Sielpenado
estuvieracumpliendolapenaenlibertadcondicionallapropuestalatienequerealizareldirectordelacrcel
enlaqueseencuentreadscrito(normalmenteunCentrodeInsercinSocial).Siseconcedeunindulto,la
personapenadanoquedarlibrehastalaordendelibertaddelJuzgadooTribunalsentenciador(art.25RP).
Sielpenadotienealgunacausapendienteapesardehaberextinguidolacondenaqueestabacumpliendo,el
directorledebeinformardelacausapenalporlaqueseencuentraretenido,asimismolocomunicarala
autoridadjudicial competente (art. 29RP). Si una persona condenada tiene dudas sobre de la fecha de
finalizacindelacondenapuedesolicitaralsubdirectordergimen,atravsdeunainstancia,unahojade
clculodecondena.Enestedocumentoseestablecenlasfechasquetienenimportancialegal(1/4partepara
los permisos, 2/3 y para la libertad condicional y 4/4 para la libertad definitiva). En caso no estar
conforme con esas fechas hay que hacer un escrito de queja al Juzgado de Vigilancia Penitenciaria
explicandolosargumentosquesetienen.
b)Siunapersonaseencuentraenlacrcelalaesperadejuicio(prisinpreventiva),elmandamientode
prisindebirealizarloelJuezdeInstruccinolaautoridadjudicialadisposicindequienseencontrabaen
el momentodel ingreso. Para suexcarcelacin es necesario el mandamiento de libertad firmado por la
Autoridadcompetente.Cuandolleguealacrcellosfuncionariosdelaoficinadergimentienenquerealizar
unaseriedegestionesycomprobaciones(Instruccin19/96DGIP).Enloquerespectaalapersonapenada,
seletienequeentregarunacertificacinacreditativadeltiempoqueestuvoprivadodelibertad(art.22RP).
c)Tambinpuedeocurrirqueelingresoseaexclusivamenteencalidaddedetenido.Estasituacinvendra
a tener los mismos efectos que el ingresoen las dependencias policiales. En este supuesto, si la orden
procededelapolica,enelladebernconstarexpresamente:losdatosidentificativosdeldetenido,eldelito
imputado,queseencuentraadisposicindelJuezyeldadevencimientodelplazomximodedetencin.Si
ladetencinhasidoacordadaporelMinisterioFiscaldebernconstarlasdiligenciasdeinvestigacinquese
estnpracticando,yelplazomximodedetencin(art.15RP).Unavezvencidoelplazodedetencino
pasadas72horasdesdequeingresenprisinbajomandamientodelaautoridadcompetenteoingreso
voluntario,eldetenidoquedarenlibertadsinosehalegalizadosusituacinporlaautoridadjudicial(art.
23RP).

2. Una persona condenada


prisin para cumplir la pena

puede presentarse voluntariamente en la


que le ha sido impuesta?

S,puedepresentarsey,entodosloscasos,tienequeseradmitida(art.16.1RP).Eldirectordelacrcel
tienequecomunicar,dentrodelasveinticuatrohorassiguientes,alJuezoTribunalquehayadictadolaorden
deingresoenprisinquelapersonacondenadaacabadeingresarvoluntariamente.Asimismopediral
Juzgadoelmandamientodeprisin,eltestimoniodelasentencia2ylaliquidacindecondena.Tambinse
considerapresentacinvoluntarialaqueserealizaanteelJuzgadooTribunalsentenciadorparacumplir
condenaanteelllamamientooficial.
1

Unasentenciaesfirmecuandoyanosepuederecurrir,bienporquesehayanpasadolosplazosparaello(5dasdesdelaltima
notificacinpararecurrirencasacinanteelTribunalSupremolassentenciasdictadasporlasAudienciasProvinciales;10daspara
recurrirenapelacinantelasAudienciasProvincialeslassentenciasdictadasporlosJuzgadosdelopenal;y20daspararecurriren
amparoanteeltribunalConstitucionalcualquierresolucinquedporfinalizadototalmenteelprocedimientoyquehayavulnerado
algn derecho fundamental recogido en la Constitucin), o bien cuando el Tribunal correspondiente haya resuelto el recurso
interpuesto.

EltestimoniodesentenciaesunacopiadelasentenciaquehasidoselladayautenticadaporelsecretariodelJuzgado.Este
documentoesmuyimportanteporque,hastaquenolleguealacrcel,elpresonopuedeserclasificado.

PuedeocurrirqueelJuzgadosolamenteremitaelmandamientodeprisin.Enestassituaciones,loms
indicadoesque,afindeagilizarelprocesodeclasificacin,lafamiliaoelabogadoacudaalJuzgadoypida
eltestimoniodelasentenciaosolicitequelomandenalacrcelloantesposible.
Ahorabien,sitranscurridassetentaydoshorasnosehubierarecibidoelmandamientodeprisin,la
personadebeserpuestaenlibertad(art.16.4RP).
TambinseconsiderapresentacinvoluntariaalosefectoslegaleslapersonacinenelJuzgadoeldaque
elcondenadoesllamadoparacumplirlacondena.
Lapresentacinvoluntariaacumplircondenadebeconstarexpresamenteenelexpedientepersonal.En
cualquiermomentodelcumplimientodelacondenalapersonapuedesolicitarqueledenunacertificacin
acreditativadesupresentacinvoluntaria,yeldirectortienelaobligacinlegaldedrsela(art.16.2RP).
Presentarseacumplircondenadeformavoluntariapuedeserpositivoporvariosmotivos.Porunlado,se
puedeacudiralacrcelquesequiera,sibienesciertoquetraslaclasificacinelpenadopuedeserdestinado
acualquierotra.Porotrolado,lapresentacinvoluntariapuedeserunelementoatenerencuentaenla
clasificacinyenlaconcesindelospermisos,todavezqueevidenciaexplcitamentelavoluntaddela
personapresadesometersealcontroldelaautoridadpenitenciariaparaelcumplimientodelapenaprivativa
delibertad.Enestoscasoselriesgodeuneventualquebrantamientodecondenaesmuyreducido.Porotro
lado,lapresentacinvoluntariaesunindicioderesponsabilizacinporlaconductadelictivacometida,toda
vezqueesunaformadeasumirlasconsecuenciasdesuaccindelictivaypuedeservaloradapositivamente
paralapropuestadetercergradoporlaasuncindelaresponsabilidadporloshechosdeclaradosprobados
en la sentencia (I 9/2003 DGIP). En este mismo sentido, para las ocasiones en que la administracin
penitenciariadeniegueunpermisoounaprogresindegradoolalibertadcondicionalconelargumentode
queelpenadonoasumelaresponsabilidadporloshechoscometidos,siempresepuedealegarlapresentacin
voluntariacomoformadeasuncindelamisma.

3. Qu es la liquidacin de condena?
Es el documento en el que se establece el tiempo de condena que un penado tiene que cumplir. Lo realiza
y firma el secretario del Juzgado o Tribunal sentenciador, previo informe del fiscal. Se manda a la persona
condenada y al director de la crcel en que se encuentre cumpliendo condena para que sea unido al
expediente penitenciario. El tiempo efectivo de cumplimiento que se refleja en este documento parte de la
condena total impuesta en la sentencia de la que hay que deducir de la misma los das de detencin policial y
los de prisin preventiva (hay que ver la problemtica del art. 58 abono de prisin preventiva de otras
causas-, cap.17). El cmputo se hace en das, contando los meses en 30 das y los aos en 365. Cada pena
impuesta exige una liquidacin individualizada. Si el penado se encuentra cumpliendo prisin, cuando se
deduzcan los abonos correspondientes, la condena comienza a cumplirse desde la firmeza de la sentencia que
ser facilitada por el Juzgado o Tribunal. Si el reo no est preso, la fecha inicio ser el da en que ingrese en
la crcel, computndose tanto el da de entrada como el de salida, independientemente de la hora a la que se
produzca (art. 38 CP) (ver Instruccin 19/96 DGIP).

4. Las mujeres presas que tengan hijos menores pueden ingresar en la crcel
con ellos?
S.Enestoscasos,ladireccindelacrceldeberadmitirlascuandoloshijosconlosqueingresensean
menoresdetresaos.
Ahorabien,esnecesarioqueseacreditedebidamentelafiliacin,ascomolaedad,yquelaestanciadelnio
enlacrcelnolesupongariesgos.LadecisinqueseadoptesedeberponerenconocimientodelMinisterio
Fiscal (art. 17.1 RP). ste puede aplicar las medidas de proteccin recogidas en la Ley 2/87, de 11 de
noviembre.PuedeinstaralasEntidadespblicaslaaplicacindemedidasdeproteccinaniosingresados
encentros penitenciarios,ydebe recurrir lasresolucionesperjudicialesparaelmenor (instruccinFGE
6/1990, de 5 de diciembre, sobre menores ingresados en los Centros Penitenciarios de mujeres con sus
madrespresas).
Silasmujerespresashubieseningresadosinloshijosmenoresdetresaosqueestuviesenbajosupatria
potestad,pueden,conposterioridadalingreso,solicitaraladireccindelacrcelquestosingresenpara
tenerlosensucompaaenelinteriordelamisma.Estasolicitudseconcedersiemprequeseacredite
debidamentelafiliacinyquetalsituacinnoentraariesgoparalosnios(art.17.2RP).Encasode
conflictoentrelosderechosdelnioydelamadre,prevalecernlosdeaqul.
Seexcluyelaposibilidaddequeseaelpadreelqueingreseconsuhijoapesardetenerasumidaslas
funcionesbsicasdecuidadoyguardaenelmomentodelingreso,sobretodoenloscasosenlosquela
madreseencuentreausente.Estaexclusinpuederesultarinjusta.

5. Cmo se realiza el ingreso en prisin?


Normalmente,laspersonassoncitadasenlasecretaradelJuzgadopararealizarelingreso.Siacudeser
conducidoaloscalabozosy,deah,alacrcel.Enalgunosjuzgadossepermitequelapersonaingresepor
sus propios medios con el mandamiento de prisin que le han facilitado en el Juzgado (presentacin
voluntaria). Si no acude al llamamiento se dictar una orden de busca y captura que aparecer en las
terminalesdelosordenadoresqueseencuentranenlascomisaras.LaPolicaylaGuardiaCivilpueden
accederalosmismosconsuemisora(oalosordenadorescentralesBertaoDuquedeAhumadapara
comprobarsiunapersonaseencuentraenbuscaycaptura.Enestaoperacinseutilizantresindicativos:
blanco,quesignificaquenoexisteningunaresponsabilidadpenalpendiente;amarilloonaranja,quesupone
quelapersonaesdeinterspolicial;ynegro,queacreditalasituacindebuscaycaptura.
Alingresarseprocedeasuidentificacin.Aestosefectoslapolica,sihasidoquienhaconducidoala
personahastalacrcel,tieneobligacindecontrastarlaidentidaddeldetenidoyhuellarelmandamientode
prisinenel anverso, si nocontodoslosdedos, al menoscon el ndice opulgarde la manoderecha,
indicandodequdedosetrata.Unavezenlaprisin,losfuncionariosdedactiloscopiahandecomprobarla
huellaquefiguraenelmandamientodeprisin.
Posteriormente,setomanotadelafiliacincompleta(nombre,apellidos,direccinenlibertad),yse
efectalareseadactilarqueconsisteentomarlahuelladetodoslosdedosdelasdosmanos.Encasodeque
faltealgndedo,ostenopuedaserhuellado,existenunasclavesdeterminadasparadejarreflejadatal
circunstancia.Tambinsehaceunareseafotogrfica(art.18RP).Paralaidentificacinpersonaldelos
detenidos,presosypenados,sondocumentosnecesarioslosquecomotalsehaganconstarenlasrdenesde
detencin de la polica judicial, en las diligencias de investigacin dictadas por el Fiscal y en los
mandamientos de las autoridades judiciales competentes, as como los documentos de identidad (DNI,
permisodeconducir,pasaporte,uotrosanlogos)queportenlospropiosreclusosobienseadjuntenenla
documentacin que acompaa a los citados primeramente (I 12/2001 DGIP). Los DNI se recogen y se
anotarnlasfechasestimadasdecaducidaddelosdocumentosyelprocedimientoparacontactarconlos
trabajadoressocialesadscritosalcentropenitenciarioaefectosderenovacin(I12/2001DGIP).
Losdatosobtenidosde cada personapresaseremitena incursos penitenciariosqueesun sistema
informtico en el que se encuentran todos los datos procesales y penitenciarios de la poblacin reclusa
espaola.Estesistemaofrecediferentesposibilidadesdeinformacintalescomoingresos,libertades,salidas,
frmuladactiloscpica,consultasporNIS,porsobrenombres,etc...;suregulacinseestableceenlaI13/99
DGIP.
Es en este momento cuando comienza la vida en prisin.. En este punto resulta espectacular la
mixtificacinquesellevaacaboenelfolletodepropagandaElsistemapenitenciarioenEspaaeditadopor
laDireccinGeneraldeInstitucionesPenitenciarias.Elmomentoenquelapersonaingresaeselinstanteen
quedebedejaratrssuidentidadsocialparaadoptarlanuevaidentidaddepreso.Esportantoelmomento
del despojo. Como en todas las instituciones totales, esto queda plasmado en una serie de rituales de
expoliacinquesuelenacompaarsedeundesnudamiento,msomenoscompleto:lapersonasedesprende
de lo suyo, le es arrebatado lo que le era propio hasta ese momento, para poder asumir los signos de
identificacindelnuevorolalquelainstitucinleconmina.Sinembargo,esteritualdedegradacinmso
menosinevitable,espresentadoenelfolletoantedichocomounarealidadinvertida.Trasleerlo,esevidente
quesepretendehacercreerquelapersonanoesengullida,devoradaporlainstitucinalaqueentra.Ms
bien,lacrcelesunespacioclidoqueadopta,acoge,recibecariosamenteaquienseincorporaaella.De
hecho,eltrminolacrcelnoexisteendichofolleto.Esunapalabraproscrita.nicamenteexisteelcentro
penitenciario,omseufemsticamente:elC.P.Comomuchosellegaanombrar,aunquemuypocasveces,la
palabraprisin.Eneltextoquepresentalaceremoniadelingresosedeclaraquesteseefectaintentando
paliarenlamedidadeloposibleelimpactonegativoquesufrelapersona.Porello,noesextraoquese
prodiguen tanto los verbos que expresan donacin, entrega, cuidado: se le entrega una tarjeta
identificativa,oloqueeslomismo,selequitaelDNI,yseledaundocumentodeidentificacininternoa
lavezqueseparayalejaelmundoexterior;loqueseledaesunatarjetaquecertificasucondicinde
incluido(enlacrcel)/excluido(delasociedad);selesuministraunlotedeproductoshiginicos,esos,
tras haberle retirado los objetos no autorizados; si no tuviera ropa, se le entrega gratuitamente por la
administracintantoropapersonalycalzado,comoropadecama,etc.Endistintosmomentosseinsiste
machaconamenteenelcarctergratuitodelacrcel.Esacaractersticadeinternamientocuasihoteleroen
rgimendegratistotalresultaextraordinariamentesospechosasilaponemosenrelacinconlamultitudde
testimoniosrecogidosquehablandelaenormecantidaddegastosquegeneralacrcelparaelpreso.
Msadelanteprosigue:desdeelprimermomentosecuidaqueelinternomantengarelacinconelmundo

exteriorautorizndolecomunicacionestelefnicas,postales,ypersonales. Loquesepublicitacomoun
derrochedebenevolencianoesmsquelaautorizacindelejerciciodelosderechosqueanmantienenlos
ciudadanospresos.Encambio,sepresentacomounaespeciedepreocupacinpaternalencaminadaalograr
quenopierdansusamistadesyrelacionesfamiliares.Puedenrecibirrevistasyperidicos,ohacerusode
lasqueseponenadisposicindelosinternosenlabibliotecadelCentroquetambincedegratuitamente
librosparaestudioylecturaatodoslospresosquelodeseen.Tratndosedeunabibliotecadeuncentrode
laadministracinpblicanotienenadadeextraordinarioqueelaccesoasusfondosseagratuitoparalos
usuarios,talycomoocurreentodaslasbibliotecaspblicas.Poresomismo,lainsistenciaensubrayarla
gratuidaddelservicionodejaderesultarchocante.Igualmente ellavadodelaropaseefectaenlas
instalacionesdelaprisintambincon carctergratuito. Nuevamenteseinsisteenlagratuidaddeun
servicio que obviamente debe prestarse, y que debe hacerse de forma gratuita. Pero el colmo de la
generosidad de la institucin llega hasta el punto de consignar que en el caso de que el interno sea
indigente,laAdministracinleproporcionarecursosparahacerfrentealosgastosdebolsillo".Conlocual
acabaderematarselatesispublicitariaoficialdelacrcelcomounaespeciedehotelocolegiomayorenel
que hasta el dinerode los pequeos gastos est cubierto por la administracin publica. Claramente se
pretende evitar que pueda seguir hablndose de la crcel como pozo, como agujero destructivo y
desestructurador.Entodocaso,paralapublicacinoficialsetratardeunhuecomaternal,unverdadero
tero,queprotegeyresguarda.
Alingresarsedaacadapersonaunlotedehigienequeserenovarcadames(I10/2001DGIP):parael
hombre: 3 rollos de papel higinico, 1 pasta dental, 3 maquinillas de afeitar, 1 cubierto de plstico, 4
preservativos,1botelladeleja,1botedegel,1decremadeafeitar,1pastilladejabn.Paralasmujeres:4
rollosdepapelhiginico,1pastadental,1cubiertodeplstico,4preservativos,1botelladeleja,1degel,1
pastilladejabn,20compresas.Cadaaoseda1peine,1cepillodental,1esponjayunbasodeplstico
duro.

6. Qu ocurre cuando ingresa un extranjero en un centro penitenciario?


Siquiere,puedecomunicarsudetencinalarepresentacindiplomtica;elmismoderechotendrcada
vezquelecambiendecentropenitenciario.Paraelloselefacilitar,dentrodelas48horassiguientesal
ingreso,undocumentoquereflejaelcitadoderechoafindequeserealicealamayorbrevedad.Encinco
dasdesdesuingresoseleentregarundocumentotraducidoasuidiomaconlasposibilidadeslegalesque
tieneparasolicitarlaaplicacindetratadosinternacionalesomedidasqueafectenasusituacinprocesalo
penitenciaria,ascomoladireccinytelfonodesurepresentacindiplomtica(I14/2001DGIP).
En caso de que estas personas no tengan documentacin personal se har constar en la hoja personal,
indicandoenlasobservacioneslosdatosqueelpropioreclusohubieseaportado.Enelplazodeunmesla
crcel proceder a iniciar los trmites para la obtencin de la documentacin personal a travs de las
autoridades judiciales, representaciones diplomticas y comisaras provinciales. La crcel proceder a
tramitar ante la Comisara Provincial la obtencin del INE (Nmero de identidad de extranjeros
correspondiente)paracadapresoextranjero.
DentrodeloscincodassiguientesalingresoelDirectordartrasladoalaDelegacindelgobiernode
todoslosdatosdelosextranjerosquehubieseningresadoenprisinprocedentesdelibertadaefectosdelo
dispuestoenlanormativavigenteenmateriadeextranjerareferentealexpedientedeexpulsin.Lamisma
comunicacinserealizarencuantoserecibaelmandamientodelibertad(I.14/2001DGIP).

7. Cules son los pasos siguientes al ingreso en prisin cuando se han


tomado a la persona presa todos los datos de filiacin?
Cuandosehantomadolosdatosdefiliacin,losfuncionariosprocedenauncacheopersonalyaunregistrode
losenseres,requisandolosobjetosnoautorizados.Acontinuacinseleconduceaunaceldadeldepartamentode
ingresos.Normalmente,dentrodelasveinticuatrohorassiguienteslapersonapresadebeservisitadaporelmdico,
eltrabajadorsocialyeleducadorafindequestospuedandetectarreascarencialesnecesitadasdetratamiento,y
otrasnecesidades.Estosprofesionalesemitirnuninformeenelqueseaconsejarsobrelaseparacindeunpreso
deotroenelinteriordelacrcel(enunmdulouotro)odetrasladoaotrocentro,ascomounaplanificacin
educativa,sociocultural,deportiva,yotrasactividadesdedesarrollopersonal(art.20.1RP).Acontinuacin,las
personas presas tienen que ser entrevistadas por el resto de los miembros del Equipo Tcnico quienes,
despusdeanalizadassuscircunstanciaspersonales,debeninformarsobreeldepartamentodedestinoas
comoformularunprogramaindividualizadodetratamientosobreocupacinlaboral,formacinculturaly
profesional,aplicacindemedidasdeayuda,tratamientoylasquehubierandetenerseencuentaparael
momentodelaliberacin(art.20.2RP).Normalmenteelpsiclogosolamenteentrevistaaloscondenados

pordelitoscontralavidaylalibertadsexual.
La informacin personal obtenida, as como la programacin individualizada de intervencin y
tratamientosonderealizacinobligatoriaporelpersonaltcnicodelaprisin.Losdocumentosenlosque
constenpodrnsolicitarseparasuincorporacinalosexpedientesdelJuzgadodeVigilanciacuandose
interpongaunrecursopordenegacindepermisosdesalidaocontralaclasificacinpenitenciariaanteel
Juez de Vigilancia y/o ante el Juzgado o Tribunal Sentenciador la Audiencia Provincial (ver modelos
relativosapermisosygradosdeclasificacin).
Posteriormenteesobligatorioelaseomedianteunaduchaylaretiradadelaropaparaserlavada,traslo
cual,seleentregarencondicionesdeuso.Siestuviesemuydeteriorada,laprisintienelaobligacinde
facilitarlaqueleseanecesaria,tantodeinviernocomodeverano,ascomocalzado(art.18.2RP)adecuado
asutalla.Encasodequenosefacilite,osielcalzadonoesapropiado,debeinterponerseunaquejaanteel
JuezdeVigilancia(modelonmero1).
Porltimo,seleinscribeenellibrodeingresos(denominado de altas y bajas) yseabreunexpediente
personal,salvoqueyatuvieraunoanteriorporhaberestadoingresadoenesamismaprisin,relativoasu
situacinprocesalypenitenciariadelquetendrderechoaserinformado.Tambinseabreunprotocolode
personalidad(art.18.1RP)documentoadministrativo,gestionadoporlajuntadetratamiento,enelque
constanlosinformeselaboradosporlosprofesionalesdelreadetratamiento.
Eltiempomximodeestanciaeneldepartamentodeingresosser,comomximo,decincodasyslo
podrprolongarsepormotivosdeordensanitario,oparapreservarsuseguridad.Deestaprolongacinse
darcuentaalJuezdeVigilanciaPenitenciaria(art.20.3RP).
AcadapenadoseleasignaunNmerodeIdentificacinSistemtica(NIS).Estenmeroseasignara
cadapersonaysersiempreelmismoparacadaingreso,situvierevariosposteriores.Constadediezdigitos:
AA.JJJ.NNNNN(A:Aoenelqueseproduceelprimeringreso,J:detalingresodentrodelao;N:nmero
deidentificacinpersonalasignadoalpenado.Ej:siunapersonaingresael25defebrerode2003ysele
asignaelnmero789suNIS03.56(31deeneroms25defebrero).00789.Conestenmerosedaacada
penado una tarjeta de Identificacin interior en la cual figurar nombre y apellidos del interno, NIS,
fotografayreseadactilogrfica.Eldocumentodeberestarenbuenestado,procedindoseasusustitucin
cuandoseobservealgunadeficiencia.Paraelpagodelpeculioesrequisitoindispensablelapresentacinde
esteDocumento,asimismoserexhibidocuandocualquierfuncionariolorequiera(I19/96DGIP)..

8. Qu ocurre cuando una persona ingresa con una orden de prisin


incomunicada?
ElJuezdeInstruccinoTribunalpodracordarladetencinoprisinincomunicadaparaevitarquese
sustraiganalaaccindelajusticiapersonassupuestamenteimplicadasenloshechosinvestigadosoque
oculten, alteren o destruyan pruebas relacionadas con su comisin, o que se cometan nuevos hechos
delictivos(art.509LEcr.)Laincomunicacindurareltiempoestrictamentenecesarioparapracticarcon
urgenciadiligenciastendentesaevitarlospeligrosanteriores.Laincomunicacinnopodrextenderporms
decincodas.Enloscasosquelaincomunicacinselleveacaboporcausadealgunosdelosdelitosdelart.
384bisosetratedeinvestigacionesqueafectenaactividadespropiasdeladelincuenciaorganizada,la
incomunicacinpodrprorrogarseporotroscincodasms.Noobstante,elJuezoTribunalqueconozcala
causa podr mandar que vuelva a quedar incomunicado el preso, an despus de haber sido puesto en
comunicacin,siemprequelacausaofrecieremritosparaello(Art.509.2LECr.).
Enestoscasos,unavezquesehanpracticadolasdiligenciasdeidentificacin,lapersonaincomunicada
pasaraocuparunaceldaindividualeneldepartamentoqueeldirectordispongayserreconocidoporel
mdico.nicamentepodrcomunicarconlaspersonasqueexpresamenteseanautorizadasporelJuezque
ordensuingresoenprisin(art.19RP),siemprequenofrustrenlosfinesdelaincomunicacin(art.510.2
LEcr.).
Paraquelapersonaincomunicadapuedadisponerdeaparatosderadio,televisin,prensaescritaorecibir
correspondencia,eldirectordeberecabarlaautorizacincorrespondientedelJuezdeInstruccinencasodequela
ordendeincomunicacinnoespecifiquenadaalrespecto.

7. Las personas presas que no tengan nacionalidad espaola pueden


comunicar su ingreso en prisin al Consulado de su pas?
S.Paraelloselesinformardeestederechodeformaqueseacomprensible.Ahorabien,estaspersonas
debernautorizarporescritolaprcticadeestacomunicacin.Encasocontrarionosepuedellevaracabo
(art.15.5RP).

9. Puede ser informada la persona presa sobre su situacin penitenciaria?


Existeunderechodeinformacinrelacionadoconlainformacinpenal,penitenciaria,tratamientoyotros
aspectosmdicosconcretos(ver,entreotros,elAutodelJuzgadodeVigilanciadeOviedoenadelanteAuto
JVPOviedode1dejuliode1996).Porejemplo,puedeocurrirqueseanecesarioconocerlossiguientes
tiposdedatos:
a)Penales:Laltimacondenaparasolicitarlaaplicacindelart.76.2CP(tripledelapenamayoro
ellmitedeveinteaos);sisehanrefundidoonolascondenas;qudaseextinguedefinitivamentela
condena;losdasredimidossolamenteparaloscondenadosporelCPderogado;lafechadecancelacinde
lassancionesquesetengan;datosdeunaspreventivasabonablesaotras,etc.
b) Mdicos: A fin de acreditar en el acto del juicio oral la drogodependencia del acusado, es
necesarioquesesolicitenlosdatosmdicosqueconstenenlosinformesquesehicieronenelmomentodel
ingreso.TambinsepuedensolicitarinformessobrelaevolucindelaenfermedadVIH/SIDAparapedirla
libertad condicional anticipada, y lgicamente cuando son excarcelados para que puedan seguir el
tratamientoenlibertad.
c)Psicolgicos:Esconvenientesolicitarlosinformessocialesypsicolgicosparapodercontradecir
losargumentosqueseutilicenenunaresolucindemantenimientooregresindegrado,odeunpermisode
salida.Deestaformaquedarasalvaguardadoelderechodelosciudadanosautilizartodoslosmediosparala
defensadesusintereses(art.24.1CE).Teniendoconocimientodeldiagnsticoypronsticoqueconsteen
estosinformessepodrasolicitarunexamenmdicoaprofesionalesparticulares(psiclogos,mdicos,etc.)
Noesinfrecuentequeduranteaosseesttomandocomobaseparadecidirsobregradosdeclasificacino
permisos, algunos datos (diagnstico/ pronstico) que constan en informes psicolgicos, sociales, o
psiquitricosrealizadosenunmomentoconcretodelacondena,cuandoconeltranscursodeltiempoestas
circunstancias han podido cambiar. Esta informacin psicolgica se suele negar por los responsables
penitenciarios,perosudenegacindeberaserrecurridaalJuezdeVigilancia,laAudienciaProvincialy,
posteriormente, al Tribunal Constitucional. En cualquier caso, los abogados pueden acceder a todo la
informacincuandoelexpedienteseencuentreel Juzgadode VigilanciaPenitenciariaoenlaAudiencia
Provincialaefectosdequeseresuelvaunrecursoquesehayaplanteado.
Las cuestiones que hemos sealado anteriormente pueden solicitarse con base a los siguientes
fundamentos:
a)Elart.15.2delaLOGPdisponequeacadainternoseleabrirunexpedientepersonalrelativoa
susituacinprocesalypenitenciariadelquetendrderechoaserinformado...
b)El art. 4.2.K RP establece que el interno tiene derecho a recibir informacin personal y
actualizadasobresusituacinprocesalypenitenciaria.
c)El art. 112.2 RP (participacin del interno en el tratamiento), seala con este fin que el
profesionaldelEquipoTcnicoencargadodesuseguimiento,leinformardelosobjetivosaalcanzardurante
elinternamientoydelosmediosyplazosmsadecuadosparaconseguirlos.
d)Elart.215.2RPdisponequelosinternostendrnencualquiercasoderechoaserinformadosde
formaclaraycomprensiblesobretodoloreferenteasuestadodesalud,ascomoalaexpedicindelos
informesquesoliciten.
e) El artculo 275.b) y d) RP establece, entre las funciones del Equipo Tcnico, el conocimiento
directo de los problemas y de las demandas que formulen los internos, as como, la atencin de peticiones
y quejas que le formulen los internos respecto de su clasificacin, tratamiento o programa de intervencin.
Adems, el art. 37.1 de la LRJAPPC, establece que los ciudadanos tienen derecho a acceder a registros y
documentos que, formando parte de un expediente, obren en archivos administrativos se trata de la
consagracin del principio de publicidad en la actuacin administrativa. En el mbito prctico, no cabe duda
que cuanta ms informacin tenga el ciudadano preso, menor ser la violencia que ejerza, pues es sabido por
todos que el desconocimiento de datos objetivos relativos a la situacin penal y penitenciaria genera una
elevada sensacin de desasosiego y ansiedad, que se traduce en una gran desconfianza y violencia hacia los
funcionarios.

10. Quin y cmo debe facilitarse la informacin?


La informacinsolicitadapuedeserfacilitadaporcualquieradelosfuncionariosencargadosdelrea
sobre el que se solicita la informacin (oficina de rgimen, equipo de tratamiento, director, o el
Juzgado/Tribunal).
Enlainformacinpenaloprocesal,ladudaradicaensisedebenfacilitarlasnotastomadaspreviamente
porelfuncionariocorrespondiente,sisedebeexpedircopiadeunadeterminadaanotacino,sisedebedar
vistadelexpediente.Estaltimaposibilidadsesuelenegarporrazonesdeseguridadenlacustodiadelos
expedientes.

Enlaprcticalapersonapresadebesolicitarlainformacinquedeseamedianteunainstancia.Existen
dosmodelos:elnmeroIqueseutilizaparadirigirsealdirectoroacualquierrganodelaprisin,yel
modelonmeroIIqueseutilizaparadirigirsealosJuzgados,MinisteriosyotrosOrganismosoficiales.
Ambosmodelosdeinstanciasconstandetreshojas:blanca,rosayamarilla.Lablancaesparalaprisin,la
rosaesparaqueelfuncionarionotifiquelainformacin,ylaamarillaesparaqueelpresoselaquedecomo
justificantedequerealizunapeticin.Lacontestacinhadesersiemprefacilitadaporescrito,conlafecha
yfirmadelfuncionarioquelahayarealizado,yaqueposteriormentepuedeserutilizadaparaformalizar
algntipodereclamacin.Silainformacinesrelevanteporalgnmotivoparalacausapenal(informes
sobredrogadiccin,mdicos,oacreditacindeestanciasenlacrcelduranteuntiempodeterminado),la
peticindeinformacinpuedehacerseatravsdelabogadosolicitndolaalJuzgado/Tribunalanteelquese
quieraaportaresadocumentacinparaquestelapidaalacrcel.
Esmuyimportantepoderaccederalainformacinpenal/penitenciaria(condenas,sancionessincancelar,
causas pendientes) ya la psicolgica/social (informes del equipo de tratamiento) que son la base de la
denegacin de permisos, regresiones o resoluciones de mantenimiento de grado. Con el acceso a esta
informacinesdelanicaformaenquelaspersonaspresaspuedendefenderseyhacerefectivoelprincipio
decontradiccin,bienseaargumentandosobredatosdehechoconcretos,osolicitandouninformepericial
porprofesionalesajenosalainstitucinpenitenciaria.
EncasodequenosepuedaaccederaestosinformesparapoderredactarlosrecursosdequejaanteelJuez
deVigilancia(contraladenegacindepermisos,enmateriadeclasificacinoantetrasladosarbitrariossin
conocer las causas del mismo) se podr interponer una queja ante el Juez de Vigilancia Penitenciaria
(posteriormentealaAudienciaProvincial),haciendoconstarenelrecursolainformacinsolicitadaylos
motivosporlosquesesolicita(modelonmero2).
Elargumentoconstitucionalesclaro.EnlasentenciadelTribunalConstitucional76/1999de26deabril
de1999seestableceque:"Elart.24delaConstitucinincluyeentresusgarantaslaproteccindelderecho
detodolitiganteoencausadoaserodoyadisponerdetodaslasposibilidadesdeoposicinydefensaen
juicio. De no ser as, se le estara ocasionando una situacin de indefensin, susceptible de amparo
constitucional,alnogozarlaparteimpedidayobstaculizadadelosmismosderechosquelacontraria.En
este sentido, este Tribunal ha dicho reiteradamente que el derecho reconocido en el art. 24.1 de la
Constitucinsignificaquehaderespetarseelprincipiodecontradiccinquegarantizaelaccesoalproceso
endefensadelosderechoseintereseslegtimosy,dentrodeste,elejerciciodelasfacultadesdealegar,
probareintervenirenlapruebaajenaparacontrolarsucorrectaprcticaycontradecirla(STC176/1988y
122/1995).Lgicocorolariodetodoelloeselprincipiodeigualdaddearmas,delquesederivalanecesidad
dequelaspartescuentenconlosmismosmediosdeataqueydefensaeidnticasposibilidadesycargasde
alegacin,pruebaeimpugnacin(SSTC47/1987,66/1989y186/1990)".Porsuparte,laSTC297/1993,al
tratardeunasancinpenitenciariaimpuestaarazdeunexpedientedisciplinario,sealquelaausenciade
informacinacercadelmaterialprobatorioobranteenelexpedientesupusounamermadelasposibilidades
dedefensa.Sedijoenellaquenoslohadepermitirsealinternoaccederalmaterialprobatorioqueseusaen
sucontra,sinoque,practicadasnuevaspruebasporel (queincorporabanuevosdatosaldebate)hade
posibilitarsealinternoquesepronuncieexpresamentesobresueventualvirtualidadprobatoriaydrsele
trasladodelresultadodelaactividadprobatoriallevadaacaboparaquepuedaalegarsobrelamisma.

11. Adems del preso, quines pueden solicitar informacin de carcter


penitenciario personal de los presos?
Surepresentantelegal(abogado,procurador,familiar...).Paraellodeberaportarunpoderespecialy
bastante otorgado por la persona presa, en el que conste expresamente el consentimiento para que su
representantepuedateneraccesoasusdatospersonales(art.8.2RP).
Aefectosprcticos,losabogadostienenderechoaobtenercualquiertipodeinformacinsobreelexpediente
penalopenitenciario(tantodepenadoscomodepreventivos),paralocual,elnicorequisitoqueselepuedeexigir
enlaprisinesquemuestreunaautorizacinfirmadaporlapersonapresa.Enestecaso,sonlosfuncionariosdela
oficinadergimen,quienestramitanlosexpedientespenitenciarios,siemprequienestienenquehandedarla
informacinquesesolicite.Encasocontrario,sinosefacilitainformacinoseponenpongandificultadespara
ello,hayquehablarconeldirector,ointerponerunaQuejaanteelJuezdeVigilanciaPenitenciaria(modelonmero
2).
Entodocaso,unavezqueelabogadosepersoneenelJuzgadodeVigilanciaparaladefensadeun
recurso (bien de queja, bien de apelacin ante la audiencia) tiene acceso a todo el material probatorio
aportadoporelcentropenitenciariooqueconsteenelexpedienteapeticinsuyaseremitaasolicitudsuya
(todotipodeinformes:sociales,psicolgicos,psiquitricosetc.).

12. Qu datos de las personas presas se pueden recoger en las entrevistas


que realicen los miembros del Equipo Tcnico?
Losqueseanprecisosparalaintervencinpenitenciariasalvolosqueafectenasuideologa,religiny
creencias,encuyocasoserprecisoelconsentimientodelapersonapresa(art.7.1RP).Evidentemente,lo
quetampocopuedepreguntarseesacercadesuorientacinsexual,inclusonisipadecealgnuntipode
enfermedadconcreta.

13. Se pueden difundir esos datos?


No, pero caben algunas excepciones. Los de carcter personal relativos a opiniones polticas, a
conviccionesreligiosasofilosficas,alorigenracial,alasaludoalavidasexual,quehayansidorecabados
paraformularlosmodelosindividualizadosdeejecucinolosprogramasdetratamientopenitenciario,slo
podrnsercedidosodifundidosconelconsentimientoexpresoyporescritodelreclusoafectadoo,cuando
porrazonesdeintersgeneralaslodispongaunaLey(art.8.1RP).Estoltimoesdemuydudosalegalidad
yaquenosepuedepermitirlacesindedatosdeciudadanos,salvoconelriesgodevulnerarelderechoala
intimidadgarantizadoconstitucionalmente.
Noobstante,puedecederseinformacindelapersonapresa,enloscasosprevistosenelartculo8.1,alas
AdministracionesPblicasenelmbitodesuscompetencias,alaSeguridadSocial,custodiademenores,al
DefensordelPueblourganoanlogo,alMinisterioFiscal,alosJuecesoTribunalesenelejerciciodesus
funciones,ocuandosetratedecesindedatosdecarcterpersonalrelativosalasaluddelosreclusospor
motivosdeurgenciaopararealizarestudiosepidemiolgicos(art.7.2y3RP).

14. En caso de que los datos personales sean inexactos o incompletos,


qu se puede hacer?
Siunapersonadescubreotieneconocimientodequelosdatosdecarcterpersonalqueseencuentranen
losficherosinformticosresultanincompletosoinexactos,puedesolicitarqueserectifiquen.Delresultado
deestapeticintienequeserinformadoenunplazomximodedosmesesdesdesusolicitud(Art.9.1RP).

15. Una persona presa puede solicitar que se cancelen los datos que
constan en los ficheros informticos una vez que quede en libertad?
Enprincipios,salvocuandoconcurranrazonesdeseguridad,interspblico,proteccindelosderechos
ylibertadesdeterceros,ascomoloscasosqueposeanvalorintrnsecodecarcterhistrico(art9.2RP).Por
ello,enlaprctica,hayquesolicitarlaalaDGIP,perosuconcesinesdifcilporlaamplitudconquese
regulanlasexcepcionesalderechoalacancelacin.

16. Tiene derecho la persona presa a conocer las normas penitenciarias?


S.Paraello,recibirnasuingresoinformacinescritasobresusderechosydeberes,elrgimendel
establecimiento,lasnormasdisciplinariasylosmediosparaformularpeticiones,quejasyrecursos.Coneste
finsedeberentregaracadapersonaunejemplardelacartillaofolletoinformativogeneraldelasnormasde
rgimeninteriordelacrceldequesetrate(art.52.1RP).Estainformacindebereditarseencastellanoy
enlalenguacooficialdelaComunidadAutnomadonderadiquelacrcel.Alaspersonasextranjerasseles
harunatraduccinoraldesucontenido(art.52.3RP).Esnecesarioqueselesfaciliteporescritoparaquela
puedanleercontranquilidadpues,delocontrario,puedennoenterarsedelascuestionesqueselesexplica,
debido,sobretodo,alatensinylaangustiadelosprimerosmomentosquesepasanenlacrcel.
Alaspersonasquenotengannacionalidadespaolaselesinformar,adems,delaposibilidaddesolicitarla
aplicacindetratadosoconveniosinternacionalessuscritosporEspaaparaeltrasladoaotrospasesdepersonas
condenadas,ascomodelasustitucindelaspenasimpuestasoaimponer,porlamedidadeexpulsindelterritorio
nacional,enloscasosyconlascondicionesprevistasenlasleyes.Igualmenteselesfacilitarladireccinyel
nmerodetelfonodelarepresentacindiplomticaacreditadaenEspaadelpasdeorigen(art.52.2RP).
Consideramos que es esencial la notificacin por escrito de las normas de rgimen interior del
establecimientopenitenciariopues,encasocontrario,puedencarecerdevalidezsusexigenciasaefectos
sancionadores (Auto JVP de Zaragoza de 2 de marzo de 1992: el Centro Penitenciario no ha dado
cumplimientoalpreceptocontenidoenelartculo49delaLeyOrgnicaGeneralPenitenciariayenlos
artculos 17 y 133 del Reglamento, que obligan a dar informacin escrita sobre el rgimen del
establecimiento,porlocualnoexistebasebastanteparadesvirtuareldesconocimientoalegadoporelinterno
referido...estimandoelrecurso...revocandoydejandosinefectolasancin).

17. Cules son los criterios seguidos para la distribucin de las personas
presas a determinados mdulos tras el ingreso?
Paradistribuiralaspersonaspresas(preventivosypenados)entrelosdiferentesmdulosdelacrcelseutilizan
una serie de criterios como: el sexo, la edad (los que tengan hasta veintin aos, excepcionalmente hasta
veinticinco,serndestinadosamdulosdejvenes,demaneraqueslopodrnsertrasladadosamdulosde
adultosponindoloenconocimientodelJuezdeVigilanciaPenitenciaria)(art.9.2LOGP)(art.99.4RP),los
antecedentespenalesypenitenciarios,elcarcterdolosooimprudentedeldelitoatribuido,elestadofsicoymental.
Estadistribucindependedelosmdulosquetengacadaprisin.Respectodelospenadossetendrencuenta,
adems,lasexigenciasdeltratamiento(arts.16LOGPy99.1RP).Encasodequehombresymujeresdebieran
compartirunmismodepartamento,serprecisocontarconsuconsentimiento.Otroscriteriosdeseparacinson:
primarios,multireincidentes,condestinosdetrabajo,conpermisosdesalida,necesitadosdeobservacin,por
tratamientosespecficos,porquesepreveaciertaconflictividadcomoocurreconlaspersonaspertenecientesalas
fuerzasycuerposdeseguridaddelEstadoquepudieranserobjetodeagresinetc...

18. Cmo se realiza el ingreso de personas transexuales?


La Comisin parlamentaria de Poltica social y empleo del Congreso de los Diputados aprob una
Proposicinnodeleyenrelacinconelderechodelostransexualesauncambiodesexo,yentreotras
cuestionesinstalgobiernoparaquedesdelaInstitucinpenitenciariaseemitieraunaInstruccinporlaque
sebuscasenfrmulasparaquelostransexualesalosquenoseleshayareconocidosucambiodesexoen
documentosoficialesacreditativosdesuidentidadseaningresados,encasodecondenaporcomisinde
delito,enlaprisinquecorrespondasegnelsexosocialmentereconocidoyporelquedesarrollansuvida
siempreycuandonosealtereelnormalfuncionamientodelacrcel.AestosefectossedictlaInstruccin
1/2001DGIP.
Cuandoingreseunapersonacuyaaparienciaexternacorrespondaaunsexodistintoalqueconsteen
documento oficial se efectuar un reconocimiento mdico y si coincide su apariencia externa con los
caracteres fisiolgicos sexuales, ser cacheado por funcionarios de igual sexo con independencia de su
documentacin oficial, dejndose constancia del reconocimiento. Una vez efectuados los exmenes
pertinentes,seleingresarenunacrcelodepartamentoquecorrespondaenfuncindesuidentidadsexual
aparente,independientementedesudocumentacinoficial.Sideseaseunaoperacindecambiodesexo,los
serviciosmdicosdelacrcelrealizarnlasgestionespertinentesparaquerecibaenmismotratoquelos
pacienteslibres.

19. Qu tipos de funcionarios existen?


a) Funcionarios de seguridad. Sonlosquerealizanlavigilanciainternadelacrcel.Normalmente
llevanuniforme.Estnjerarquizados,ysegnsucargoasumendistintascompetencias:
Jefe de mdulo.Detodoslosfuncionariosquehayenelmdulounodeelloseselresponsable.
Jefe de centro.EselresponsabledelaoficinadelaJefaturadeServicios.Controlaelmovimiento
delospresosdentrodelaprisin,controlalospartes,informes,recuentos,requisasycacheos.
Jefe de Servicios.Seencargadelbuenfuncionamientodelaprisin(art.283RP),ypuedeadoptar
medidas provisionales, como suspender una comunicacin en aras de la seguridad y buen orden del
establecimientopenitenciario(art.44RP).
b) Subdirectores. Suelen ser los encargados de reas determinadas de trabajo, (art. 281, RP), y los
podemosclasificaren:
1.Subdirector de Rgimen.Eselsegundoresponsabledelaprisinyeselencargadodelaoficinade
rgimen.Allseencuentrantodoslosexpedientespenitenciariosdecadapreso.
2.Subdirector de Tratamiento.Eselresponsabledelosequipostcnicosqueseencarganderealizar
losestudiosyobservacionesparacadapreso.
3Subdirector de seguridad.Tieneencomendadafuncionesdeseguridadenlaprisin.
4.Subdirector mdico.Eselresponsabledelosserviciosmdicos.
5.Subdirector de personal.Eselencargadodeasuntosdepersonal,ynoesseguroqueexistaenla
prisin.
6.Administrador.Esunsubdirectorqueestencargadodelagestineconmicadelaprisin(art.
282RP).
7.Director.Eselquemspodertiene.Aefectosprcticossigueautorizandotodoloqueantesdeba
deautorizar(art.208RP),comolasvisitasdeamigos,peroahora,adems,debedeautorizartodoslos
acuerdosquesedenporcualquierrganopenitenciario(art.266RP),salvolosdelacomisindisciplinaria
queahoravers.Unacosainteresanteesqueeldirectorapruebalaseparacindelospresosdentrodela
prisin.Dichodeotromodoeselresponsabledeloscambiosdemdulo,siloshubiera,yaquesuyaesla
competencia(art.280.2.9.RP).

c)Tcnicos:
Jurista.Esquienseencargadeconocerlasituacinpenalypenitenciaria.Legalmentetienela
obligacindeinformaralpresoenlostemaslegales.Estambinelasesorjurdicodelaprisinyquien
estudiatodaslasquejasyrecursosquepresentesconelfindedefenderalaprisinanteelJVP.
Psiclogo, pedagogo, psiquiatra, socilogo.Sonmiembrosdelequipodetratamiento.Seencargan
derealizarlosinformessobrecadapresoenfuncindesucapacitacinprofesional.
Educador.Colaboraenlosinformesquesehacendecadapresoyalavezeselencargadode
programarlasactividadesrecreativasydeportivas.Deberadetenerasucargounnmerodeterminadode
presos,perolonormalesquehayaunopormduloodepartamento.Esquienmscontactotieneconlos
presos.
Asistente social.Eslapersonaencargadadeinformarsedelasituacinsocialyfamiliar.Encaso
de necesidad se le puede solicitar que realice alguna gestin, bien familiar, o de tramitacin de alguna
documentacinconelfindeobtenerayudasfamiliares,cobrodeparo,etc.
Maestro.Enlaprisinhayescuela,tambinllamadaunidaddocente,ylallevanmaestros.Pueden
ser de Instituciones Penitenciarias o del Ministerio de Educacin y Ciencia. Llevan todo lo referente a
estudiosylabiblioteca.
Equipomdico.Estcompuestoporunmdico,ATSyauxiliardeenfermera(art.209.1RP).Puede
habervarios.
Demandadero.Eldemandadero,orecadero,esuncontratadolaboraldelaprisinqueseencarga
decomprarlascosasquesenecesitanynoseencuentraneneleconomatodelaprisin(art.304RP).En
cadaprisinhayunmtodoparapedirlascosas.
d) rganos colegiados. LosrganosdelaprisinvienendeterminadosenelRP(art.265),perolo
importanteesque,salvocuandolacompetenciaseadelJVP(art.267.2),losacuerdosestnsujetosalaLey
30/1992,de26denoviembre,deRgimenJurdicodelasAdministracionesPblicasydelProcedimiento
AdministrativoComn(art.267.1RP).
1.Consejo de Direccin(arts.270y271RP).Eselrganodegobiernodetodalaprisin,yentre
otrascosas,apruebalasnormasdergimeninterior,fijalosdasdevisita,etc.LoquehacalaantiguaJunta
deRgimen,perosinelrgimendisciplinario.Sereneunavezalmescomomnimoyestcompuestapor:
director, subdirector de rgimen, subdirector de seguridad, subdirector mdico, subdirector de personal,
administrador.
2.Junta de Tratamiento (arts. 272 a 275 RP). Est encargada, entre otras cosas, de realizar los
estudiosacadapreso,laclasificacinytratamientonecesarioylaplanificacindelasactividades.Tambin
proponelaaplicacindelarticulo10alaDGIP.LoquehacaelEquipodeTratamiento.Serenecomo
mnimo cada semana y esta compuesta por: el director, subdirector de tratamiento, subdirector mdico,
tcnicosdeinstitucionespenitenciarias,psiclogo,psiquiatra,etc.,directordeunidaddocenteopedagogo,
coordinadordelosservicios,uneducador,unjefedeservicios.
Para el desarrollo de sus cometidos dispondr unos equipos tcnicos, que se encargarn de los
estudios, propuestas y ejecucin los mismos, y estarn compuestos, bajo la supervisin directa del
subdirectordetratamiento,porunjurista,unpsiclogo,unpedagogo,unsocilogo,unmdico,unATS,un
maestrodelaunidaddocente,unmaestrooencargadodetaller,uneducador,untrabajadorsocial,unmonitor
socioculturalodeportivo,unencargadodedepartamento.
3.Comisin Disciplinaria(arts.276y277RP).Eslaencargadadeejercerlapotestadsancionadora
enelcasodelasfaltasgravesymuygraves.Esunrganodenuevacreacin.Serenecomomnimo4veces
almesyestacompuestapordirector,subdirectordergimen,subdirectordeseguridad,unjurista,unjefede
servicios,unfuncionario.Losdosltimossonelegidosanualmenteentrelosfuncionarios.
4.Junta Econmico-Administrativa(arts.278y279RP).Seencargadelagestineconmicayde
personaldelaprisin.Esdenuevacreacin.Serenecomomnimounavezaltrimestreyestacompuesta
por: director, administrador, subdirector mdico, subdirector de personal, coordinador de formacin
ocupacionalocoordinadordelosserviciossociales,sisonconvocadosporeldirector,yunjurista.
e) Centro Directivo. Este rgano, al que nos vamos a referir con mucha frecuencia, tiene muchas
competencias y el poder/control absoluto sobre las decisiones de los directores de las crceles. Es de
naturalezapolticayseencuentraenlaDireccinGeneraldeInstitucionesPenitenciarias.

Captulo 2
LUGAR DE CUMPLIMIENTO,
TRASLADADOS Y CONDUCCIONES

1. Quin decide la crcel de cumplimiento?


LaJuntadeTratamientodelacrcelproponealaDireccinGeneraldeInstitucionesPenitenciarias
(Centro Directivo) un grado de clasificacin (primero, segundo o tercero) as como una crcel de
cumplimiento(dergimencerrado,ordinariooabierto)quedeberaserlamscercanaposiblealdomicilio
habitualdelapersonapresaafindeevitarsudesarraigosocial.
EsteElcriteriodecercanaalaciudadoprovinciaderesidenciafamiliarseesttomandoencuentaenlas
decisionesadministrativas,sobretodoparalosquenotienenantecedentespenalesyparalosquenoson
conflictivos. No obstante, muchas personas (algo menos de la mitad de los penados) se encuentran
cumpliendocondenaencrcelessituadasfueradelasprovinciasderesidenciafamiliar.Elloesdebidoaque
entreloscriteriosqueseutilizanenladistribucindelospresospredomina,sobretodo,laseguridadyel
ordeninternodelacrcel.Cualquier reclusopreso,alolargodelacondena,puedeverseinvolucradoen
situaciones conflictivas que motiven el traslado a prisiones situadas lejos de la provincia de residencia
familiar.Deahquenoseainfrecuentequelaadministracinpenitenciariautiliceeltrasladocomosancin
encubierta,comounmedioparasolucionarunasituacinconflictiva,ocomoformadedesprendersedeun
presomolestooreivindicativo.

2. Cules son las razones que justifican la proximidad de la crcel


al domicilio habitual de la persona condenada?
Lasrazonesylospreceptoslegalesenlosqueseestableceyjustificalaproximidaddelacrcelal
domicilio habitual del condenado, y que, por tanto, van a fundamentar el cumplimiento legal de la
administracinpenitenciariaenladistribucindelospenados,atiendenalassiguientesconsideraciones:
a)Consideracionesenelmbitoconstitucional.Elcumplimientodelaspenasprivativasdelibertad
debeestarorientadoalareeducacinyalareinsercinsocialdelospenados(art.25C.E.y1LOGP).Este
mandatoexigeconsiderarquelaspersonascondenadasapenasprivativasdelibertadnosonsereseliminados
delasociedadcomodesdealgunasorientacionesideolgicassemantiene,sinoquesonpersonasque
debencontinuarformandoparteactivadelacomunidadsocial.
Para la observancia de esta consideracin, el precepto constitucional resocializador mantiene una doble
exigencia.Porunlado,elfavorecimientodelcontactoactivoreclusosociedad,queexigealaadministracin
penitenciaria el inicio de un proceso de integracin social del recluso a travs del
mantenimiento/potenciacindelosvnculossocialesfamiliares,amigos,comunidadsocialquetengael
ciudadanoantesdelingresoenlacrcel.Porotro,lanecesidaddeevitareldesarraigosocialqueentorpezca
elprocesodeintegracinsocialyderecuperacinpersonal.Aestefin,loscriteriosdeactuacindela
Direccin General de Instituciones Penitenciarias en materia de ubicacin de penados/lugar de
cumplimiento, deben ir encaminados a evitar que el cumplimiento de la condena origine un desarraigo
familiarmotivadoporelalejamientogeogrficoentrelacrcelyeldomicilio.Eldesarraigoseintensifica
cuandoelciudadanopresonopuedecomunicarconsusfamiliaresporcuestioneseconmicas,esdecir,
cuandostosnodisponendemediosmaterialesoeconmicossuficientesparadesplazarsehastalacrcel.La
expresindeestasituacinvieneavaladanosloporlaprecariasituacineconmicadelagranpartedelas
familias de los presos, sino tambin por los datos de un estudio que realizamos desde la Universidad
PontificiaComillas1:lafrecuenciadelascomunicacionesentrepresosyfamiliascuandostasresidenenla

mismaprovinciaqueellugardeubicacindelacrcelesmselevado(comunicanel89%),quecuandonoes
as(distintaubicacincrcel/domiciliofamiliar),encuyocasocomunicansolamente53%delaspersonas
condenadas.
De lo que concluimos que el incumplimiento de esta orientacin constitucional genera situaciones de
desarraigoqueentorpecenlaintegracinsocialylarecuperacinpersonalenelmbitorelacional.
b)Consideracionesenelmbitodelalegislacinpenitenciaria.Ellegisladorrealizaunesfuerzoen
laredaccindelaLeypenitenciariaparaquelaspersonasseandestinadasacumplirsucondenaacrceles
situadasdentrodesusprovincias.Dosejemplosclarosdeelloson,porunlado,losartculos12.1LOGPy9
RPqueestablecen:lapolticaderedistribucingeogrficadelospenadosdebeestarencaminadaaevitarel
desarraigosocialdelosmismos,procurandoquelasreasterritorialescoincidan,enlamedidadeloposible,
conel mapadelEstadode las Autonomas, dedicndose alos penados decada rea, la totalidadde la
capacidaddeloscentrosdecumplimientoqueenlamismaseubiquenyprocurandoquecadareacuente
conelnmerosuficientedeestablecimientosparasatisfacerlasnecesidadespenitenciarias.Porotro,la
muestra de la intensa preocupacin del legislador por la evitacin del desarraigo de los penados es la
indicacinquesehacealCentroDirectivo(DGIP)paraquedispongadedepartamentosespecficospara
programasrelativosadrogodependenciasubicadosendiferentesreasgeogrficasparaevitar,enloposible,
eldesarraigosocialdelosinternosquesiganprogramaenellos(art.116.3RP).
c)Consideracionesenelmbitodeltratamientopenitenciario.LaLeyPenitenciariaestablecequela
pretensindeltratamientoeshacerdelinternounapersonaconlaintencinycapacidaddevivirrespetando
laleypenal...seintentardesarrollarunaactividadderespetoasmismos,yderesponsabilidadindividualy
socialconrespectoasufamilia...Objetivosqueexigenparasucumplimiento,queelreclusoresidaenuna
crcelubicadaenellugarderesidenciafamiliar.
Amayorabundamiento,siparaindividualizareltratamientoyprocederalaclasificacinsedebeteneren
cuentaelhistorialpersonal...elmedioalqueprobablementeretornar...(art.63LOGP),sehacenecesario
queelcontactodelreclusoconsteseacontinuo.
Una ltima consideracinenmateria de permisos que tambin son parte del tratamiento, nos lleva a
explicar la importancia de la existencia y mantenimiento de la vinculacin familiar. La inexistencia de
vnculosfamiliaressevaloranegativamenteparalaconcesindepermisosdesalida;enlaprcticaestees
unodelosmotivosdedenegacin.Porello,escoherenteyrazonablequeelmantenimientodevnculopreso/
familiaseacontinuodesdeeliniciodelacondena.
d)Consideracionesenelmbitodelacomunidadsocial.Juntoconlosderechosdelaspersonas
presas antes reseados debemos tomar en consideracin, en el horizonte axiolgico de un Derecho
penitenciarioarticuladoenunEstadoSocialyDemocrtico,elderechodelafamiliaydeltejidosociala
intervenirenelmbitopenitenciarioacompaadodelosprocesosderecuperacinydeinsercinsocial.No
sepuedeobviarquelainstitucincarcelariaconstituyeunsistemasocialalternativoalasociedadyque,
ademsdeformarparteintegrantedelamisma,seretroalimentadeellademaneracontinua.Deahla
convenienciadequelapersonapresacumplacondenaenunacrcelprximaasuentornofamiliarysocial.
e) Consideraciones del Defensor del Pueblo. Esta situacin es continuamente motivo de
preocupacin en los informes del Defensor del Pueblo. En el ltimo informe (1997), seala que ha
comprobadoquebuennmerodelasquejasqueespontneamenteplanteanlosinternosvienenreferidasal
alejamientoquesufrenrespectodesusfamilias,sinqueaparentementeexistanmotivosparaellodistintosde
lamerafaltadeplazas".

3. De quin es competencia el traslado de crcel?


Los traslados son competencia de la Direccin General de Instituciones Penitenciarias. Este rgano
administrativoordenalostrasladoscorrespondientessobrelabasedelaspropuestasqueformulanlaJuntade
Tratamientoo,ensucaso,eldirectoroelConsejodeDireccin(art.31.2RP);
TodoslostrasladosdebennotificarsealJuezdeVigilanciasisetratadepersonasyacondenadas.Sisetrata
depreventivosodetenidos,lanotificacindeberhacersealasAutoridadesjudicialesacuyadisposicinse
encuentren(art.31.3RP).SielReglamentoexigeesanotificacinposteriores,obviamente,nosloaefectos

decomunicacinparaqueelJuzgadoconozcadondeestundeterminadopreso,queporotroladoesuna
informacinsencilladeconseguir,sinoparaqueelactoadministrativoqueordenaeltrasladoseacontrolado
judicialmente.Deah,podraentenderseque,sobrelabasedelasatribucionesqueposeenlosJuecesde
Vigilanciadevelarporlosderechosdelospresos,undeterminadotrasladopodradeclararsejudicialmente
ilegal,loqueconllevaralavueltadelapersonaalacrcelenlaqueseencontraba.
LosJuzgadosdeVigilanciaPenitenciariatienencompetenciaparaordenareltrasladoenbasealosarts.76.1
y2g)LOGP,puestoqueconformealoscuales alJuzgadodeVigilancialecorrespondealJuzgadode
VigilanciaPenitenciariasalvaguardarlosderechosfundamentalesdelosinternosquecumplencondena.Ala
mismaconclusinconduceelart.106.1CEporelquelaadministracin,tambinlapenitenciaria,estsujeta
alcontroljudicialdelalegalidaddesuactuacin.Lalegalidadpenitenciariatomacomoejefundamentalla
reinsercinsocialdelpenado(art1LOGPy25.2CE)cuyocontenidoyahasidodefinidomsarriba.Se
puede alegar por parte de la administracin penitenciaria que el derecho a la reinsercin social no es
considerado como derecho subjetivo porque es compatible con otros fines de la pena tales como la
retribucin(STC233888y4791),perotambinesciertoqueelobjetivodelareinsercinsocialnopuede
quedarcomounndiceprogramticodederechosdedesarrollodiscrecionalporelpoderlegislativoyel
ejecutivo,sinocomosealalaSTC.15/84,"elart.25CEsuponeunmandatodelconstituyenparaorientar
la poltica penal y penitenciaria", adems, como establece la STC 112/96 que "la reeducacin y la
reinsercinsocialsolamenteseaunprincipioconstitucionalnosignificaquepuedadesconocerseenla
aplicacin de las leyes; y menos an cuando el legislador, cumpliendo el mandato constitucional ha
establecidomecanismosdirigidosagarantizarlaorientacinresocializadora".Pareceunaincongruencia
queelnicofinexpresamenteestablecidoenlanormaconstitucionalquedarareducidoaunsegundoplano
operativo, a merced a su simple carcter orientativo, en detrimento de finalidades defensistas o
retribucionistas.
Cabe concluir que el Juez de Vigilancia penitenciaria no puede tener una actitud expectante de simple
transmisinorecepcindepeticionesocomunicacionesdetraslado.Quincumpleyhacecumplirelprincipio
delegalidadalaadministracin?,porque,noesqueelJueztengaquevelarporelcumplimientodelosderechos
garantizados en la LOGP, sino que tiene que obligar a la administracin penitenciaria a que observe el
cumplimientodelalegalidad,sobretodoenmateriadederechosfundamentalesyencuestionesdetratamiento
queeselejefundamentaldelsistemapenitenciario.
Larespuestapuedeserquelapersonapresadebeacudiralajurisdiccincontenciosaadministrativa;aeste
respectodiraqueestajurisdiccinestanlentaycomplejaquecuandoquieranresolverelderechovulneradoya
nopodrserrestauradooreparado;esdecir,lasustitucindelmecanismofiscalizadordeljuezdevigilanciaser
virtualmentenula.
PorellocabeconcluirquelareservaalaJurisdiccinContenciosaadministrativadelcontroldelostraslados
decididosporlaadministracinconllevaqueelderechoalatutelajudicialefectivadelosJuecesyTribunalesdel
art.24.1delaConstitucinpuedaquedarvulnerado;hechorespectodelquecabeinterponerrecursodeamparo,
yunavezagotadalavajurisdiccionalordinaria.Laefectividaddedichocontrolrequiereotorgarelcontrol
jurisdiccionalalosJuecesdeVigilanciapenitenciaria.
Unainterpretacinabiertaalanormativapenitenciaria(art.76.LOGP)yconstitucional(art.117CE:"el
poderjurisdiccionaljuzgayhaceejecutarlosjuzgado")yalprincipiodelegalidad,haceposiblesu
intervencinordenandoeltraslado.Sumarginacinenestamateriasuponeunaquiebradelafuncin
garantistadelosderechosdelosinternos,cuyasalvaguardalehasidoespecficamenteasignada.
Estainterpretacinabiertaresultaobligada,porquelosderechosdelaSeccin2,Captulo1,TtuloIdela
Constitucin,yentreelloselderechoaltrabajo(art.35CE)vinculanalospoderespblicos,yelpoder
judicialdeberealizarunainterpretacinquemaximicesueficacia(art.53.1CE).Delamismaformadebe
destacarseelalcanceinterpretativodelosprincipiosrectoresdelapolticasocialyeconmica,(Captulo3,
Ttulo I CE), y entre ellos, el principio de proteccin a la familia (art. 39 CE), que segn imperativo
constitucional informarn la prctica judicial (art. 53.3CE). En el mismo sentido apuntan el principio
superiordedignidaddelapersona(10.1CE),ylosprincipiosdereeducacinyreinsercinsocialdelos
internos,comofinesalosquedebeservirtodoelordenamientopenitenciario(art.25.2CE).
Es conveniente aadir que adems de este alcance interpretativo, el derecho al trabajo y el principio de
proteccinalafamiliapresentanenestecasounaeficaciavinculantesuperior,cuandosondesarrolladosenleyes,
puesestoposibilitasuinvocacincomoautnticosderechosantelajurisdiccin.Yestoesloquesucedeenel
casopresente.Efectivamente,elart.12.1LOGPespecificaquelaubicacindelosestablecimientosserfijada

porlaAdministracinpenitenciariadentrodelasreasterritorialesquesedesignen.Entodocasoseprocurar
quecadaunacuenteconelnmerosuficientedeaqullosparasatisfacerlasnecesidadespenitenciariasyevitar
eldesarraigosocialdelos penados.Demodoquelaleyconcedeestederechoalosinternos,cuyanica
limitacinvlidaeslafaltadedisponibilidadesfsicasobienencuestionesrelativasalaseguridad,ydebeser
cuidadosamentejustificadaparaelcasoconcreto,sinquequepanjustificacionesgenricas.Enloscasosenque
laadministracinpenitenciarianohajustificadolalimitacindeestederechoincurreenarbitrariedad,prctica
proscritaporelart.9.3CE.QueelJuezdeVigilanciaPenitenciariaseinhibadelconocimientodeestamateria
suponelaminusvaloracindesufuncindesalvaguardarlosderechosdelosinternosycorregirlosabusosy
desviacionesqueenelcumplimientodelospreceptosdelrgimenpenitenciariopuedanproducirse(art.76.1
LOGP),ademsdesuespecficamisindeacordarloqueprocedasobrelaspeticionesoquejasquelosinternos
formulenenrelacinconelrgimenytratamientopenitenciarioencuantoafectealosderechosfundamentaleso
alosderechosybeneficiospenitenciariosdeaqullos(art.76.2g)LOGP).Comotal,suponeunaquiebradel
derechoalatutelajudicialefectiva(art.24CE).
PorltimohacerreferenciaalacertezadequeelTribunalConstitucionalensentencia138/1986de7de
noviembrenoatribuyelacompetenciaalJuezdeVigilanciaPenitenciariaparaconocerdelosrecursoscontra
lasresolucionesdelaDGIPqueafectanaltrasladodelospenadosdeunestablecimientoaotro;ahorabien,
dichasentencianoentrenelfondodelacuestin,desestimandoelrecursodeamparo,pornohaberse
agotadopreviamentetodalavajudicialordinaria.Estaesunacuestinareconsiderarenfuturasresoluciones
delTC.PorotrapartelaSentenciadictadaporelTribunaldeconflictosdejurisdiccin,16/1996de5de
diciembrede1986entreelDepartamentodeJusticiadelaGeneralitatdeCataluayelJuzgadodeVigilancia
Penitenciarianum.2resolviqueesalaadministracinpenitenciariaaquienleincumbegestionarlatotal
actividadpenitenciariayfijarlaubicacindeloscentrosyporellodebeserlereconocidacomofuncin
propialadistribucindelospenados,mximecuandohandeserespecialmentetenidosencuentatantola
naturaleza de los centros como el nmero de plazas, circunstancia que no podr ponderar el Juez de
Vigilancia.Haestaresolucinsepuedenhacerdosobjecionesrazonables.Primera,elJuezdeVigilancia
puede ponderar las circunstancias relativas a la naturaleza de los centros y al nmero de penados si la
administracinle da la informacin. Segundo, en la actualidad existen macrocentros o centros tipo con
mdulos destinados a diferentes grados de clasificacin (ordinario, abierto restringido y departamentos
especialesoprimergrado),porlotantoelnmerodeplazasexistentespuedesersuficienteparalademanda
de traslados a centros cercanos al domicilio familiar, y en todo caso puede comprobarse solicitando
informacin.

4. Quines pueden solicitar el traslado o conduccin de una prisin a otra?


ElCentroDirectivoordenadalostrasladoscorrespondientessobrelabasedelaspropuestasdelossiguientes
rganosopersonas:
a.Lasautoridadesjudicialescompetentes.
b.LaJuntadeTratamiento,directoroconsejodedireccin(art.32.1RP)
c.Elpenadoquepuedesolicitarelcambiodeprisin,antelaJuntadeTratamiento,quienestudiar
lapropuesta,siempreantesdelasiguienteclasificacin,enfuncindelosmotivosalegadosydesusituacin
penitenciaria(I20/96DGIP).
d.Enloscasosenqueelreclusohayasidotrasladadodeprisinparalarealizacindediligencias
judicialesenunaprovinciadistintadedondeestubicadalacrcelenqueseencuentredestinado,unavez
quehayafinalizadoaquellasdiligencias, eldirectortienequeproponeralCentroDirectivoeltrasladodel
reclusoalacrceldeorigen.Porello,enestossupuestos,unavezfinalizadaslasgestionesjudicialesysiel
trasladoalacrceldeorigenseretrasaesconvenientequelapersonapresasolicitealDirectorquepidaal
Centrodirectivoeltraslado.
e.El Director tambin puede intervenir solicitando al Centro Directivo el traslado cuando una
personahayafinalizadolacondenayquederetenidoporunacausapreventivaenunJuzgadooTribunal
situadoenunlugarterritorialdistintoadondeestubicadalacrcel(art.29.2RP).Creoqueestapeticinno
seraconvenientesilacrcelenqueseencuentraestuvierasituadamscercadeldomiciliofamiliarquelade
dondeestsituadoeljuzgado.

f.LaJuntadetratamientoquepuedesolicitaralcentroDirectivoeltrasladoainstanciasdelmdico,
trabajadorsocialyeleducadordespusdelexameninicialeneldepartamentodeingresos(art.20.1RP);
tambinpormotivoseducativos(art.121RP)yporlapropuestadeclasificacininicialodeaplicacindel
art.10LOGPparapreventivos.

5. El Juez de Vigilancia Penitenciaria Puede controlar los traslados el Juez


de Vigilancia?
S, adems de lo expresado anteriormente, es criterio unnime de los Jueces de Vigilancia que la
competenciaresideenlaDireccinGeneral,sibienaelloslescompeteelcontrolenlaformaderealizarse,
pudiendodejarsinefectoeltrasladocuandohayaexistidoabusoodesviacindepoderporpartedela
administracinpenitenciaria,conapoyoenprincipiosgeneralesdelderechocomolaevitacindelfraudede
leyodeabusodederecho.As,porejemplo:
a)SiconeltrasladoseintentasustraeralapersonapresadelacompetenciadeundeterminadoJuez
deVigilanciaquehayaderesolverunaquejaorecursoformuladoporaqul.
b)Sieltrasladoconstituyeunasancinencubierta.
c) Si a causa del traslado se produce un empeoramiento de la situacin del preso respecto de
beneficiospenitenciarios,delaaplicacindeuntratamientoodelaposibilidaddedesempearuntrabajoen
rgimenabierto.
En estos casos la competencia para resolver la queja que se debe interponer le corresponde al Juez de
Vigilanciadelterritoriodondeseencuentralacrceldesdelaqueseproduceeltraslado.Silaquejanoha
podidopresentarse,sepuedeformularanteelJuezdeVigilanciadellugardondeestlacrcelalaqueha
sidodestinado;stelaremitiralJuezcompetente(criterionmero14RJVP).
Laexistenciadeestecontroljurisdiccionalevita,enalgunoscasos,trasladosarbitrarios.Seintentaconseguir
atravsdeestaintervencinjudicialelcontroldelalegalidadpenitenciariapararestaurar,tutelarygarantizar
losderechosdelapersonapresacuandoestoshayansidovulneradosporunadecisindelaadministracin
penitenciaria(STC2/1987).Esms,elAutodelaSeccin5delaAudienciaProvincialdeMadrid568/98de
14demayode1998sealaquesibienlosrecursoscontralasresolucionesadministrativasqueanulano
denieganlostrasladosdelosinternossonlospropiosdelajurisdiccincontenciosoadministrativa,sila
resolucinafectaaderechosfundamentales(peticindetrasladoporenfermedadvida,eintegridadfsica)
latuteladelosmismoscorrespondealJuezdeVigilanciaPenitenciariaconformealart.76GLOGPypor
vadeapelacinalaAudienciaProvincial.

6. Qu se puede hacer para pedir un traslado a otra prisin que est en la


ciudad/provincia del domicilio familiar?
HayquesolicitareltrasladoalaJuntadeTratamientoyasuvezalaDireccinGeneraldeInstituciones
Penitenciarias (modelo nmero 3.a). Si se deniega el traslado hay que recurrir al Juez de Vigilancia
penitenciaria, aunque los Jueces de Vigilancia penitenciaria no los suelen admitir salvo en algunas
situacionescomolasdescritasenlapreguntaanterior(modelo3.b).

7. Qu se puede hacer ante un traslado que se considere ilegal?


Los nicos traslados legales son los realizados para que la persona presa est ms cerca del domicilio
familiar, o para la prctica de diligencias en un Juzgado situado en otra provincia, o por razones de
tratamientocrcelconmduloderehabilitacindedrogodependencias,odeestudiosenlaUNED.Todos
losdemstrasladossonarbitrarioseineficaces,yaquepormotivosdeseguridad(regimentales)existen
mediossuficientesdentrodelascrcelesintermodularesparadarsolucinalconflictolessolucin;adems

sonilegalesporsercontrariosalanormativapenitenciariayconstitucional.
Siunapersonaestrasladadadelacrceldondeseencuentrasincausalegalalguna,eltrasladohayque
recurrirloalJuzgadodeVigilanciaPenitenciariadelterritoriodesdeelqueseproduceeltraslado,basndose
enelcriterionmero14deRJVP.Hayquehacerreferenciaaloshechosque,ajuiciodelpreso,hanmotivado
eltraslado,yexponerlasrazonesporlasqueseconsideraquehasidoarbitrario(portratarsedeunasancin
encubierta,uncastigo,unarepresalia,etc.),ascomolosefectosqueesetrasladovaaproducir(prdidade
destino,alejamientodelafamilia,prdidadebeneficiospenitenciarios,desarraigopersonal).Porltimo,siel
trasladosuponeademselalejamientodelaciudad/provinciaderesidenciafamiliarhayqueexponerlas
razonesyamencionadasanteriormentequejustificanquelapersonadebeestarenlacrcelsituadadentrode
laprovinciadeldomiciliofamiliar.
EnestoscasoshayquehacerunescritodequejaalJuezdeVigilanciaPenitenciariaenelqueseexponganlas
razonesporlasquesecreequeeltrasladohasidoarbitrarioeinjusto(modelonmero4).

8. En qu condiciones y de qu forma deben hacerse los traslados?


Segnlaley,lostrasladoshanderespetarladignidad,losderechosdelapersonapresaylaseguridaddela
conduccin(art.18LOGPy36.1RP).Lostrasladosdeprisinaprisinsehacennormalmenteporcarretera,
enautobusesdenominadosvulgarmenteKanguros,custodiadospormiembrosdelasFuerzasdeSeguridad
delEstado(GuardiaCivilart.12.1LOCFSE2/1996).Estosvehculoscarecenrealmentedelasadecuadas
medidasdeseguridadapesardelamodificacinlegal(Ordende15dejuniode1995).Estasituacinesun
ejemplomanifiestodecomolalegalidadsuplantaalarealidad,ylaconstruye.
Elhechodequelosautobusesseajustenalanormativareguladoranosignificaquelostrasladosgaranticen
la seguridad, la salud y la dignidad de las personas. A pesar de las innovaciones introducidas en las
condicionesdelosvehculos,lospresossesiententratadoscomoanimales.Lacasitotalidaddelosmismos,
salvoalgnmodelonuevo,tienenunaescassimaonulavisibilidadhaciaelexterior,loquegenera,juntoala
insuficienteiluminacin,ventilacinyclimatizacin,unclaroriesgoparalasalud.Elhechodequelas
personaspresasvayanesposadasensuinterioraumentaestosriesgosfsicos.Ensuinterior,estndivididos
enpequeasceldasconunestrechopasilloenmedio.
Lasconsecuenciasdelostrasladosenestosvehculosson:desorientacinespacial,sensacindeangustiay
ansiedad,unmayorriesgodeconfusionesencasodemaniobrasforzadasodeaccidente,grandesdificultades
paraabandonarelvehculoinclusoconayudaexterior.Todasestassituacionessoncapacesporssolasde
afectaralasaludeintegridadfsicadelaspersonasconducidas.Sihubieseunaccidenteounincendio,las
consecuenciasseranmortales.
Anteestarealidad,laadministracinpenitenciariaincumpleconsudeberdevelarporlavida,laintegridady
saluddelospresoscuandohaceentregadeellosparaqueseantrasladadosenvehculoscuyascaractersticas
nogarantizanelmodoenqueesdebidoaquellosderechos(AutodelaAPBilbaode31dediciembrede
1987).Losviajesenestosvehculossuponenunaclaraviolacindelderechoanosersometidoapenaso
tratosdegradantes(art.15CE),(AutodelJVPSevillade3dejuniode1988).Delamismamanerasuponela
vulneracindelaregla45delasReglasMnimasparaeltratamientodelosreclusos(ONU1973),que
expresamenteprohbeeltrasladodelosdetenidos,presosypenadosenmalascondicionesdeventilacino
deluz,oporcualquiermedioquesupongaunsufrimientofsico.
Cuandoserealiceunaconduccinenunvehculodeestascaractersticas,hayqueinterponerunaquejaante
elDefensordelPueblo,laFiscaladelTribunalSuperiordeJusticiadelaComunidadAutnomaenlaque
estubicadalacrcel,elJuzgadodeVigilancia,ycuantosorganismosinternacionalesdedefensadederechos
fundamentalesseconozcan.Enestosescritosesimprescindibledescribirlasituacinycircunstanciasque
rodeanalaconduccin:lugardesalida,dedestino,horasdeviaje,nmerodepresos,espacioenelquese
viaja,sensacionesquesehantenido,condicionesdeventilacinyluz,etc.(modelonmero5).
Esmuyimportantequeantetrasladosencondicionesqueatentencontralaintegridadfsica,porsuduracin
oespecialescondicionesdepenosidadsesoliciteunarevisinmdicaalallegadaalacrceldedestinopara
objetivarlainfluenciadeltrasladoenlascondicionesfsicas(AutoAPLARiojade31.12.2001)

9. Qu actuaciones administrativas se establecen realizar una conduccin?


Los traslados exigen una serie de preparativos que vienen regulados en la instruccin 23/96, de 16 de
diciembre:
Se destina al penado al Departamento de ingresos y salidas para la realizacin de un cacheo
personalyunregistrodesusobjetos.Tienequehacerselatardeanterioraltraslado.
Sedepositaelequipajeenunlugaradecuado.
Tienequerealizarseunreconocimientomdicodentrodelas24horaspreviasalasalidadela
conduccin, cuyos resultados se reflejarn en la hoja de control sanitario que acompaa al expediente
personal(seentregacopiaaljefedelaConduccinysehaceconstarenimpresoespecialsipresentaalgn
tipodelesin).
EntregaalinternodeHojainformativaydeunimpresoenelquepodrnformularlasquejaso
peticionesqueconsiderenconvenientes.
SilaconduccinnoserealizaconestospreparativoslapersonapresapuedeinterponerunaQuejaanteel
Juzgado de Vigilancia y ante el servicio de Inspeccin de la Direccin General de Instituciones
Penitenciariasindicandolosdatosnecesariosparaidentificarlaconduccin(dayhora,centropenitenciario
desalidaydedestino).
El centro penitenciario tiene que solicitar la peticin de conduccin con 30 das de antelacin cuando
supongauncambiodeprovincia,salvoqueporrazonesdeurgencianosepuedasolicitareneseplazo.En
estoscasos,elcentropenitenciariopuedenoentregarelexpedientepersonalsinohadadotiempoparasu
preparacin.
Recibidalaordendetrasladoseanotaenelexpedientepenitenciario,sepreparalahojadeconduccin
(documento que identifica al penado durante el traslado; en l se resea la filiacin y se realiza una
impresindactilardeldedopulgarderecho,tantoalasalidacomoalallegada;tambinreflejarsusituacin
penalypenitenciaria).Asimismo,tienenquellevaruncertificadomdicoemitidoporlaprisin,eloficiodel
directordelacrceldeorigendirigidoaldedestino,eloficioemitidoporelDirectorparalasautoridades
judiciales que correspondan Juez de vigilancia penitenciaria, Juez de Instruccin, si es preventivo,
comunicacinalCentroDirectivomediantesugrabacinenincursospenitenciariosylaordendesalida
firmadaporeldirector.Todaestadocumentacinseintroduceenunasobrecerrado,yenelexteriorsegrapa
elinformemdicoylahojadeconduccin.Todoestematerialseentregaalosencargadosdelaconduccin.
Concarctergeneralseentregarunbocadilloyunlitrodeaguamineralsiladistanciaessuperiora100
KM;asimismoseentregarunracionadoenfrocuandolallegadaalacrceldetrnsitoodedestinoest
previstadespusdelahoradelacomida.Atodoslosinternosselesfacilitardesupeculiopersonaluna
cantidadmximaequivalentealpagosemanal.Elrestodesupeculioleserremitidoalacrceldedestino(I
23/96 DGIP). Ante el incumplimiento de alguna de estas normas hay que hacer una Queja al Juez de
Vigilancia.

10. Algunas personas presas pueden hacer el traslado por sus propios
medios?
S.Laspersonasclasificadasentercergradoylasqueseencuentrenensegundoquedisfrutendepermisosde
salidapuedenrealizarlostrasladosconsuspropiosmediossinvigilancia,previaautorizacindelaDireccin
General.CuandosetratedecomparecenciasanterganosjudicialesserecabarlaautorizacindelJuzgadoo
Tribunal(art.37.1RP,eInstruccin23/96,de16dediciembre).Cuandounapersonatengaconocimientode
quevaasufriruntrasladoaotraprisinporcualquiermotivo(ejemplo,paralaprcticadediligencias
judiciales),tienequesolicitaraldirectorenunainstancia,lomsrpidourgentementequesepueda,la
posibilidadderealizarelviajepormediospropios;laJuntadetratamiento,siloconsideraviable,harla
propuestaalcentroDirectivo.SilacontestacinseretrasahayquehacerunescritoalJuezdeVigilancia
Penitenciariaexponindolelaurgenciadelasituacinparaqueautoriceeltrasladouobliguearesolverala
administracin penitenciaria ante la inminencia del mismo y la posible prdida del beneficio (modelo
nmero6).Sieltrasladoporlospropiosmediossedeniega,hayqueinterponerunaquejaanteelJuezde

VigilanciaPenitenciariautilizandolosmismosargumentosdelmodelonmero6.
Enestoscasosdetrasladoporautogobierno,losgastosocasionadoscorrernporcuentadelapersonapresa,
salvosituacionesexcepcionalesenlosquelaadministracinpenitenciariapagareltransportepublico.Nose
establecelegalmenteculessonlassituacionesexcepcionales,perosepuedeentenderrespectodequienes
seaninsolventes.Sieltrasladopormediospropiosesaotraprisin,elexpedientepenitenciarioseenvapor
correo.Alreclusoseleconcederuntiempoprudencialparaquepuedallegaralanuevacrcelytieneque
firmarlaordendesalidaalhaberquedadoenteradodelaobligacindepresentarseeldaylahoraquelehan
indicado.Igualmenteseleentregaunoficioaldirectordelaprisindedestinocomomediodeidentificacin.
Asimismo,elDirectordelacrceldeorigenmandarunFaxaldedestinoanticipandolaprximallegadadel
interno, adjuntando la situacinprocesal, penal y penitenciaria, adems de la fecha de incorporacin (I
23/96).Esmuyimportantellegaralahora,puesdelocontrariolaprisinpuedeimponeralgunasancine
inclusoregresardeterceroasegundogrado;enmsdeunaocasinhaocurrido.Obviamentesiestoocurre
hayquerecurrirloalJuzgadodeVigilanciaPenitenciaria
Estesistemadetrasladodeberapotenciarse,nosloporlaevitacindelriesgoqueparalavidaeintegridad
delaspersonasgeneraunaconduccinoficial,sinotambin,porrazonesestrictamenteeconmicasencuanto
alahorroquesuponealaadministracinunaconduccinoficial(vehculo,personal,combustible,etc.).

11.Qu son los trnsitos?


Enocasiones,laconduccintienequedetenerseparaquelaspersonaspernoctenencrcelespreviamente
determinadas:largadistanciaarecorrer,poraveradelmediodetransporte,cortesdecarretera,enfermedad
gravedealgnpasajero.Enestoscasos,laspersonastienenqueseralojadasenceldasodependenciasya
preparadasconseparacindelrestodelapoblacinreclusa,siemprequeseaposible(art.39RP),porrazones
de seguridad y de adaptacin de las personas trasladadas. La Instruccin 23/96 prev que las crceles
utilizadasenlaslneasregulares(itinerariosdeconduccin)tenganespaciosparagarantizarlaseparacindel
restodelosreclusos.Durantelaestanciaenestasprisiones,aunqueseadetrnsitotemporal,sepueden
interponerlasquejasquesequieranencasodevulneracindelanormativapenitenciariadeigualformaque
siestuviesenenlacrceldedestino.

12. Es posible suspender una conduccin?


En ocasiones una conduccin puede ser vivida como negativa por varios motivos: no querer asistir a
diligenciasjudiciales,temoraencontrarseconotropresoconquienexistengravesdiscrepancias,temora
perderlascomunicacionesetc...Paraello,sonconocidosportodoslossistemasdeautolesinuotrosquese
utilizanparaintentarsuspendereltraslado.Novoyaentraravalorarsiespositivoonegativo,cadapersona
eslibredeactuardeunaformauotra.Ahorabien,esbuenosaberqueesasconductaspuededarlugaraun
partedisciplinarioyqueellotieneconsecuenciasnegativasenlaconcesindepermisosyenlasprogresiones
degradopresentesyfuturas,ascomoeldeteriorofsicodelaautolesin.Loquesiparececlaroesqueal
finallaconduccinsellevaacabo,esedauotroposterior.LaInstruccin23/96daindicacionesparaestos
casossealandoquecuandoelinternopresenteanomalasfsicas,opsquicassesolicitarunaconduccin
especialalasubdireccingeneraldesanidadpenitenciariaparahacerloenambulanciayconescolta.Porello
parecemseficazexponerlasituacinaldirector,encuantoseconozcalaconduccin,porlaquenoquiere
serconducido.Anteestaopcinsepuededecirqueenmuchasocasionesnoseavisadelaconduccinhasta
momentoantesdellevarlaacabo.EstoesciertoysiocurrehayquedenunciarloalserviciodeInspeccinde
laDGIPyalJuzgadodeVigilanciaPenitenciaria.

13. Cmo debe ir el equipaje y quin debe abonar los gastos de traslado
de equipaje?
Elequipajedebetenerrotuladoelnombredelpropietarioparafacilitarsuidentificacinyconteneruna
relacindetalladadeobjetos;nopodrexcederde25KG,nielvolumendeunamaletatipofamiliar;el
excesodeequipajeylosefectosnoautorizadososusceptiblesdedeterioropodrnserentregadosalapersona

quedesigneelinternopreviasolicitudoremitidoalacrceldedestino(I23/96yautodeAPSantander
8.2.2001).
LaadministracinPenitenciariacubrirhasta25KG(20KGsiesenavin),corriendoacargodelpenadoel
restosalvosituacionesexcepcionales(carenciademedioseconmicos).Cuandoaunapersonalatrasladen
forzosamentesinqueexistanrazonesfamiliaresojudiciales,laadministracinpenitenciariatienequeabonar
losgastosgeneradosporeltrasladodeequipajedebidoalainjusticiadelasituacin.Demaneraquecuando
noconstequeeltrasladoseaporpeticinpropiaelabonodelosgastosdetransportedeTVdebencorrera
cargodelaadministracin(AutodelJVPnum.3deMadridde27.11.2002).Estainterpretacinpuedetener
fundamento normativo en la regla 50 de las Penitenciarias Europeas que figuran como anexo a la
recomendacinR.(87)delComitdeMinistrosdelConsejodeEuropaqueestablecequeeltransportedelos
presosseharacargodelaadministracin;portanto,estareglapuedeextenderseasuequipaje.
Cuandoestonoocurraylacrcelobligueapagarlosgastosdetransportedeformaparticular,hayquehacer
unescritodequejaalJuezdeVigilancia(modelonmero7);siestelodesestimahayquehacerunrecursode
reformaanteelmismoJuzgado;silovuelveadesestimarhayquepediralJuzgadoquedesignenunabogado
yprocuradordelturnodeoficioparainterponerunrecursodeapelacinantelaAudienciaProvincial.Ysila
Audiencia lo desestima hay que pedir abogado de oficio para recurrir en amparo ante el Tribunal
Constitucional. Igualmente hay que hacer una queja ante el Defensor del Pueblo y la Fiscala
correspondiente.
Lasquejasporprdida,extravoodeteriorodelosobjetosoenserespersonalesdelapersonatrasladada,o
pornohaberserecibidoenlacrceldedestinoalgunooalgunosdelosobjetosretenidosenlacrcelde
procedencia,oensolicituddeladevolucindelosgastosdeltransportecuandoyahansidocargadosenla
cuentadelpeculiodelrecluso,hayqueinterponerlasanteelJuzgadodeVigilanciaPenitenciariadelacrcel
delaqueelpresoprocede,ynoenlaqueseencuentra(Criterio7JVP,enero2003).
Enloreferentealtrasladodeaparatosdetelevisinuordenadores,laDireccingeneraldeInstituciones
Penitenciarias seala que no podr llevarlos consigo, pudiendo serle enviados a travs de agencia de
transporte,siendoasucargolosgastosdelmismo,oentregadoasusfamiliaresopersonasquedesigne(I
21/96DGIP)..

14. Cunto dinero se puede llevar en los traslados?


Segnlainstruccin23/1994,1.000ptas(seiseuros).Peroestacantidadesinsuficiente.Elart.24LOGP
recogeelderechodelaspersonaspresasalaadquisicinporsucuentadeproductosalimenticiosyde
consumodentrodeloslmitesreglamentariamentefijados.Porello,deberfacilitarsealpresolacantidadque
necesitesinquepuedarebasar8.000ptas.(AutodelJVPdeCiudadRealde22demarzode1995).

15.

Qu

ocurre

con

el

traslado

de

mujeres

con

hijos

menores

en prisin?
Enestoscasos,lasmujeresserntrasladadasdeformaordinariayloshijossernentregadosalosfamiliares
queestnenelexteriorparaqueseencarguendeltraslado.Denoserposible,viajarnjuntoconsusmadres
envehculosidneosyestarnacompaadosporpersonalocolaboradoresdeInstitucionesPenitenciarias.Ha
dequedarsiempreasalvolasensibilidaddelosnios(art.37.2RP).

16. Qu caractersticas tienen los desplazamientos a hospitales no penitenciarios?


En ocasiones algunas citas mdicas para acudir a hospitales se pierden porque se dice que no existen policas
suficientes para el traslado. Estas salidas para consulta o ingreso las acuerda el Centro directivo y
posteriormente es el Director de la crcel quien tiene que solicitar a la polica o Guardia civil la conduccin
concreta (art. 35 RP). En los casos de imposibilidad por la ausencia de policas se puede acudir a otras vas:
- Permisosextraordinarios(art.155.4RP).

- Desplazamientosporlosmediospropios(art.37RP).
- Concesindepermisosordinarios.
Porello,cuandosetengaunacitamdica,ysesolicitelaconduccin,sieldirectordelacrceldicequese
suspendeporfaltadepolica,sepuedesolicitarurgentementealgunadeestastresposibilidades,yantesu
denegacin,sedeberinterponerunrecursodequejaanteeljuezdeVigilanciaparaque,ensucaso,las
autorice.Enloscasosenqueunapersonadisfrutedepermisosordinariosdesalidaestasposibilidadesson
mssencillasdeconseguir.

17. Puede una persona ser trasladada a otra prisin si tiene pendientes
pruebas mdicas?
No.LaInstruccindelaDGIP2/98loprohbe.Laadministracinpenitenciarianopuedeasegurarlasalud
de lospresosconmedios propios,sinoquedebecompletarsecon el apoyoespecializadode la sanidad
pblica.Enocasionesdeterminadasconsultadasopruebascomplementariasnoseproducenconcarcter
inmediatoyaquesesometenalaplanificacinquellevanacaboloshospitalespblicos.Sisonmuchoslos
mesesquehayqueesperarelpresohapodidosertrasladadoconelconsiguienteperjuicioparaelpesoypara
elhospital.
PorellolaI2/98sealaqueantelacomunicacinporpartedelaoficinadergimendellistadodeinternosa
trasladaraotrascrceles,elsubdirectormedicoojefedeServicios,solicitardelpersonalasucargola
relacindeaquellosqueestnsometidosatratamientoopendientesdecitaparaconsultaespecializadaopara
realizacindepruebascomplementarias.Sieltrasladoestemporalsevalorarasilaconsultaopruebaestaba
previstaparaantesdelregresodelinternoalacrcel.Enestecasosesuspenderlaconduccinsalvoquesea
posibleposponerlacitasindificultadyestonosupongaperjuicioparalacontinuidaddelaasistencia.Side
acuerdoconlos criterios anteriores, procediere a suspender el traslado y el motivo del mismo fuese la
celebracindeljuicio,secomunicaraljuzgadotalcircunstanciasporsisteestimaoportunoproponerotra
fecha.Encualquiercasoseestaraloquedispongalaautoridadjudicialenunouotrosentido.Siesun
trasladodefinitivo,sevalora,siprocedesuspenderelmismohastalanormalizacindelasituacin,osipor
elcontrariopuedegestionarsedenuevodesdeelcentrodedestinosinmenoscabodelacontinuidaddela
asistencia.

18.Es posible un traslado por motivos educativos?


S,elCentroDirectivopodrconceder,previoinformedelaJuntadeTratamiento,trasladosdecrcelpor
motivoseducativos.Lapersonapresatienequesolicitarlosconladebidaantelacin.Sepuedeconcedersino
existenmotivosdeseguridadqueloimpidan(Art.121RP).

Captulo 3
OBSERVACIN, CLASIFICACIN Y TRATAMIENTO
1.Qu es la clasificacin penitenciaria?
LafinalidadquelaConstitucinotorgaprincipalmentealapenadeprisineslareeducacinylareinsercin
socialdelaspersonascondenadas.Paralaconsecucindeestosobjetivosreeducativoslacrcelutilizaun
conjuntodeactividadesteraputicas,educativasydeportivasqueconstituyenloquelegalmentesedefine
como tratamientopenitenciario. Asuvez a cada persona presa se le asigna una situacin penitenciaria
(grado)rgimencerrado(clasificadosenprimergrado),ordinario(clasificadosensegundogrado,tambin
aplicables a los detenidos, presos preventivos, penados sin clasificar porque an no se haya recibido el
testimoniodelasentencia,penadosinclasificarquetengadecretadasimultneamenteunprisinpreventiva),
yabierto(clasificadosen tercergrado)quesecorrespondeconundeterminadorgimen(conjuntode
normasdeconvivencia)devidaenprisin(horariosdepatio,cacheos,actividades,recuentos,permisosde
salida)yquevaaposibilitarlarealizacindeundeterminadotratamientopenitenciario.Esteprocesode
asignacindegradosedenominaclasificacin.

2. Cuntos grados de clasificacin existen?


Existentresgrados(1,2,y3)ladoctrinaotorgaalalibertadcondicionalelcuartogradodetratamiento.
Laspersonasclasificadasenprimergradocumplenlascondenasencrcelesdondeseaplicaunrgimende
vidaestablecidoporlasnormasdelrgimencerrado.Losclasificadosensegundogradocumplenpenasen
crcelesenlasqueseaplicaelrgimenordinario.Laclasificacinentercergradodeterminalaaplicacindel
rgimenabiertoencualquieradesusmodalidades:Seccionesabiertas,CentrosdeInsercinsocial(art.163
RP),UnidadesDependientes(art.165RP),UnidadesdeMadres(art.178.RP)yUnidadesextrapenitenciarias
privadasopblicasparalaatencinadrogodependientes(art.182RP).
ElnuevoReglamentoPenitenciariohaflexibilizadolaaplicacindelosregmenesdevidadelosdistintos
gradospermitiendoque,apropuestadelEquipoTcnico,laJuntadeTratamientopuedaadoptarrespectode
cadapersonapresaunmodelodeejecucinenelquepuedancombinarseaspectoscaractersticosdecadauno
delosmencionadosgrados,siempreycuandodichamedidasefundamenteenunprogramaespecficode
tratamientoquedeotraformanopuedaserejecutado.Estamedidaexcepcionalnecesitardelaulterior
aprobacindelJuezdeVigilancia,sinperjuiciodequeseejecutesinesperarlaresolucindeste(art.100.2
RP).
Estesupuestopuedeserbeneficioso,perotambin,enocasiones,puedeperjudicargravemente.Esteartculo
puedepermitirqueaunapersonaclasificadaensegundo/tercergradoleapliquenelementosdevidadeun
primergrado.Estoyahaocurrido.ElJVPdeSantanderenelAutode9deoctubrede1996estimalaQueja
deunpresoquefuesometidoaunrgimendevidaconelementosrestrictivosparaelquelacrcelutilizel
art.100RP.ElJVPargumentaqueanteunasituacinqueasloexija,elCentroPenitenciariopodrutilizar
losmedioscoercitivosysancionadoresquepermitelanormativay,ensucaso,laregresindegradodel
interno,peronosometeralmismoaunrgimennoacordeconsuclasificacinnisiquieraporlavade
entenderquesetratadeunamedidatratamentalpueseltratamientoesvoluntarioynopuedeaplicarseen
contradelinterno.Esteautosealaqueesteartculo100RPvulneraelprincipiodelegalidadporquela
LOGPestablececlaramente4gradosdeclasificacinynorecogeelsistemaflexibledelReglamento.En
consecuencia,deacuerdoconestalegislacinnocabeestablecerregmenesintermediosoflexiblesapesar
desu,sinduda,mayorbondadyrelevanciaprcticadecaraalareinsercin.Portantodeberechazarsela
aplicacinapenadosclasificadosensegundogradoaspectospropiosdelprimero,oapenadosclasificadosen
tercergrado,aspectospropiosdelsegundo.
Habrqueestarpendientesdelaaplicacindeestesupuestoafindedenunciarporvaderecursosituaciones
restrictivas,desfavorablesoperjudicialesparaelrgimendevidadelapersonapresa.Y,encualquiercaso,

debido a que esta situacin no viene descrita por la Ley General Penitenciaria, entendemos que es
absolutamentenecesarioqueelJuezdeVigilanciaapruebeelprogramacombinadodegradosdetratamiento,
sisequierepaliarconestecontroljudicial,lavulneracinelprincipiodejerarquanormativa(principiode
legalidadarts.9,25y53CEyart.2LOGP).
Estaposibilidaddetratamientoflexiblesepuedesolicitaryportanto,aplicarsejudicialmenteparapresos
clasificados enprimer gradocon la posibilidad de ampliar el nmero de horas de patio o de acceso a
instalacionescomunesodeparticipacinenactividadesencomn,oalgunasalidateraputica.Tambinse
puedeaplicarapresosclasificadosenrgimenordinarioquedisfrutanreiteradamentedepermisosdesalida
sinincidenciasnegativas,peroquetienenpenasmuyelevadasounpronsticodereincidenciamuyalto
(segninformesdelcentroDirectivo).Aestosefectossepodramantenerelsegundogradohastaqueel
pronsticodereincidenciasereduzca,peroconlasventajasdeltercergrado:incrementandohasta48dasel
lmitecunticodelospermisosyconcederlosfinesdesemanapropiosdeltercergrado,art.82.(JVP3
Madrid,de1dejuniode2003).Enelmismosentido,yalosefectosderomperelcrculoviciosoenelque
alserextranjerolaexistenciadegarantasimpidelaconcesindepermisosylainexistenciadestosimpide
laprogresinatercergrado,podraserdeaplicacinelart.100.2RPnocomofrmuladefinitivasinocomo
pasointermedioymecanismoderupturadelasituacinplanteada,paraencaminarseenunfuturoaltercer
grado(AutoAPMadridde3dejuniode1999yde18dejuliode2000).Tambinsehaaplicadoporla
Audiencia Provincial, a travs de un recurso de apelacin, para paliar la ausencia de permisos, poder
prepararlavidaenlibertadqueseibaahacerefectivaenpocosmeses,parapoderevaluarelsentidodela
responsabilidadyelusodelalibertad;enestesupuestoseleconcediunsegundogradoconlassalidasal
exteriorlosfinesdesemanaart.100y87RP,APMadrid5de12deseptiembrede2000,conidntico
contenidoelAutoAPMadrid,5de15deseptiembrede2000
Apesardeelloenlaprcticaesteartculo100.2seaplicaenpocasocasiones,puessialclasificadoen
segundogradoselequiereaplicarunprogramadetratamientoquenecesitemslibertadselepuedeaplicar
elart.117RP;siestuvieseentercergrado,lalegislacinpermitetodaslasposibilidadesenrelacinauna
mayorlibertaddemovimientos;ysiestenprimeroselepuedeprogresardefaseodegrado.

3. En qu debe consistir legalmente la observacin?


ParaquelaJuntadeTratamientopuedaproponeraunapersonaparaungradodeclasificacindeterminado
(unrgimendevida)esnecesarioquesetenganencuenta algunosdatospersonales,familiares,sociales,
laborales,etc.Paraconseguirlosesnecesarioque,previoalaclasificacin,existaunperododeobservacin
delciudadanopreso.
Esteperiodo,segnlaleypenitenciaria,consistirenlarecogidadedatosdocumentales,deentrevistasyde
laobservacindirectadelcomportamiento(art.64.1LOGP).Unavezquelasentenciacondenatoriasea
firme,esainformacinsecomplementarconunestudiocientficodelapersonalidaddelpenado.
Con todos los datos recogidos, el Equipo de Tratamiento deber formular la determinacin del tipo
criminolgico,eldiagnsticodecapacidadcriminalydeadaptabilidadsocial,ascomounapropuestade
gradodetratamientoquedeberserrazonada,yunapropuestadedestinoaltipodecrcelquecorresponda
(art.64.2LOGP).Adems,enelprotocolodeclasificacin,deberconstarunprogramaindividualizadode
tratamientodestinadoadarcoberturaalasnecesidadesycarenciasdetectadas.Enesteprogramasesealarn
expresamentelosdestinos,actividades,programaseducativos,trabajoyactividadesocupacionales,odeotro
tipo,quedebaseguirlapersonapresa(art.103.3RP).
Estosdatossonimprescindiblesytienenenlaprcticaunaimportanciaesencialparaeldesarrolloposterior
delacondena.Conlosdatosobtenidossevaarealizarunaclasificaciny,seguramente,deellossevaa
hacerdepender,principalmente,lasposterioresclasificaciones,ascomotodaresolucinqueimpliqueuna
salidaalexterior(permisos).Deahque,encasoderecursocontraunaclasificacinengradoocontrala
denegacindeunpermiso,esteprotocolodeclasificacin,contodosestosinformes(siestnhechos),debe
solicitarse a travs del Juzgado de Vigilancia o de la Audiencia Provincial, para que se incorporen al
expedientepenitenciarioyalrecurso.
Porelloesmuyimportantequeeseestudioestbienhecho,circunstanciaquenoocurre,yaqueenlos
protocolosdeclasificacinnosiemprefigurantodoslosdatos,informescompletos,oformulacionestcnicas.

Asimismo,habraqueconocerlaformadeobtencindelosmismosy,sisonrealmenteelreflejodela
personalidad y circunstancias del preso, o se han hecho en formulariostipo, previamente diseados,
limitndosearellenaresosprotocoloscondeterminadosdatos.Enmuchasprisionesseconfeccionaloquese
denominaprotocoloabreviado,ycuentanconunescasoconocimientodelpreso(vid.InformedelDefensor
delPueblode1995).
Anteestasituacin,losresponsablesdelaprisindeberantenerencuentainformesdetodotipoqueotros
tcnicosqueconozcanalapersonaenelexteriorpudiesenaportar.

4. Cunto tiempo de observacin es necesario para la clasificacin inicial?


Noexistetiempomnimodeobservacinparalaclasificacininicial.Legalmenteseestablecequeaqulla
seaadecuada,yqueeltestimoniodelasentenciahayallegadoalacrcel.Apartirdesurecepcinse
estableceunperododedosmesesparaquelaJuntadeTratamientoformuleunapropuestadeclasificacin
(arts. 102.1 y 103.2 RP). No es necesario que llegue la liquidacin de condena para la propuesta
clasificatoria.LosJuzgadosyTribunalessentenciadorestardanbastanteenremitirla,perolapropuestade
clasificacinsepuedehacerperfectamenteconlosclculosefectuadosenelexpedientedelpenado.
Aefectosprcticosesmuyimportante,comoyahemosdicho,queelpenadoingreseconeltestimoniodela
sentencia.Paraello,silapersonaescitadaenlasecretaradelJuzgadoparaingresarenlacrcel,hayque
solicitarque,juntoalmandamientodeprisin,seadjunteeltestimoniodelasentencia.Encasodequese
ingrese sin ella hay que solicitar al Juzgado sentenciador que lo remita con la mayor brevedad posible
(modelonmero8).

5. Cules son los criterios legales de clasificacin?


a)Penalesyprcticos:duracindelaspenasymedidas,medioalqueprobablementeretornar,recursos,
facilidadesydificultadesexistentesencadacasoymomentoparaelbuenxitodeltratamiento(art.63
LOGP).
b) Cientficos: predominantemente psicolgicos, sociolgicos y criminolgicos. As, historial individual,
familiar,social(profundizacinenelorigenydesarrollodeestosmbitosenelprocesodesocializaciny
maduracindelapersona)ydelictivos(anlisisdelosdelitoscometidosalolargodelavida,ascomode
lasvariablesquehanpodidointervenirenl)delapersonapresa(arts.62y63LOGPyart.102.2RP),tipo
criminolgico,sociedadcriminal,sectoresorasgosdelapersonalidad(inteligencia,motivacin,emocin,
autoconceptooidentidad,actitudes)directamenterelacionadosconsuactividaddelictiva,conductaglobal,
etc.
c)Conceptosjurdicosindeterminados:art.43.2LOGP:estimarque,bieninicialmenteoporevolucin
favorableensegundogrado,puedenrecibirtratamientoenrgimendesemilibertad.

6. En la prctica, cmo se realiza la propuesta de clasificacin?


En la mayora de las prisiones, la clasificacin se realiza tras una breveentrevista con el psiclogo, el
trabajadorsocialyelcriminlogo,valorndoseespecialmenteeltipodedelito,eltiempodecondena(el
tiempo elevado de condena debe ser tenido en cuenta, como elemento relevante a efectos de valorar la
procedencia en la clasificacin en le grado que proceda Auto AP Pamplona de 14.5.2003), aspectos
meramentedisciplinariosydesumisinalordenpenitenciario.Otrotipodeaspectos(maduracinpersonal,
medios extrapenitenciarios de apoyo a la reinsercin, etc.), tienen una consideracin subsidiaria en la
prctica.Demaneraque,enocasiones,loscriteriosquelegalmentevienenestablecidosquedanincumplidos.
En la prctica domina lo disciplinario, y ello depende de los informes y partes de los funcionarios de
vigilanciaydeleducadorquesonquienestienenmscontactoconlaspersonasreclusas.Losmiembrosdel
EquipodeTratamientodesconocenalospresosy,asuvez,stostambindesconocenenlamayoradelas
ocasionesaaqullos.Estasituacincontradicelanormativapenitenciariapues,comosealaelAutodelJVP
deMlagade4denoviembrede1993:elfuncionamientodelEquipodeTratamientodebeserefectivo,

debiendo visitar todos los miembros a los internos, no slo el educador, para facilitar la progresin
penitenciariaylograrlareinsercinsocial.Enestemismosentido,elart.273.f)RPdisponequelosEquipos
deObservacinyTratamientotienencomocometido,adems,orlaspeticionesyquejasqueformulenlos
internosrespectodelaclasificacinytratamientoyadoptarlosacuerdosqueestimenpertinentessobrelas
mismas...ascomomediantelastcnicasadecuadas,laintegracinpersonalycolectivadelosinternosenel
trabajo y en la organizacin laboral (art. 273.i) RP) Estas obligaciones legales quedan desatendidas en
muchoscasos(verAutodeJVPOviedode24defebrerode1995).
Enloscasosenquesesoliciteentrevistasconlosprofesionalesdelaprisin(trabajadorsocial,psiclogo,
educador,mdico,jurista,subdirectores,etc.)ynoseconcedanenplazosrazonables,hayqueinterponer
quejaalJuzgadodeVigilanciaPenitenciaria,alaFiscala,alDefensordelPuebloyalaDireccinGeneralde
Instituciones Penitenciarias (modelo nmero 10). Es muy importante que, aunque algunos de estos
organismosnotenganposibilidadesdirectasdeordenarlasentrevistas,conozcanlassituacionesylasreflejen
ensusinformesanuales.

7. Cmo se realiza la clasificacin inicial?


Unavezquehayallegadoeltestimoniodesentenciaalacrcel,laJuntadeTratamientodebehaceruna
propuesta de clasificacin al Centro Directivo (Direccin General de Instituciones Penitenciarias) y de
destinoaunacrcelconcreta(conformealaI20/96).EstaLapropuestadeclasificacinquerealizalacrcel
noesmsqueunapropuesta,esdecir,quenecesitaconfirmacin.Aestosefectos,quienresuelvesobreella
eselCentroDirectivo(DGIP).Lodebehacerdeformaescritayrazonadaenelplazodedosmesesdesdela
recepcindelapropuestadeclasificacin.Esteplazopuedeserampliadohastadosmesesmsparalamejor
observacindelaconductaylaconsolidacindefactorespositivosdelpenado(103.6RP)Ahorabien,el
lmitelegalordinarioesdecuatromeses:dosparalapropuestadelacrcelydosparalaresolucindel
CentroDirectivo.Elplazoextraordinariodedosmesesmsparalaemisindelaresolucindefinitivaslo
puede hacerse para laobservacin de conducta y la consolidacin de factores positivos. Estos trminos
generanunagraninseguridadjurdica;porellotienequecomunicarsetalsituacinalafectadoyalEquipo
Tcnico,quiendeberrealizarunseguimientoespecial,informandoalCentroDirectivodelasnovedades
acaecidas(Instruccin20/96).Demaneraque,enesteplazoextraordinarioderesolucinnotienecabida
otrotipodeargumentoscomoexcesodetrabajo,faltadediligencia,represaliacastigo,esperaaquenuevas
condenas sean firmes. Y, esta justificacin, debe hacerse razonadamente, explicando detalladamente los
motivosdelretraso,enfuncindelosdossupuestosprevistoenlaley(mejorobservacindelaconductayla
consolidacindefactorespositivosdelpenado),yporningunaotracausams.
LaresolucinqueseadoptesernotificadaalapersonapresaparaquepuedainterponerrecursoanteelJuez
deVigilanciaPenitenciaria(modelonmero9.a).Enesterecursoesmuyimportantequeseexpliquen(por
escritoenelrecurso,yatravsdeentrevistas)alJuezdeVigilanciaoalJuzgadooTribunalSentenciador
AudienciaProvincialtodaslascircunstanciasconcretasqueconcurrenenelrecluso(personales,sociales,
familiares,teraputicasetc.).Estascircunstanciastienenqueacreditarseatravsdeinformesemitidospor
profesionales.Enestesentido,loscriteriosdeactuacindelosJuecesdeVigilanciasealanquelaprueba
pericialnohadelimitarsenecesariamentealosinformesdelosEquiposdeObservacinyTratamiento,sino
queelJuezdeVigilanciapodrcontarconelasesoramientodelosmdicosforensesodeaquellosotros
expertosqueestimeconveniente(criterioRJVPnm.12).EnloscasosenqueelJuezdeVigilanciadicte
resolucinconcediendoeltercergradoyacordandoeldestinoaunainstitucinextrapenitenciariaparael
tratamientodelasdrogodependencias,seprepararalamayorbrevedadelcorrespondienteexpedienteyse
deberremitiralServiciodeTratamientoparaelcorrespondientetraslado(I19/96).

8. Qu es el protocolo de clasificacin?
Es una parte del protocolo de personalidad (documentos, informes y estudios que afectan al rea de
tratamientoaspectospsicolgicos,educativosysociales)quecontienetodoslosaspectosrelacionadoscon
el procedimiento que se sigue para asignar un grado de tratamiento, as como sus modificaciones. El
protocolodeclasificacindebecontenerciertainformacin(Instruccin20/96,de16dediciembre):Copia

de hechos probados en la sentencia, informe de conducta, informe psicolgico y modelo de programa


individualizadodetratamientoPIT);seadjuntanademsinformesespecficossisetratadeclasificacinen
tercer grado o en primero. Las propuestas de clasificacin y destino Modelo PCD establecido por la
Instruccin20/96debencontener:
Datosidentificativosdelpenado:nombre,apellidos,fechadenacimiento,residencia,sexoyedad.
Datos penales: Antecedentes penales, condenas a cumplir, causas, delitos, perodos de prisin
preventiva,fechasdecumplimiento(1/4,2/3,3/4).
Datos penitenciarios: historial, nmero de ingresos, fecha del primer ingreso, de la ltima
excarcelacin,prisininterrumpida.
Datos objetivo de comportamiento: Descripcin de la conducta penitenciaria, sanciones sin
cancelar,recompensas,permisosordinarios,participacinenactividadesyprogramasdetratamiento.
Motivacin: se trata de realizar una valoracin de los datos anteriores: primariedad delictiva,
relacionesfamiliaresvinculantes,ausenciaopresenciadetoxicomana,reconocimientodelhechodelictivo,
hbitos laborales, entorno marginal de procedencia, reincidencia, prisionizacin, trastornos de la
personalidad,pronosticodereincidenciaenelfuturoalto,medio,bajo).Tambintienequevalorarsela
antigedaddeldelito,labuenaevolucinpenitenciaria,eldisfruteadecuadodepermisosetc...).
Documentacin adjunta al acuerdo: Informes mdicos con diagnstico y pronstico, sociales,
psicolgicos,familiaresyensucasolaborales,testimoniosdesentencia(copiadehechosprobados).
Acuerdo:Contienelapropuestadegradoydedestino.Tambintienequehacerseconstarsifuepor
unanimidadopormayoraconexpresindevotosafavoroencontra.

9. Qu ocurre con las personas que han sido condenadas a penas cuya
suma no exceda de un ao?
Comoestetiempoesmuycorto,ydebidoqueelprocesodeclasificacinsepuedealargareneltiempohasta
seismeses,afindeposibilitarqueelpenadopuedadisfrutardepermisosodelibertadcondicionalode
rgimenabierto,esimportantequelaclasificacinsealomsrpidoposible.AesterespectolosJuecesde
VigilanciaPenitenciariaensureuninde2003establecieronelsiguienteacuerdo:afindeevitarlaprdida
debeneficiosenlaspenasprivativasdelibertaddecortaduracin(menosgravesyleves),seencarecela
mximaagilizacinenelenvodeltestimoniodesentenciayliquidacindecondenaalestablecimiento
penitenciario por los Jueces y Tribunales sentenciadores, as como la tramitacin con urgencia de la
clasificacininicialylaprogresindegradoparalaconcesindelalibertadcondicionalcuandoproceda,por
partedelosrganospenitenciarios(criterio21,JVP,2003).
Porestosmotivos,cuandolapersonahayasidocondenadaaunaovariaspenasquenoexcedandeunao,la
propuestadeclasificacininicial,ensegundootercergrado,formuladaporlaJuntadeTratamientodela
crcel,siemprequeseaadoptadaporacuerdounnimedesusmiembros(esdecirportodossusmiembrosy
no por una mayora de ellos), tendr la consideracin de resolucin de clasificacin inicial a todos los
efectos, salvo cuando se haya propuesto la clasificacin en primer grado, en cuyo caso, la resolucin
corresponderalCentroDirectivo.Perolosacuerdosdeclasificacinentercergradoadoptadosporlas
JuntasdeTratamientosobrepenadosconcondenasdehastaunaosegnelart.103.7RPnotendrnefectos
ejecutivossiexistiereresponsabilidadcivilnosatisfecha.Enestecaso,laspropuestassetramitarnconforme
aloestablecidoen losapartadosf)yg)anteriores,remitindola,ensumomentoalCentroDirectivo(I
9/2003DGIP).
Enestossupuestos,lamencionadapropuestasernotificadaalpenadolaspersonaspresasafindeque
puedan recurrir, si lo desean, ante el Juez de Vigilancia. Si la clasificacin fuese en tercer grado, la
notificacin de la propuesta se realizar tambin al Ministerio Fiscal (art. 103.7 y 8 RP). Cuando el
Reglamentoestablececondenasdeunaoseentiendequeenestecmputotemporalseincluyenlaspenasde
prisin, los arrestos de fin de semana si se quieren cumplir ininterrumpidamente y los das de
responsabilidadpersonalsubsidiariaencasodeimpagodemulta.

10. Se puede clasificar a una persona que tenga causas pendientes?


S, salvo que tuviere alguna causa en prisin preventiva. En este caso no se formular propuesta de
clasificacin.Silapersonapresayaestuvieraclasificadaylefueradecretadaprisinpreventivaporalguna
causa penal, la clasificacin quedar sin efecto (art. 104.1 y 2 RP) y tendr el rgimen de los presos
preventivosrgimenordinarioocerradoart.10LOGP.Estadesclasificacindebeseradoptadaporla
JuntadeTratamientoynotificadaalCentroDirectivo(I20/96).
Esimportantehacerhincapienquetienequeexistirunautodeprisinpreventiva,porquesielJuezde
Instruccinacuerdalalibertadprovisionalporesacausa,laclasificacinquetenaconanterioridaddebe
volver a tener efectividad. Pero esto no siempre es as. Desde el punto de vista de la administracin
penitenciaria, siguiendo la Instruccin 20/96, si el penado estaba clasificado en segundo grado cuando
aparecelacausapreventivaystaledesapareceantesdelosseismeses,estasituacinsedebecomunicaral
CentroDirectivoparaasignarelmismogradodetratamiento,salvoqueconcurrannuevascircunstancias.Si
han transcurrido ms de seis meses hasta que desaparezcan las causas preventivas, debe estudiarse
nuevamenteelcasodebiendoformularlaJuntadetratamientounanuevapropuestaconactualizacinde
datosynuevosinformes(I20/96).
Ennuestraopininyenladealgunosjuecesdevigilanciapenitenciaria,sinohansobrevenidocircunstancias
nuevas,enloscasosenquelospenadosseencuentrenentercergrado,yacontinuacinsedecreteprisin
preventivaporotracausa,sepuedesuspenderesegradoyvolveralrgimenordinario(rgimendelosno
clasificados),peroencuantoserevoquelaprisinpreventivaysedecretelalibertadprovisionalporesa
causa,debepasarinmediatamenteatercergrado(AutodelJVPCastillaLennm.1de10deoctubrede
1997).Aunqueunapersonatengavariosprocesosjudicialesabiertos,sienunmomentodeterminadoslo
estprivadodelibertadporunodeellos,nopuedeserlapluralidaddeprocesosunacausaderegresinde
gradoporrespetoalderechofundamentalalapresuncindeinocencia(Auto375/98APMadridseccin5
de1deenerode1998)
Enalgunascrceles,apesardequedarenlibertadprovisionalporlacausaquemotivlasuspensindel
tercergrado,sedejaalaspersonasensegundo.EnestoscasoshayquerecurriralJuzgadodeVigilancia
Penitenciaria.SielrecursosedesestimahayquehacerunodereformaanteesemismoJuzgado;silovuelvea
desestimarhayquepedirquedesignenunabogadodeoficiopararecurrirenapelacinanteelJuzgadoo
Tribunalsentenciador,yquemientrassedesigna,sesuspendaelplazoparainterponerelrecurso.Sise
desestimalaapelacinaAudiencialodesestima,hayquesolicitarabogadodeoficioyprocuradorpara
recurrirenamparoanteelTribunalConstitucionalsisevulnerasealgnderechofundamental.Ademsde
ello,hayquehacerunaquejaalDefensordelPuebloyalaFiscaladelTribunalSuperiordeJusticiadela
ComunidadAutnomadondeseencuentrelacrcel.
Puedeocurrirqueunapersonahayasidojuzgadaperoquecontineenprisinpreventivaporhaberrecurrido
al Tribunal Supremo. En caso de que sea improbable que se gane el recurso, habra que estudiar la
posibilidaddedesistirdelrecursodecasacinafindeserclasificadoloantesposibleypoderdisfrutardelos
beneficiospenitenciariosquelecorrespondan,ascomoparapoderobtenerpermisos,eltercergradoola
libertadcondicional(modelonmero13).Lomismopodrahacersesiunapersonaqueestpenadapor
algunacausa(A)ytieneotraenelSupremo(B)lequedapocotiempoparacumplirlaprimera(A)ysabeque
siserefundenlasdos(A+B)podra,enpocotiempo,accederalalibertadcondicional;yencambio,siespera
unpocomsdetiempo,esposiblequelacondena(A)selicencie,quedeenlibertadyluegotengaquevolver
acumplirtotalmentelanueva(B).

11. Se puede clasificar a una persona directamente en tercer grado?


S,salvoquelapenaseasuperioracincoaos(art.36.2CPreformadoporLO7/2003),encuyocasohabr
queesperarlamitaddelacondenaparalaclasificacinenrgimenabierto.Paraloscondenadosapenas
inferioresacincoaos,nohayningnlmitetemporalparalaclasificacininicialentercergrado.Elnico
requisitoqueseestableceeslanecesidaddequeexistauntiemposuficientedeestudioparaqueelcentro
penitenciario obtenga un adecuado conocimiento del penado que le permita valorar las variables
intervinientesenelprocesodeclasificacin.

Aestosfinesdeclasificacindirectaentercergradoesnecesarioqueconcurranfavorablementedeforma
cualificadalasvariablesintervinientesenelprocesodeclasificacinqueestnenumeradasenelartculo
102.2 RP, valorndose especialmente el historial delictivo y la integracin social (art. 104.3. RP)
primariedaddelictiva,relacionesfamiliaresnormales,trayectoriafamiliarconsolidada,trayectoriaregular
penitenciaria,desempeodetrabajosconregularidad,ausenciadeconflictividadenelcomportamiento(Auto
JVPdeLogroode20denoviembrede1996).
Para la clasificacin directa en tercer grado es conveniente que la persona ingrese en prisin con el
testimoniodelasentenciayconlosinformesqueacreditenelprocesodenormalizacindevida(informe
social,psicolgico,contratosdetrabajo,librodefamilia,etc.).Estaclasificacindirectaesimportanteen
todos los casos y, especialmente, en los supuestos en que las personas condenadas estn realizando
programasderehabilitacindedrogodependencias,afindequepuedancontinuarenlosmismos.Paraello
hay que aportar al subdirector de tratamiento todo tipo de informes de seguimiento (psicolgicos,
teraputicos,sociales,mdicos).Sisedemoramucholaclasificacininicialhayquepresentarunescritoal
subdirectordetratamientoSisedeniegalaclasificacininicialentercergradohayquerecurriralJuezde
Vigilancia (modelo nmero 11). Es muy importante que el abogado o familiares se entrevisten con el
subdirectordetratamientooconlosmiembrosdelEquipoTcnico(modelosnmeros11y12).
Enocasiones,laadministracinpenitenciariaargumentaquedeconcederuntercergradodirecto"seprivara
alapenadelfinlegaldeprevencingeneralodeintimidacinpenal".Anteesteargumentosepuededecir
quelafinalidadpropiadelapenaprivativadelibertadeslareeducacinylareinsercinsocialdelpenado.
Lafinalidaddeintimidaralosdemsciudadanosparaquenoimitenlaconductadelictivaalpenadono
puede dirigir la prctica penitenciaria ya que podra desembocar en tratamientos excesivos y podra
anteponerselaraznpolticaalaraznlegal.Enningncasocabeidentificarlaejemplaridaddeunapena
conuna"penaejemplar"niconelcumplimiento"ejemplar"delapenaimpuesta(Auto1425/99APMadrid
seccin5de30denoviembrede1998).
LaclasificacindirectaentercergradodebecomunicarsealMinisteriofiscaldentrodelostresdashbiles
siguientesalafechaenquefueadoptado(art.107RP)

12.Qu requisitos se exigen en el Cdigo penal para poder acceder al


tercer grado?
La ley 7/2003 sobre cumplimiento ntegro de las penas ha introducido una serie de novedades en la
regulacindeltercergrado.Seexigetenerlamitaddelacondenacumplidasilapenadeprisinessuperiora
cincoaos(estetiemposedenominaperododeseguridad),habersatisfecholaresponsabilidadcivilypara
loscasosdeterrorismo,haberabandonadolasactividadesterroristas.

13.Qu es el perodo de seguridad?


Cuandoladuracindelapenaseasuperioracincoaos,laclasificacindelcondenadoeneltercergradode
tratamientopenitenciarionopodrefectuarsehastaelcumplimientodelamitaddelapenaimpuesta(art.
36.2CPintroducidoporLO7/2003).
Destrozaabsurdamenteysinfundamentorazonableelprincipiodeindividualizacincientficaqueseintenta
conseguiratravsdeltratamientopenitenciarioquepostulalaLeyOrgnicaGeneralPenitenciaria.Esta
normaysuReglamentocuentanconlossuficientesmecanismosdecontrolparaevitarquelaspersonascon
penas elevadas obtengan inicialmente el rgimen cerrado, pero no lo hacen imposible para casos
excepcionales.Entodocaso,lafasedeejecucinenelderechopenaltieneautonomapropia.Porello,enmi
opinin,elaccesoalrgimenabiertoyalalibertadcondicionaldeberahacerseenfuncindeltratamiento
individualizadolegalmente establecidoy aplicado (en las crceles en que existan medios para ello). Su
aplicacinnodeberatenerningnlmitetemporal,sinoquedeberaseraplicadoenfuncindelasvariables
queestablecelalegislacinPenitenciaria(posibilidaddehacervidaensemilibertad,factoresrelacionados
conlaactividaddelictiva,historiaindividual,laboralsocialydelictivo,personalidad,duracindelaspenas,
mediosocialalqueretorne,facilidadesydificultadesparaeltratamiento)enrelacinconelfindelapenay
deloscentrospenitenciarios,establecidosenlaConstitucinyenlalegislacinPenitenciaria.Sonestas

variablescriminolgicas,valoradasporlosequipostcnicos,yenltimoextremosupervisadasporelJuezde
Vigilancia Penitenciaria, las que deben determinar y dar seguridad de que quien sea clasificado o
progresadoatercergrado,seacapazdevivirensemilibertad,respetandolaleypenal,conindependenciade
lacondenaquetenga.

14. Existe alguna posibilidad de no aplicar el perodo de seguridad a


penas superiores a cinco aos?
S.Excepcionalmente,yaunquelapenadeprisinseasuperioracincoaos,puedenoaplicarseelperodo
deseguridadAesterespecto,elprrafosegundodelartculo36.2CPexigecomorequisitoqueelJuezde
VigilanciaPenitenciariapreviopronsticoindividualizadoyfavorabledereinsercinsocialyvalorandoen
sucaso,lascircunstanciaspersonalesdelreoylaevolucineneltratamientoreeducador,cuandonosetrate
dedelitosdeterrorismoocometidosenelsenodeorganizacionescriminales,podracordarrazonadamente,
odos el fiscal, instituciones Penitenciaria s y las dems partes, la aplicacin de rgimen general de
cumplimiento.
EstanormaposibilitaqueelJuezdeVigilanciapuedasuprimirelperododeseguridad.Paraelloesmuy
importantequeelpenadoparticipeenlasactividadesquedesdelaprisinseofrezcan,intentetenerbuen
comportamientoparanosersancionado,circunstanciasstasque,unidasalapoyofamiliaryposibilidadesde
trabajo,puedenhacerquelaevolucineneltratamientoseaconsideradooficialmentecomopositivoyqueel
pronsticoseafavorable.

15. Cules son las gestiones que el centro penitenciario realiza para no
aplicar el perodo de seguridad a pesar de que la pena sea superior a cinco
aos?
La I 9/2003de la DGIP regula el procedimiento a seguir cuando la Junta de tratamiento de un centro
penitenciarioconsiderequeunpenadoalquenoleesaplicableelperododeseguridaddeconformidad
conelart.36.2CPpornohabercumplidoanlamitaddelaspenasimpuestas,seencuentrepeseaello,en
condicionesdeaccederaltercergradodetratamiento.Enestoscasos,laJuntadetratamientopodrformular
lacorrespondientepropuestaalCentroDirectivocondicionadaalaposibilidaddequeelJuezdeVigilancia
acuerde,ensucaso,laaplicacindelrgimengeneraldecumplimiento.Enestecasoseadjuntarala
propuestauninformeespecficosobreelpronsticoindividualizadoyfavorabledereinsercinsocialdel
interno,convaloracindesuscircunstanciaspersonalesylaevolucindeltratamientoreeducador.Paraello
setendrencuenta:
Asuncinonodeldelito:reconocimientoyvaloracinporelinternodelsignificadodesuconducta
recogidaenloshechosprobadosdelasentencia.
Actitudderespetoalavctimaovctimas:compromisofirmadodearrepentimientoyasuncino
reparacindelasconsecuenciasderivadasdeldelito.
Conductaefectivallevadaacaboenlibertad,ensucaso,entrelacomisindeldelitoyelingresoen
prisin,ypruebasqueloavalen.
Participacinenprogramasespecficosdetratamientotendentesaabordarlascarenciasoproblemas
concretosquepresenteyqueguardenrelacinconlaactividaddelictiva,ascomolaevolucindemostrada
enellos.

Valoracin de los anteriores extremos por parte de la Junta de Tratamiento, con emisin del
pronsticodereinsercin.
Alarecepcindedichapropuestacondicionada,elCentroDirectivoadoptardecisinsobrelaaplicabilidad
onodeltercergradoalinterno,sometiendo,ensucaso,alaaprobacindelJuezdeVigilancialaposibilidad
deaplicaralpenadoelrgimengeneraldecumplimiento,deformapreviaalaadopcinderesolucinde
tercergrado.

Nopuedequedarlaaplicacindeltercergradoconsupresindelperododeseguridad,exclusivamente,enla
iniciativadelaadministracinPenitenciaria.LapersonapenadapuedetambinaccederalJuezdeVigilancia
paraplanterseloatravsdelosrecursoscontralaresolucindemantenimientoensegundogradoemitida
porelCentroDirectivo.Cmolasrevisionesdegradoseefectancadaseismeses,laposibilidadderecurso
esfrecuenteyenlsepudeplantearlasupresindelamitaddelacondenaaportandotodoslosdatosquese
tengan para fundamentar una evolucin en el tratamiento penitenciario y un pronstico favorable de
reinsercinsocial(vermodelonum.12).
Laresolucinjudicialtienequeserrazonada.Porellotienenquetomarseencuentatantolosdatosoficiales
aportadosdesdelasJuntasdetratamiento,comolosaportadosporelpenado.Pordosmotivos.Uno,para
contrarrestarlanaturaltendenciaopositoradelaadministracinalasmedidasdeexcarcelacinquetienensu
origenendecisionespolticasdelministeriodelinterior.Elsegundo,paracomplementarlainformacinde
losinformesoficiales,casisiempreincompletosporfaltadeprofesionalesydetiempo,estandostosms
vinculados a las tareas burocrticas que al contacto, conocimiento, eintervencin real con las personas
presas. Estos informes pueden ser sociales, laborales, psicolgicos o criminolgicos. Pueden haber sido
obtenidosporelpenadodebidoasuvinculacinconprofesionalesdeentidadesquetrabajendentrodela
crceloasociacionesdeapoyoapresosquelosconozcandesdeelexterioryquesindudapuedenaportar
unosdatosrealesdelavidapersonal,socialylaboral,ascomofacilitarlosmediosmaterialesydeapoyo
paraqueelpronsticodereinsercinsocialpuedaserpositivo.

16. Las penas superiores a cinco aos , se refiere a las penas


consideradas individualmente, o al total de la condena siempre que la suma
de la penas, aunque individualmente sean inferiores,

sea superior a cinco

aos?
Dosposiblessoluciones.LaprimeraeslaquemantienelaDireccinGeneraldeInstitucionesPenitenciarias
enlaInstruccin9/2003sobre"Indicacionesparalaadecuacin delprocedimientodeactuacindelas
JuntasdeTratamientoalasmodificacionesnormativasintroducidasporlaLeyOrgnica7/2003,de30de
junio,demedidasdereformaparaelcumplimientontegroyefectivodelaspenas".Establececomopenas
susceptiblesdesersometidasalperododeseguridad"lassuperioresacincoaosovariasquesumadas
aritmticamenteorefundidasexcedandeestaduracin,conindependenciadequestasvenganimpuestasen
unaovariascausasoprocedimientos;paraellotodaslaspropuestasdeclasificacininicialoprogresina
tercergradoindicarnexpresamenteeltotaldelacondenaimpuestaenlacausaocausaspenadasquese
encuentrecumpliendo,ascomolafechadecumplimientodelamitaddeellas".
Lasegundainterpretacin,amiparecermscorrectaporsermsacordeconelprincipiodelegalidadpenal,
es la contraria. El art. 36.2 CP establece el trmino "pena", la cual deber entenderse como entidad
individual,proporcionalalinjustopenalcometidoycomoreaccinestatalalmismo.Nopuedeextenderse
estemecanismolegalrestrictivodelvalorsuperiordelalibertadasupuestosnocontempladosenlanorma
penal, o, si se quiere, que supongan una interpretacin extensiva del trmino pena, otorgndola un
contenidogenricodeacumulacindepenasinferioresacincoaos.Siellegisladorhubierabuscadola
primera opcin lo hubiera expresado textualmente de idntica forma a como lo hace la I 9/2003. La
interpretacincontrariavulneraelprincipiodelegalidadpenalyunaInstruccindeunrganoadministrativo
nopuedecrearnidesarrollarcontenidospunitivos.Deformaquesiunapersonaestcondenadaacinco
penasdecuatroaos,noesaplicableelperododeseguridad,puesesdistintola"pena"cuatroaosquela
condena,queenestecasoseradeveinteaos.Comoelartculo36.2habladepenas,yladelejemploesde
cuatroaos,podraaplicarseelrgimengeneraldecumplimiento.Siunapersonaestcondenadaatrespenas
deprisindetresaosyunadeseis,podraconsideraseelperododeseguridaddetresaosparalaprimera
delaspenasquetienequecumplirseporsermsgrave,peronohabraqueesperaralamitaddeltotal,es
decirdelasumadetodas:15aos,alnoserstaslastresdetresaossuperioresacincoaos.

17. Qu debe entenderse por las partes a las que el Juez de Vigilancia

Penitenciaria debe or para aplicar la exclusin del perodo de seguridad?


El Juez de Vigilancia para aplicar la exclusin del perodo de seguridad, adems de que concurra la
evolucindeltratamientoyelpronsticofavorabledereinsercinsocial,debeoralfiscal,ainstituciones
Penitenciariasyalasdemspartes.Ningunadudasepresentaconlasdosprimerasinstituciones,puesal
fiscal siempre hay que darle Audiencia y la institucin Penitenciaria ya ha mostrado su parecer en el
informe.Loquenoresultararazonableporlaprdidadetiempo,queunavezcompletadoelexpedientecon
todos los informes se diese nuevamente traslado a la administracin Penitenciaria para su opinin al
respecto,cuando,repito,yahasidooda.
Elproblemaquesepuedeplanteareslainterpretacindeltrminopartes.Lamsadecuada,enprincipio
esvincularlaalasprocesales:acusacinydefensa.Deellosederivalaexigenciadequelavctimaest
representadaporunaacusacinparticular,puesdelocontrario,seraelfiscalquientieneobligacinlegalde
informar,elquecumpliracontalmisin.Detodasformas,enlafasedeejecucin,esmuycuestionablela
participacindelavctima,posiblementemsmovidaporsentimientosnaturalesdevenganzafomentados
porlainsatisfaccinquesuelegenerarelpropiosistemapenalensusfasesdeinstruccinyenjuiciamiento.
Enlafasedeejecucinelintersprincipalquedeberegireslaintervencinreeducadoradelpenado.De
maneraquesolamenteserapositivalaintervencindelavctimapararealizartrabajosdemediacinque
tendiesenalaresponsabilizacindelaconductadelpenado,oparaaportarinformacinnecesariaparasu
seguridad personal en la medida en que el Juez de Vigilancia pueda adoptar alguna regla de conducta
determinada si optase por aplicar el tercer grado o la libertad condicional. De manera que la simple
oposicindelaparteacusadorapormotivosvindicativosnopuedesertenidaencuenta.
Laotraparte,ladefensa,obviamentedebeseroda.Enprincipioaquienhabraqueescucharesalpenado
directamente,salvoqueexpresamenteremitieseaunletradodefensorconcreto.Decimosestoparaevitarla
indefensin que se puede generar si el expediente se pasa al letrado que intervino en el juicio y que
posiblementehayaperdidotodocontactoconsudefendido.Laexigencialegalesobvia.Elpenadodebeser
escuchado y debe tener la posibilidad de aportar todas las pruebas (informes) que avalen el pronstico
favorabledereinsercinsocial.Como,previsiblemente,lasupresindelperododeseguridadsesolicitar
porelpenadoenvaderecursoantelaresolucinadministrativademantenimientoensegundogrado,no
parecerazonablequeademsdeeserecurso,selevolvieseadartrasladounavezqueestcompletoel
expedienteparaserodo.Siyahasidoodo,cualquieractividadprocesaltendenteaduplicarlosactosdetal
carctersupondranunnuevoretrasotemporalenladecisinjudicial.Ysinohasidoescuchadoporqueno
hayatenidolaoportunidaddepresentaralegaciones,debedrseletraslado.Ahorabien,elnicomotivoque
fundamentaraladuplicidaddeactosprocesalesparaqueelpenadoseadoblementeodo,seraquepudiera
teneraccesoalasalegacionesrealizadasporlaadministracinPenitenciaria,porelministeriofiscalyporla
acusacinsilahubieraafindepodercontradecirlosargumentosexpuestosporellos.Vendraaserlaltima
palabradeljuiciooralafindesalvaguardarplenamenteelderechoaladefensa.Desdeestaopcin,podra
tenervalorjurdicoqueelpenadofueseelltimoenserodo,conindependenciadequehubieseintervenido
previamenteconlapresentacindeunrecurso.

18. Qu ocurre si al penado estando ya clasificado en tercer grado, le


apareciese una nueva causa, cuyo cmputo temporal fuese superior a cinco
aos?
Vadependerloqueseentiendaporeltrminopena:obiensuconsideracincomoentidadautnoma,o
biencomosumadevariascondenasqueseestncumpliendoaunqueseaninferioresacincoaos,sisusuma
superatallmite.Desdelaprimerainterpretacinqueesporlaqueyoopto:
Silanuevapenafuesesuperioracincoaosylapersonaseencontraseentercergrado,elcentro
penitenciariodereferenciaenelqueestcumpliendoelrgimenabiertodebera,enlasiguienterevisinde
laclasificacinysielcomportamientofuesebuenoycontinuaseconlaactividadlaboralodetratamiento
concreta(evolucinpositivadeltratamientoypronsticofavorabledereinsercinsocial),plantearanteel
centrodirectivoelmantenimientoentercergrado.Encasocontrarioregresinasegundogradoporla
aparicindelanuevacausa,elpenadodeberainterponerrecursoalJuezdeVigilanciaPenitenciariapara

queseaplicaselasupresindelperododeseguridadart.36.2CP,aportandolosinformesdeseguimiento
sobresusituacinsocialylaboralcontratodetrabajo,nmicas,informesdeconductadelaempresaetc.
(modelo12.a)
Silanuevapenanofuesesuperioracincoaosyalsumarseconlasqueestuviesecumpliendo
superasenestelmite,nohabraningnproblemalegal.Lapersonapodraseguirentercergrado.
Desdelasegundainterpretacinenlaqueeltrminopenaseentiendecomolasumadetodaslascondenas,y
queeslainterpretacin,amiparecerilegal,seguidaporlaadministracinPenitenciaria,habraqueseguirlo
establecido en la I 9/2003: Cuando a un interno clasificado en tercer grado le llegue una nueva
responsabilidadpenada,producindoseaslasituacindequepasaanotenercumplidalamitaddetodaslas
condenas,laJuntadeTratamientoprocederarevisarsuclasificacinconelfinderealizarunavaloracin
actualizadadetodaslasvariablesdelinterno.EnelcasodequeelJuezdeVigilancianohubieraefectuado
conanterioridadpronunciamientosobrelaaplicacindelrgimengeneraldecumplimiento,dicharevisinde
clasificacinseremitirdeformapreceptivaalCentroDirectivo,consusinformescomplementarios.
Ahorabien,entiendoqueelCentroDirectivonopodraregresardegradoalpenadoporconcurrirnicamente
talcircunstancia(penaqueexcedadecincoaos)sinremitirelexpedientealJuezdeVigilanciaparaque
resolviesesobrelaposibleaplicacindelrgimengeneralart.36.2CP.Mantenerunaposicincontraria
llevaraalaregresinasegundogradoylanecesidaddequeelpenadointerpusierarecursodirectamente
ante Juez de Vigilancia para que realizase una nueva clasificacin de progresin a tercer grado con
aplicacindelrgimengeneral.Estecaminoprocesal,ansiendoformalmentemscorrecto,generaraunas
graves consecuencias sobre la persona penada: ingreso en rgimen ordinario y sus consecuencias:
desvinculacinfamiliar,vueltaaunaanormalydesestructuranteadaptacinalsistemapenitenciario,adems
delaprdidadeempleo.ConsecuenciasquesepuedenevitarsisediesetrasladodelexpedientealJuezde
Vigilanciaantesdelaregresindegradoparaquesemanifiestesobrelaposibleaplicacindelrgimen
generalexcluyendolaaplicacindelperododeseguridad.

19. El perodo de seguridad se aplica a las personas que estn cumpliendo


condenas en el momento en que entr en vigor?
Lamentablementes.LamayoradelosJuzgadosdeVigilanciaypartedeladoctrinaafirmanqueestaley
tieneefectosretroactivos.Peronotienenrazn.Noquieroserpresuntuoso,peroeslanicamateriadeeste
libroenlaquepuedoafirmarconrotundidadqueestaleynoesretroactivaysolamentepuedeaplicarsealas
personasquedelincanapartirdelda2dejuliode2003.Loafirmoporlossiguientesmotivos:

1.Elart.2.3Ccestableceelprincipiogeneraldelairretroactividaddelasnormasjurdicas,perodeja
abiertalaposibilidaddequelapropialeydispongasueficaciaretroactiva.Enestesentido,laDisposicin
Transitorianica(LO7/2003)establecelaretroactividadlosartculos90y93.2CPy72.5y72.6LOGP.No
obstante,desdeunpuntodevistapolticocriminal,comolasleyespenalescontienennormasdeconducta
destinadasaregularlaconvivenciasocialdefuturo,elprincipiogeneraldebeserquelaleypenaldespliegue
susefectosapartirdesuentradaenvigor.EllounidoalaparticularsensibilidaddelDerechopenalhaciala
certeza y seguridad jurdicas (art. 9.3 CE) determina que en este mbito del ordenamiento jurdico el
principiodeirretroactividaddeberegirconespecialescrupulosidad,sobretodoteniendoencuentaqueel
mismoart.9.3C.E.sealalairretroactividaddetodotipodenormas,auncuandonoseanmaterialmente
sancionadoras ni penales, en cuanto constituyanrestriccin de derechos individuales (Cf. Ms
genricamenteart.49CartadelosDerechosFundamentalesdelaUninEuropea).Laexcepcinquedeja
abiertaelCdigocivildebequedarvedadacuandosetratedefundamentaroagravarlaresponsabilidad
penal,biencondelitosopenasnuevas,bienconlacreacindesituacionesjurdicasqueimponganformasde
cumplimiento mas penosas que supongan una restriccin de un bien jurdico protegido
constitucionalmente:lalibertad.Elperododeseguridadsellame,comosellame,suponelacreacindeuna
nueva pena no prevista legalmente que prolonga en el tiempo la extensin de permanencia en rgimen
ordinario.
Desde el punto de vista de la prevencin general del derecho penal, el perodo de seguridad debe ser
irretroactivo.Suaplicacinaquienesseencuentrancumpliendocondenaenelmomentodesuentradaen
vigoresineficazparaprevenirdelitospuesdespliegasusefectossobrehechosdepasado.
Porotrolado,deconsiderarseretroactivoelperododeseguridadlaseguridadjurdicaensuvertientedel

conocimientodecertezadelassituacionesjurdicasydeldesplieguedeconsecuenciaspunitivasparalos
ciudadanos, quedara, groseramente vulnerada. Los ciudadanos que en la actualidad se encuentren
cumpliendounapenadeprisinporconductasconcretassesometieron,desdesuinicio,aunasreglasde
juego:conductatipificadaenelCdigopenal,consecuenciajurdicaenformadepenadeprisinyla
expectativa de salida en aplicacin de un programa de tratamiento individualizado, sin lmite temporal
algunoparaelaccesoalrgimendesemilibertad.Lavariacindecualquieradeestasposibilidadesatenta
directamentealaseguridadjurdicaynogeneraningunaexpectativapositivademejorregulacindela
convivencia social. No se olvide que el legislador se dirige al Juez para que aplique el derecho con
certidumbre (funcin primaria de la norma), como a la poblacin en general (funcin secundaria de la
norma)paraqueconozcannosloeldesvalorjurdicodelaaccinsinolaseventualesconsecuenciasdesu
comportamiento,tantoenloqueserefierealquantumdecondena,comoalascondicionesdeejecucindela
misma.
Portanto,laspenasqueseestncumpliendocuandoentrenvigorlaLO7/2003yquesonconsecuenciade
lacomisindedelitoscometidosbajounaspremisaslegalesdedescripcindeconductasdelictivas,una
consecuenciasjurdicas,ascomocondicionesyformasdeejecucinconcretasydeterminadasencuanto
stasafectandirectamentealalibertadcomoderechofundamental(art.17CE)o,cuantomenos,comovalor
superiordelordenamientojurdico(art.1CE)haceninaplicableretroactivamenteelperododeseguridad.
2.LaDisposicinTransitorianicaestablecelaretroactividaddelosart.90y93.2CPparaaccedera
la libertad condicional y 72.5 y 72.6 respecto de la clasificacin o acceso al tercer grado. Esta norma
concretasucontenido:expresaestoynadams;noesposiblequelosaplicadoresdelaleyylosoperadores
jurdicosqueintervienenenlafasedeejecucinpenalhaganunainterpretacinextensivadelanorma,
singularmenteencuandosupondraunaquiebradelclsicoprincipiojuridicoFavorabiliaamplianda,sed
odiosarestringenda.LaDTnicanohaceningunamencinexpresaalart.36.2queregulaelperodode
seguridad;porellodebeserexcluidalaposibilidaddelaretroactividad.
EnestamismalneaargumentalydesdeunainterpretacinsistemticadeestaDisposicinTransitoria,hay
quetenerencuentaquetampocoincluyeelart.93.3CP(prdidadeltiempopasadoenlibertadcondicional
para el caso de quebrantamiento del art 90.2, precepto ste que s tiene carcter retroactivo segn esta
Disposicin);ynoloincluyeporalgoobvio:esabsolutamenteirretroactivoporelperjuicioquesuponepara
elreoporafeccindirectaalbienjurdicolibertad(comoderechofundamentalelart.17CEocomovalor
superiordelordenamientojurdicodelart.1CE),alaseguridadjurdica yalcarcterpreventivoquese
otorgaalanormapenalcomofundamentosdelairretroactividad.Dichodeotromodo,losciudadanostienen
que saber ante una determinada conducta, si es delictiva o no, y si lo fuere, qu consecuencia jurdica
conlleva(penaomedidadeseguridad),ycmosevaaejecutarsta(garantadeejecucinenelprincipiode
legalidad). Naturalmente, el ciudadano puede desconocer ciertas normas de tipo interno y cuasi
administrativo:tramitacindelasquejas,delosrecursos,delasformasderegistroencelda,delasnormasde
laobservacin,delafasedeperodo,inclusodelasformasdelaprcticadeloscacheosetc...),puesstas
normas pueden no afectar directamente ni a la libertad, ni a la seguridad jurdica (aunque se ven
comprometidas), ni a la futura prevencin de delitos y por tanto pueden variarse y desplegar efectos
retroactivos.Peroesclaroqueelciudadanotienequeconocer,enelcasodelart93.3CP,quesicometeun
delitoyescondenadoporello,yseencuentraenfasedelibertadcondicional,quesilaquebrantaselerevoca
yademspierdeeltiempodecondenacumplidaenestergimen.Loquesetraduceenunaprdidade
libertadmayor.Ysaberloesimportanteparalaprevencindequebrantamientodelapenaenfasedelibertad
condicional, y por seguridad jurdica. Por ello, creo que es pacfica la argumentacin respecto de la
irretroactividaddelart.93.3CP
Losmismosargumentosparafundamentarlairretroactividadcabrainferirdel36.2CP;primero,porqueno
vieneexpresamenteestablecidoenalDTnicaaligualqueelart.93.3CP.Ensegundolugar,porquelos
bienes jurdicos, valores, funciones y derechos que se pueden ver afectados por la retroactividad son
exactamentelosmismosquelosdelart.93.3CP:lalibertad,lafuncinpreventivadelanormaylaseguridad
jurdica, queexigenqueelciudadanoconozca,noslolasconductasconsideradascomodelictivas,sino
tambinlaconsecuenciajurdicaysuformadecumplimiento,noencuantoalasnormasadjetivas,sinoen
cuantoasucontenidosustantivo:lalibertad.Conello,noesdifcilprobar,yahseresidenciaexplcitamente
la intencinde la reforma aprobada ysuhipottica eficacia en este orden que no es lo mismo queun
ciudadano,cuandocometaundelito,tengalacertezadequenovaasalirdeprisinhastaquellevelamitad

delacondenacumplida,quelopuedahacerencualquiermomento,inclusounasemanadespusdeingresar.
Imaginemosquelareformapenalhubieraestablecidoensusdisposicionesquelaspenassuperioresacinco
aossedeberancumplirntegramenteenprisin,sinposibilidaddeaccesoalrgimenabiertoyqueadems
ycumplimientodeberahacerseenrgimendeaislamiento,noseriaconsideradoabiertamenteunfraudede
etiquetassiseleotorgaseelcarcterderetroactivo?,Quinseatreveraadecirqueesanormaesretroactiva
yapartirdelaentradaenvigortodoslosqueactualmentecumplenpenassuperioresacincoaostendran
queseringresadasenelaislamiento?;creoquenadie.Aesterespecto,elperododeseguridadqueintroduce
laLO7/2003yelsupuestoficticioqueacabamosdereferir,partendeidnticaafeccinalosmismosbienes
jurdicos:lalibertad,laseguridadjurdicayelmandatopreventivodelanormapenal.
Por tanto, si la aplicacin del art. 93.3 CP es irretroactiva, y tambin lo es el supuesto hipottico que
anteriormentehemosrelatado,necesariamentetienequeserlotambinelart.36.2CP.Demaneraquenada
msquesepuedeaplicaraquienescometanhechosdelictivosapartirdelaentradaenvigordelaLO7/2003,
puesel36.2novieneexpresamenteestablecidoenlaDTUnica..

3.Elart.9.3delaConstitucinestablecelairretroactividaddelasdisposicionessancionadorasno
favorablesorestrictivasderechos.Nosepuedeescaparacualquierrazonamientolgicoycoherenteconuna
visinsistemticadetodoelordenamientojurdicopenalqueencontrarsecumpliendounapenadeprisin
respectodelaquepuedesalirenlibertadenuntiempoprudencialyqueestaposibilidad/expectativabasada
enlaseguridadjurdicaquegeneralalegalidadconcreta,seadeimposiblecumplimientoporlaaplicacin
retroactivadelperododeseguridad,generaunperjuicio,restringeunderecholibertadovalorsuperiordel
ordenamientojurdicoysuponeunasancinnofavorabledesdeelpuntodevistadelaconsecuenciaque
despliega.
ElinformedelCGPJentiendequesetratadeunaretroactividadimpropia,porquedespliegaefectoshacia
futurorespectodesituacionesjurdicasannoconsolidadas.Aesterespectocabeargumentarquesinduda
despliegaefectoshaciafuturopueslaspersonasestncumpliendocondena,perolaimposibilidaddeacceder
al rgimen abierto en un tiempo delimitado que al comenzar el cumplimiento y el tratamiento
individualizadonoexista,suponeunclaroygraveperjuicio,encuyabaseestelvalorsuperiordelalibertad
art. 1 CE. La presencia de la proteccin constitucional de este valor o derecho hace su aplicacin
irretroactiva.Porotrolado,conelrespetoobvioquemerecetodainterpretacinconstitucional,introduciruna
clase nueva de irretroactividad, ms all de la autntica, supone la creacin de un nuevo gnero de
irretroactividad,dedudosajustificacin,siloqueestenjuegoeslalibertadysuperjuicio,derechosy
valores protegidos constitucionalmente. De idntica forma y para hacer una interpretacin global del
ordenamiento penal, el Tribunal Constitucional establece que no caben situaciones intermedias entre la
detencinylalibertad,anulandocualquierefectoaunatercerafiguracreadaporlapolica:retencin
policial;oseestdetenidoyportantoseaplicantodoslosderechosdelart.520L.E.Cr.oseestlibre.
Similarargumentacincabrasealarpareltemaquenosocupa:siestenjuegolalibertad,laseguridad
jurdicaylafuncinpreventivadelderechopenal,unanormaoesretroactivaonoloesenfuncindel
perjuicioquecausaalreo;deningunamanerasepuedencrearnuevasfigurasparajustificarloinjustificable
desdeelpuntodevistaconstitucional.
4. En una interpretacin gramatical de la Disposicin Transitoria nica no se puede inferir la
aplicacin retroactiva del perodo de seguridad. La nica duda es si se puede aducir la retroactividad
partiendodelart.72.5CPcuandoestablece:Laclasificacinoprogresinaltercergradodetratamiento,
requerir, adems de los requisitos previstos en el Cdigo penal, que el penado haya satisfecho la
responsabilidadcivilderivadadeldelito....puedesuponerestareferenciaarequisitosprevistosenel
Cdigopenallaintroduccindelart36.2CPenlaD.Tnica?.Enmiopinin,deningunamanera.La
retroactividaddelasnormasquerestringenderechostienerangoconstitucional(art.9.3y25CE),afectaa
valoressuperioresdelordenamientojurdico:lalibertad,laseguridadjurdicayhastalafuncinpreventiva
delanormapenal.Estosvaloresafectadosgozandetantaimportancia/proteccinenelordenamientojurdico
penal quenopuedenserhurtadosniporunlegisladorquepordudosascuestionesdepolticacriminal
intentacrearconfusinjurdica,niporunanormadereferenciaoremisinaunartculodelcdigopenal.
Conbaseaunainterpretacinunitariadelordenamientojurdicoenelqueestnafectadoslalibertadyla
seguridadjurdica,hemosdehacerreferenciaexplicitaalaimportanciaygarantaquesedespliegaenla
proteccindeesosvaloresporlasresolucionesdelTribunalConstitucionalenotros mbitospenales:la
motivacindelasresolucionesylaprisinpreventiva:
a. Existensupuestos enlos que se exige un especfico y reforzado deber de motivacin de las

resoluciones judiciales, entre las que cabe citar aquellos en que se ven afectados otros derechos
fundamentales o libertades pblicas o en que se incide de alguna manera sobre la libertad como valor
superiordelordenamientojurdico(STC116/1998,2.6FJ4).
b.Encuantoalaexcepcionalidaddelaprisinpreventiva:porellolainterpretacinyaplicacinde
lasnormasreguladorasdelaprisinprovisionaldebenhacerseconcarcterrestrictivoyafavordelderecho
fundamentalalalibertadquetalesnormasrestringen.Porello,encasodeduda,hayqueoptarporlaLeyms
favorableosea,lamenosrestrictiva(STC88/1988,de9demayo).Ylasresolucionesdebenvenirapoyadas
enrazonesquepermitanconocercualeshansidoloscriteriosjurdicosesencialesfundamentadoresdela
decisin,culhasidosuratiodecidiendo(214/2000FJ.4).
Estasdosreseasnossirvenparaexplicitarlaespecialsimaproteccinqueelordenamientopenal
otorgaalalibertadyalaseguridadjurdica,yquenosllevaaconcluirquenopuedenverseafectadaspor
aplicacinretroactivadeleyespenales(art.72.5LOGP)porunaremisingenricaaunartculodelCdigo
penal(36.2CP).Laespecialproteccinhubieserequeridounaremisinexpresa,claraymotivadaenla
exposicindemotivosalart.36.2CP,talycomosehahechoconel90y93.2CP.Enelordenamientopenal
nocabeninterpretacionesextensivasdelasnormasencuantoaperjudiquenalreo,yestnafectadoslos
valoressuperioresdelalibertadydelaseguridadjurdica.
5.Enotroordendeargumentos,laexpresinademsdelosrequisitosprevistosenelCdigopenal,
esmsunaaclaracinnecesariadelapropiaredaccindelart..72.5CP.Siseomitelasexpresionesobjetode
debate,laredaccindelaDTnicaquedaradelasiguienteforma:laclasificacinoprogresinaltercer
grado de tratamiento requerir () que el penado haya satisfecho la responsabilidad civil derivada del
delito....Nteseporellector,quesisesuprimelaexpresinobjetodeanlisis,laformulacinlegales
errnea,porquelaclasificacinentercergradorequiereelpagodelaresponsabilidadcivil,peronoslo.Por
tanto,paracompletarladefinicinlegaltienequeintroduciralgotanobviocomonecesario:ademsdel
requisitoexigidoenelcdigopenal.Porello,estaexpresinnoquiereintroducirelperododeseguridada
efectosderetroactividad,loquequiereescompletarladefinicinlegaldelosrequisitosdeaccesoaltercer
grado, pues no hay otra posibilidad de formulacin normativa completa. Pero el nico elemento que
introducerealmenteelart.72.5LOGPessloynicamentelasatisfaccindelaresponsabilidadcivilelpago
delaresponsabilidadcivil.
6. EnlaExposicindeMotivosdelaLO7/2003,queesexpresindelavoluntadyrazonesdela
reforma,delimitaclaramentelosdelitosalosquevadirigida:lasociedaddemandaunaproteccinms
eficazfrentealasformasdedelincuenciamsgraves,enconcreto,losdelitosdeterrorismo,losprocedentes
delcrimenorganizadoylosquerevistenunaespecialpeligrosidad.Contextualizadalareformaenestos
delitos, no cabe, en principio, extender la aplicacin retroactiva a otros delitos castigados con penas
superioresacincoaos,quenoseanlosexpresamentedefinidosenesaexposicindemotivos.
7. El informe del Consejo General del Poder Judicial informa en sentido favorable a aplicar la
retroactividaddelperododeseguridadargumentandoqueelprincipiodelegalidadenlafasedeejecucinno
exigelapromulgacindeleyesanteriorescomoseestableceparaelprincipiodegarantacriminalypenalde
losart.1y2CP.Peroellegisladorpenal,cuandoestableceenelart.3...nopodrejecutarsepenanimedida
deseguridadsinoenvirtuddesentenciafirmedictadaporelJuezotribunalcompetente,deacuerdoconleyes
procesales, no hace referencia a las leyes promulgadas con anterioridad por cuestin meramente
legal/prctica, pensando en las modificaciones de procedimiento de ejecucin que lgicamente deben
aplicarseporigualatodoslosqueestncumpliendocondena.Recordemosqueenmateriaprocesalrigeel
principiotempusregitactum,esdecir,lasleyesprocesaleshandeaplicarsealosactosprocesalesquese
desarrollenoefectanapartirdelaentradaenvigordelanuevaley,conindependenciadelaleyprocesal
vigenteenelmomentodelacomisindeldelito.Esportodoello,porloqueellegisladorpenalensuart.3,
nopuedehablardeleyesprocesalesanterioresalaperpetracindedelito,peronoporqueexistaunaautntica
fasedeejecucinpenal,distintaalasfasesdeinstruccinyenjuiciamiento,enlaquelaretroactividades
posible.
Aesterespecto,ladoctrinadiscutesilareglatempusregitactumtienequeregirconcarcterabsolutopara
todaslasleyesprocesales;suaplicacinnoofrecedudasconrelacinalasleyesprocesalespropiamente
dichas, es decir aquellas que se refieren al mero desarrollo formal del proceso y competencia de los
tribunales.Peroexistenotrasleyesprocesalesque,alexigirdeterminadospresupuestosparalapersecuciny
castigodeloshechos,determinantambinefectosmaterialesdecisivos,porlosquecabeplantearlacuestin
desialasmismaslesseraplicablelaprohibicinderetroactividadconreferenciaalareglatempusdelicti

comissi(tiempodecomisindeldelito)ynoalareglatempusregitactum.Entreestasleyesprocesales
penalesseincluyenporladoctrinalasrelativasalindulto,alaquerellaodenuncia,laprescripcin;ynocabe
dudaquesepuedeincorporaraesteelencolasleyesdeejecucinquetienenqueverconlaimposicinde
lmitestemporalesqueafectanalalibertad,talycomoestableceelperododeseguridaddelart.36.2CP
Ellegisladorpenal,cuandoredactaelart.3CP,estpensandoenlasnormasdeproceso,perodeninguna
manera en normas de ejecucin que, por su ubicacin en el Cdigo penal (art. 36.2 CP), dejan de ser
procesalesparatenerelcontenidosustantivodequamtumdepena;deahquesuubicacinsistemticase
encuentraenelart.36.2delcdigopenalenelqueseestablecelaextensindelapenadeprisin.Porello,la
normadel36.2noesdeejecucinstrictusensu,sinosustantivaencuantofijacantidaddepenaacumpliren
rgimenordinario,dichodeotraforma,cantidaddepenaquenopermitesalirensemilibertad,estandopor
tantoafectadoestevalorsuperiordelordenamientojurdicoyportantosiendoaplicablelosart.25y9.3dela
Constitucin.

20. Qu se exige en la ley para satisfacer la responsabilidad civil?.


Paratodosloscondenados,conindependenciadequelapenadeprisinseasuperioroinferioracincoaos,
seexige,parateneraccesoaltercergrado(art.72.5LOGPmodificadoporLO7/2003),lasatisfaccindela
responsabilidadcivil.
Aestosefectosdesatisfaccinseestablecelaexigenciade:
1.Pagoefectivodelaresponsabilidadcivil.
2.Una conducta efectivamente observada en orden a restituir lo sustrado, reparar el dao e
indemnizarlosperjuiciomaterialesymorales.
3.Lascondicionespersonalesypatrimonialesdelculpable,aefectosdevalorarsucapacidadreal
presenteyfuturaparasatisfacerlaresponsabilidadcivilquelecorrespondiera.
4Lasgarantasquepermitanasegurarlasatisfaccinfutura.
5Laestimacindelenriquecimientoqueelculpablehubieraobtenidoporlacomisindeldelitoy
ensucaso,eldaooentorpecimientoproducidoalserviciopblico,ascomolanaturalezadelosdaosy
perjuicioscausadosporeldelito,elnmerodeperjudicadosysucondicin.
Delalecturadelprimerapartado,enprincipio,parecieraquesolamentepuedeaccederaltercergradoyala
libertadcondicionalquientengadineroparapagarlaresponsabilidadcivil,todavezqueseestablececon
rotundidadqueelpenadohayasatisfecholaresponsabilidadcivil.Yquinnotengabienes?,essuficiente
consaberqueenunfuturolospodrtener?...enmiopininessuficienteconladeclaracindeinsolvenciaal
igualqueseestableceenotrasinstitucionespenalescomolasuspensindelaejecucindelacondenadelart.
81.3CP,despusdeoralosinteresadosoalMinisterioFiscal,declarelaimposibilidadtotaloparcial
de que el condenado haga frente a las mismas, o del art. 136.2 1 CP. para la cancelacin de los
antecedentes: tener satisfechas las responsabilidades civiles provenientes de la infraccin, excepto en
supuestosdeinsolvenciadeclaradaporelJuezoTribunalsentenciador.Porello,nosepuededenegarla
clasificacinenrgimenabierto/libertadcondicional,aunapersonaporcarecerdedineroparasatisfacerla
responsabilidadcivil,puesesincompatibleconlaideamismayelconceptolegaldereinsercinsocialyde
tratamiento.Delocontrariohabraqueafirmarquesolamentepuedeserobjetodetratamientopenitenciario
entercergradoolibertadcondicionalaqulquetengabienesparapagarlaresponsabilidadcivil.Sedebera
valorarelesfuerzoporreparareldaocausadoysutendenciaparaadecuarsuconductaalrespetodela
normayalavctimadeldelito.EnestesentidosemanifiestaelInformedelCGPJsobreelanteproyecto
sealandoquelaconcesindelalibertadcondicionalydeltercergradonosepuedencondicionaralpago
delaindemnizacin,todavezquelavadeapremiodelaquedisponenlostribunalesconstituyensuficiente
garantaparalareparacindeldao.Porello,loquedebeexigirseesunacolaboracinactivadelpenadoen
esareparacinynounameramenteinactivacomosujetopasivodeinvestigacinpatrimonial.
ElprocedimientoaseguirporloscentrospenitenciariosenestamateriaestreguladoenlaI9/2003dela
DGIP.ElcentropenitenciariotienequeconfirmardelTribunalsentenciadorsielcondenadohapagadola
responsabilidadcivilosiseexistedeclaracindeinsolvenciadelpenadoenlasentenciacondenatoria.Con
una u otra es suficiente. Para ello, desde las crceles se tiene que solicitar del Juzgado o Tribunal
Sentenciador el informe correspondiente o una copia de la pieza de responsabilidad civil. Estos
procedimientosseestndilatandotemporalmenteenexceso.Existenpersonasconpropuestasdetercergrado

anterioresal2dejuliode2003ycomoelCentroDirectivoannosehabapronunciadosobreellas,han
paralizadolaresolucinfinaldeclasificacinparalatramitacindelaexigenciadelcumplimientodeeste
requisito.
Entodoslosdemsapartados2,3,4y5lasatisfaccindelaresponsabilidadcivilsebasaencriterios
ampliosquenecesitanserobjetodevaloracinporelJuezdeVigilanciaPenitenciariaconcarcterprevioa
ladecisinadministrativadeclasificacindelpenadoentercergrado.Paralatramitacin,laI9/2003DGIP
establecequeentodaslaspropuestasdetercergradoseadjuntarcopiadelfallodelassentenciasquese
encuentrecumpliendoelpenado.Enelcasodequeenalgunadeellasvengaimpuestalaresponsabilidad
civil, se recabar del Tribunal sentenciador la pieza de responsabilidad civil o informe que acredite la
satisfaccinonodelamisma.Estaactuacindeberllevarseacaboconlaantelacinsuficientequepermita
disponerdeestadocumentacinalahoradeconsideralaposibleclasificacinentercergradodelinterno.Si
el penado no ha satisfecho an la responsabilidad civil impuesta o ha sido declarado insolvente en la
sentencia,laJuntadeTratamientovalorarlaactitudycomportamientoefectivosdelinternotendentesa
resarcireldaoocasionadoporeldelito,debiendoelaborarinforme,deformaprevia,sobresielpenadose
encuentraendisposicindehacerloylascondicionesqueaceptaparaqueelloselleveacaboenunfuturo,
duranteelcumplimientodelacondena.Esteinformerelativoalosaspectosdelcomportamientopostdelictual
delinternoseremitir,antesdeformularpropuestadetercergrado,alJuezdeVigilancia,solicitandoel
pronunciamiento de dicho rgano judicial sobre si, a la vista del mismo, resulta satisfactorio el
comportamientoydisposicindelpenadoparahacerfrenteasuresponsabilidadcivil,deformaqueposibilite
unapropuestadetercergrado,deconformidadconelart.72.5delaLOGP,quedandoaloquedispongaeste
rganojudicial.Dichopronunciamientodeberadjuntarse,ensumomento,alapropuestadetercergrado.
Es cuestionable que sea una Instruccin la que establezca un procedimiento en el que se involucre
directamentealosrganosjurisdiccionales,envezdeserlaesperadaleydeprocedimientoantelosJuzgados
deVigilanciaPenitenciaria,laquelodesarrolle.Nopareceadecuadoelpasointermediodelavaloracinpor
parte del Juez de Vigilancia de la idoneidad de la promesa o actitud de reparacin del penado. Causa
dilacionestemporalesqueperjudicanalpenado.EsavaloracindeberahacersedirectamenteporlasJuntas
de tratamiento y una vez aprobado o denegada la clasificacin en tercer grado, es cuando el Juez de
Vigilancia podra intervenir sealando la idoneidad, en sentido positivo o negativo, de las promesas o
garantasdesatisfaccindelaresponsabilidadcivil.Enestemomentoescuandotienequevalorarsila
promesaoladisposicindelpenadodesatisfacerlaresponsabilidadcivilesadecuadaono,peronuncaantes
comopasointermedio.Amiparecerpodrasersuficientelareparacinsimblicaconsistenteenescribiruna
cartadearrepentimientoalavctimaatravsdelJuzgadootribunalsentenciadorolaconsignacindeuna
partedeldineroquesepudieraobtenerportrabajosrealizadosdentrodelcentropenitenciario,olapromesa
defuturodesatisfacerlaresponsabilidadcivilaportandodelfuturotrabajo,unacantidaddedinero3.Entodo
caso,paralassituacionesdeinsolvenciaserapositivolacreacindeprogramasdecompensacincondinero
pblicocuyofundamentoseencontraseenlaideadesolidaridad social hacialavctimainocente yla
necesidaddequeelEstadoasumieseunoscostesoriginadosensupropiofracasodelaprevencindeldelito.
Aadelanuevanormativapenalquesingularmenteseaplicarestanorma,cuandosetratededelitoscontra
el patrimonio y contra el orden socioeconmico que hubieran revestido notoria gravedad y hubieran
perjudicadoaunageneralidaddepersonas;delitoscontralosderechosdelostrabajadores;contralahacienda
pblicaycontralaseguridadsocial,contralaadministracinPblicacomprendidosenloscaptulosValIX
delTtuloXIXdel libroIIdel Cdigopenal.El trmino singularmentepuedeinterpretarse como la
necesidaddequeelJueztengaunamayorexigenciaenlavaloracindelosavalesopromesasdepagofuturo.
Enestoscasos,segnlaI9/2003serpreceptivoparalaformulacindepropuestadetercergrado,queel
penado haya satisfecho la responsabilidad civil o exista informe judicial que acredite que el mismo se
encuentraencondicionesdehacerloporlaexistenciadeavalocualquierotrafrmulaconsideradasuficiente
porelTribunal.
Desdeunpuntodevistaprcticodeladefensadelacusadoysatisfaccindelintersdelavctima,habraque
reflexionarsobrelasposibilidadesrealesdeaplicacindelaatenuantedereparacindeldaodelart.21.5.
Estopermitiralaaplicacindeunaatenuante,inclusocomomuycualificadacuandoseunenlareparacin
3

ElT.Salahoradeinterpretarlareparacindeldaoparalaapreciacindelaatenuante,haconsideradoenlasSTS04.02.00y
05.09.01 para reparaciones parciales y otras formas simblicas p.e. STS 12.02.00 de mostrar el propsito de minorar el dao
causado.Cuandosetratadesalvaguardarelintersdelavctima,obviamentenopuedehacerseunalecturatanrestrictivaque
impidalamismapornoserlareparacintotal(peorseranada)oporimpedirlaefectivareinsercinsocialdelinfractor(conel
consiguienteriesgodepotencialesnuevosdelitos.

econmicadeltotalylasimblica:relatarloshechostalycomoocurrieron,peticindeperdnexpresoa
lavctima,haberintervenidoenalgunamediacinpenal.Laconsecuenciapenolgicadelaatenuantemuy
cualificadaeslarebajaenunoodosgradosdelapena.Laapreciacindelaatenuantesimpleeslaaplicacin
delapenaenlamitadinferior,perosiconcurriesejuntoaotraatenuante,lapenapodrarebajarseenunoo
dosgrados.Ademsdeestaatenuacinenlapena,laclasificacinentercergradoinicialmenteoalolargo
delacondenaseraposibleporhabersatisfecholaresponsabilidadcivil,yporser,adems,unindicioclaro
deasuncindelaresponsabilidadpersonalporelhechodelictivocometido.Esconocidoportodosqueeste
factoresdecisivoenlasclasificaciones.Porotrolado,sedaposibilidadesaquelavctimaseveareparadoen
eldao,ycomprendidoensusituacin;nuevamenteinsistimosenlaimportanciadereflexionarsobrelas
positivasconsecuenciasqueparatodaslaspartestienelamediacinpenal.
Encasodeoposicinalpagodelaresponsabilidadcivil,seexigelaprcticadelostrmitesparahacer
efectivoelembargodelosbienes.Aestosefectossemodificaelart.989delaLeydeEnjuiciamiento
criminalestablecindoseunanuevoapartado2:Aefectosdeejecutarlaresponsabilidadcivilderivadade
delitoofaltaysinperjuiciodelaaplicacindelasdisposicionesdelaLeydeEnjuiciamientoCivil,los
juecesotribunalespodrnencomendaralaAgenciaEstataldeAdministracinTributariao,ensucaso,los
organismostributariosdelasHaciendasForales,lasactuacionesdeinvestigacinpatrimonialnecesariaspara
ponerdemanifiestolasrentasyelpatrimoniopresenteylosquevayaadquiriendoelcondenadohastatanto
nosehayasatisfecholaresponsabilidadcivildeterminadasenlasentencia.

21.

En

qu

consiste

la

colaboracin

activa

contra

la

organizacin

terrorista?
Enelcasodepersonascondenadaspordelitosdeterrorismodelaseccin2delcaptuloVdelTtuloXXIIo
pordelitoscometidosenelsenodeorganizacionescriminalesseexigequemuestrensignosinequvocosde
haber abandonado los fines y los medios terroristas, y adems hayan colaborado activamente con las
autoridadesparaimpedirlaproduccindeotrosdelitosporpartedelabandaarmada,organizacinogrupo
terrorista, para atenuar los efectos de su delito, para la identificacin, captura y procesamiento de
responsablesdedelitosterroristas,paraobtenerpruebasoparaimpedirlaactuacinodeldesarrollodelas
organizacionesoasociacionesalasquehayapertenecidooconlasquehayacolaborado.Estascircunstancias
sepodrnacreditarmedianteunadeclaracinexpresaderepudiodesusactividadesdelictivasydeabandono
delaviolencia,ascomounapeticinexpresadeperdnalasvctimasdeldelito.Ademsseacreditarnpor
losinformestcnicosqueexpresenqueelpenadoestrealmentedesvinculadodelaorganizacinterrorista,
delentornoydelasactividadesdeasociacionesycolectivosilegalesquelarodean.

Se puede entender como un signo inequvoco de reinsercin social y de respeto absoluto a la norma
penal la exigencia de que se abandonen los fines y medios de la banda armada. Ahora bien.
condicionar la concesin de la libertad condicional a la eficacia policial es cuestionable, toda vez
que puede ocurrir que pasados los aos en prisin, la informacin que tenga el penado sea ineficaz a
tales efectos. Adems puede suponer una instrumentalizacin del penado no acorde con los
principios preventivo especiales que rigen en la fase de ejecucin penal. En este mismo sentido la
previsin se basa en una incorrecta comprensin del art. 6 de la decisin marco de la UE de 13 de
junio de 2002 sobre terrorismo; dicho articulo no condiciona la libertad a la delacin, sino que
obliga a prever en las legislaciones la figura del arrepentido y a tener en cuenta la colaboracin
activa para la determinacin de la pena a imponer. Por eso la decisin de la UE lo refiere al
momento posterior a la detencin y hasta la imposicin de la sentencia; con el pronstico favorable
de resocializacin es suficiente conforme al espritu del instituto de la libertad condicional. Se busca
con la pena evitar la reincidencia del condenado, y no puede convertirse la libertad condicional en
una manera de favorecer la confesin o la delacin (Enmienda 22 EA Boletn Oficial de las Cortes
Generales. Congreso de los Diputados. VII legislatura. 25 de marzo de 2003) En estos aspectos y
de forma contraria se manifiesta el informe del CGPJ que seala que la ausencia de colaboracin,
con la consiguiente reserva de informacin eficaz, es un signo claro de que el penado an no ha
tomado conciencia de la necesidad de contribuir a la finalizacin de tan graves ilcitos por otros

integrantes de la organizacin;.En todo caso, la existencia o no de este requisito depende, en


ltimo extremo de la valoracin judicial que se realice de la colaboracin prestada.
22. Qu criterios va a utilizar la Junta de tratamiento y el Centro Directivo
para la tramitacin del tercer grado?
LaI9/2003delaDGIPestablecequetodaslaspropuestasdeclasificacininicialoprogresinatercergrado
detratamientoencualquieradesusmodalidades,excepcinhechadelasqueseadoptensobrelabasedelas
previsionesdelart.104.4RPqueformulenlasjuntasdeTratamientoseatendrnalaspresentesnormas:
1.Conindependenciadelascaractersticaspenalesencadacasotipodelictivoyduracindela
condena, la actuacin de clasificacin de las Juntas de tratamiento deber tomar en consideracin los
principios introducidos por la LO 7/2003, en cuanto a las importancia de la evolucin favorable en el
tratamientoreeducadorypronsticodereinsercinsocialascomoalresarcimientoporpartedelpenadodel
daoocasionadoporeldelito,valorandotalesextremosconcriteriosobjetivos.
2.Cuandovayaaformularsepropuestadeclasificacinentercergradodeuninternosetendren
cuentalaposibleexistenciadeotrasresponsabilidadespenalesencursoquenoseencuentrenanpenadas,
procurando recabar toda la informacin disponible sobre ellas (tipo delictivo, peticin fiscal, etc)
incluyendolamismaenlapropuesta.Sinduda,esmsquecuestionablequesetomenencuentacausasan
no juzgadas para el estudio de la clasificacin en rgimen abierto, y que, vulnerndose el principio de
presuncindeinocencia,sepuedadenegartalclasificacinenfuncindehechoannosentenciadosen
firme.Quocurrirasiunapersonanoesprogresadaatercergradoportenerresponsabilidadespenales
pendientesdejuicioyposteriormenteesabsueltaporquesedemuestrasuinocencia?;elperjuiciohaciala
libertad como derecho fundamental o, al menos, como valor superior del ordenamiento jurdico, ser
irreparableyporello,malseconjugaestecriteriodelaI9/2003conlanormativaconstitucional(art.1,17y
24CE).
3.Cuandolajuntadetratamientoconsiderequeunpenadoalqueleesaplicableelperodode
seguridaddeconformidadconelart.36.2CPpornohabercumplidoanlamitaddelaspenasimpuestas,se
encuentra pese a ello en condiciones de acceder al tercer grado de tratamiento, podr formular la
correspondientepropuestaalCentroDirectivocondicionadaalaposibilidaddequeelJuezdeVigilancia
acuerde,ensucaso,laaplicacindelrgimengeneraldecumplimiento.Enestecasoseadjuntarala
propuestauninformeespecficosobreelpronsticoindividualizadoyfavorabledereinsercinsocialdel
interno,convaloracindesuscircunstanciaspersonalesylaevolucindeltratamientoreeducador.Paraello
setendrencuenta:
Asuncinonodeldelito:reconocimientoyvaloracinporelinternodelsignificadodesu
conductarecogidaenloshechosprobadosdelasentencia.
Actitud de respeto a la vctima o vctimas: compromiso firmado de arrepentimiento y
asuncinoreparacindelasconsecuenciasderivadasdeldelito.
Conductaefectivallevadaacaboenlibertad,ensucaso,entrelacomisindeldelitoyel
ingresoenprisin,ypruebasqueloavalen.
Participacinenprogramasespecficosdetratamientotendentesaabordarlascarenciaso
problemasconcretosquepresenteyqueguardenrelacinconlaactividaddelictiva,ascomolaevolucin
demostradaenellos.

ValoracindelosanterioresextremosporpartedelajuntadeTratamiento,conemisindel
pronsticodereinsercin.
4.Alarecepcindedichapropuestacondicionada,elCentroDirectivoadoptardecisinsobrela
aplicabilidadonodeltercergradoalinterno,sometiendo,ensucaso,alaaprobacindelJuezdevigilancia
laposibilidaddeaplicaralpenadoelrgimengeneraldecumplimiento,deformapreviaalaadopcinde
resolucindetercergrado.
5.Cuandoauninternoclasificadoentercergradolellegueunanuevaresponsabilidadpenada,
producindoseaslasituacindequepasaanotenercumplidalamitaddetodaslascondenas,laJuntade
Tratamientoprocederarevisarsuclasificacinconelfinderealizarunavaloracinactualizadadetodaslas
variables del interno. En el caso de que el Juez de Vigilancia no hubiera efectuado con anterioridad
pronunciamientosobrelaaplicacindelrgimengeneraldecumplimiento,dicharevisindeclasificacinse

remitirdeformapreceptivaalCentroDirectivo,consusinformescomplementarios.
6.Porloquerespectaalrequisitodesatisfaccindelaresponsabilidadcivil,atodaslaspropuestas
detercergradoseadjuntarcopiadelfallodelassentenciasqueseencuentrecumpliendoelpenado.Enel
casodequeenalgunadeellasvengaimpuestaresponsabilidadcivil,serecabardelTribunalsentenciadorla
piezaderesponsabilidadciviloinformequeacreditelasatisfaccinonodelamisma.Estaactuacindeber
llevarse a cabo con la antelacin suficiente que permita disponer de esta documentacin a la hora de
consideralaposibleclasificacinentercergradodelinterno.Cuandosetratededelitossingularmente
recogidosenelart.72.5LOGP,serpreceptivo,paralaformulacindepropuestadetercergrado,queel
penado haya satisfecho la responsabilidad civil o exista informe judicial que acredite que el mismo se
encuentraencondicionesdehacerloporlaexistenciadeavalocualquierotrafrmulaconsideradasuficiente
porelTribunal.
7.Enelcasodelosrestantesdelitos,sielpenadonohasatisfechoanlaresponsabilidadcivil
impuesta o ha sido declarado insolvente en sentencia, la Junta de Tratamiento valorar la actitud y
comportamientoefectivosdelinternotendentesaresarcireldaoocasionadoporeldelito,debiendoelaborar
informe,deformaprevia,sobresielpenadoseencuentraendisposicindehacerloylascondicionesque
aceptaparaqueelloselleveacaboenunfuturo,duranteelcumplimientodelacondena.Esteinforme
relativoalosaspectosdelcomportamientopostdelictualdelinternoseremitir,antesdeformularpropuesta
detercergrado,alJuezdeVigilancia,solicitandoelpronunciamientodedichorganojudicialsobresi,ala
vistadelmismo,resultasatisfactorioelcomportamientoydisposicindelpenadoparahacerfrenteasu
responsabilidadcivil,deformaqueposibiliteunapropuestadetercergrado,deconformidadconelart.72.5
delaLOGP,quedandoaloquedispongaesterganojudicial.Dichopronunciamientodeberadjuntarse,en
sumomento,alapropuestadetercergrado.
8.NotendrefectosejecutivoslosacuerdosdeclasificacinentercergradoadoptadosporlasJuntas
de Tratamiento sobre penados con condenas de hasta un ao segn el art. 103.7 RP si existiere
responsabilidadcivilnosatisfecha.Enestecaso,laspropuestassetramitarnconformealoestablecidoen
losapartadosf)yg)anteriores,remitindola,ensumomentoalCentroDirectivo.

23. Se puede clasificar a una persona en tercer grado sin haber disfrutado
de permisos de salida?
S.Laleynoloprohibe,porlotantoestpermitido.Elargumentoaducidoporalgunascrcelesparanegar
estaposibilidadesquelapersonanoseencuentracapacitadaparallevaracabounrgimendevidaen
semilibertad, debido a que no ha disfrutado de permisos de salida. En principio, tal interpretacin es
abiertamenteilegalporque,comohemosdicho,laleynoexigeesterequisito.Peromsinjustoescuandono
sehanpodidoconcederpermisosporqueconcurrencircunstanciasexcepcionalesomuypeculiares(nohaber
cumplidolacuartaparteexigidaparalaconcesindepermisos,onohaberobtenidolosmismosalnotener
nifamilianiamigosenelexterior,AutoJVPdeCiudadRealde11defebrerode1997).

24. Qu ocurre con la clasificacin de los enfermos muy graves con


padecimientos incurables?
Comoanalizaremosenotrocaptulo,alaspersonascondenadasquepadezcanenfermedadesgravesseles
puedesuspenderlacondenaantesdelingresoenlacrcelsinqueconcurraningnrequisitodelosexigidos
porlaleyparalaconcesindelasuspensindelapena(arts.80.4y81CP),salvoqueenelmomentode
comisindeloshechosyatuvieraotracondenasuspendidaporlamismacausa.Enestecaso,lacondenano
sepuedesuspender,ylanicasalidalegalqueexisteeslaclasificacininicialentercergrado.;amenosque
sehayasolicitadounindultoporrazoneshumanitariasyelJuezoTribunalsentenciadorhayaaccedidoala
suspensindelacondenadurantelatramitacindelmismo.
Cuandolapersonaconunaenfermedadgraveeincurabletienequeingresarenlacrcel,conindependencia
de las variables intervinientes en el proceso de clasificacin, se le puede clasificar en tercer grado por
razones humanitarias y de dignidad personal, atendiendo a la dificultad para delinquir y a su escasa

peligrosidad(art.104.4RP).
Estaclasificacininicialpuederealizarladirectamentelaprisino,encasocontrario,envaderecursoante
elJuezdeVigilanciaPenitenciaria.Hayqueadjuntartodoslosinformesmdicosquesetengan(altasde
ingresosenhospitales...),ascomolosquesehayanrealizadoporlapropiaprisin.

25. Qu caractersticas tienen y qu problemtica presentan algunas


resoluciones de clasificacin emitidas por el centro Directivo?
El Centro Directivo (DGIP) en sus resoluciones utiliza, con mucha frecuencia, criterios estrictamente
polticos(justificacinymantenimientoparafinesgenricosdeunasupuestaseguridadciudadana),yno
depolticacriminalcomoseraelcriteriodereeducacinatravsdetratamientoindividualizado.Ignoran
el mandato legal que les obliga a atender exclusivamente a la evolucin del penado. En concreto, en
determinadoscasos,laJuntadeTratamientodelaprisinrealizaunapropuestadetercergradoinicial,o
durantelacondenayelCentroDirectivolaresuelvemanteniendolaclasificacinensegundogrado.En
estoscasossepuederecurrirelmantenimientodegradoalJuezdeVigilancia,quienestimaelrecursoenla
casitotalidaddeloscasos(vid.entreotrosmuchosAutosdeJVPdeLogroo28dejuliode1997y18de
abrilde1995,JVPdeCiudadRealde10deagostode1994).
Esta situacines incoherente eilegal. Si la Junta de Tratamiento de la crcel correspondiente, una vez
analizada y comprobada la evolucin personal del penado, propone la clasificacin en rgimen abierto,
resultaatentatoriocontratodorazonamientolgicoylegalqueelCentroDirectivodicteunaresolucin
manteniendoelsegundogrado,cuandodesdeelCentroDirectivonoseconocealaspersonassobrelasque
se dicta la resolucin. En estos casos, la mayora de los Juzgados de Vigilancia estiman los recursos
basndoseenlosinformespositivosdelosequipostcnicosfrentealosargumentosgenricoscarentesde
sustratoobjetivodelasresolucionesdelCentroDirectivo(AutoJVPAlicantede17deagostode2000).Es
unarealidadquelosmiembrosdelaJuntadeTratamientodelascrcelesconocenmuypocoalaspersonas
penadas,perolosfuncionariosdelaDireccinGenerallasdesconocencompletamente.
Adems,estasyotrasresolucionessedictanempleandotrminosyconceptosjurdicosindeterminados(por
ejemplo,faltaporconsolidarfactorespositivos,noconsolidacindevariablesenelprocesodeclasificacin,
etc.)queimposibilitanconocerenquesefundamentalaresolucin,yaquenoseexpresanloscriterioscon
queseredactanesasresoluciones,nielporqunoconcurrenconlasuficienteintensidadlasvariablesque
intervienenenlaclasificacin.Porelloserecurreamotivosgenricossobrelagravedaddeldelitosinelms
mnimodescensoalapersonalizacindeltratamiento(Auto6/99APMadridseccin5de12deenerode
1999).Lasfrmulasgenricasqueseutilizannosirvencomosuficientemotivacindelaresolucin,puesse
convierten en autnticos cajones de sastre, en elsticos criterios de decisin que justifican cualquier
arbitrariedad.Adems,alnoconocerlosfactoresquehayqueconsolidar,nicomohacerlo,lasresoluciones
nosepuedenatacar,niimpugnarconfundamentosslidos.Estacuestinorigina,porunlado,indefensiny,
porotro,situacionesquefavorecenlaarbitrariedaddelaadministracinpenitenciariaensuintervencin.
Estosupone,enlacasitotalidaddeloscasos,lavulneracindelprincipiodeseguridadjurdicaqueexigeque
todaresolucinquedefundamentada(principiodetaxatividadprincipiodelegalidad).
Estostiposderesolucionesvulneranelprincipioconstitucionaldelainterdiccindelaarbitrariedaddelos
poderespblicos(art.9.3CE)prohibicindequelaadministracinactearbitrariamente.Aesterespecto,
cuandoelCentroDirectivodicteunaresolucindeclasificacinutilizandotrminosamplsimos,carentesde
contenidoconcretoycontradiciendolapropuestadeprogresindegrado(aunqueestopuedeextendersealas
demantenimientoengrado)delaJuntadeTratamientodelacrcel,debenquedarconcretadosexpresamente
losfundamentoslegales,psicolgicos,sociales,enquesebasaparadictarsudecisin.Delocontrario,la
resolucin deber ser declarada nula. En el recurso que se haga al Juez de Vigilancia Penitenciaria (o
JuzgadooTribunalSentenciadorAudienciaProvincial)contralaresolucindeclasificacindegrado,hay
quepedirqueseaclarenlaspalabras/conceptosqueseutilizan,yqueseconcretenensituacionesyhechos
determinados,noenvagasreferencias.
Elargumentoessencillo:elprincipiodeinterdiccindelospoderespblicosaspiraaevitarquesetraspasen
loslmitesracionalesdeladiscrecionalidadyseconviertastaencausadedecisionesnojustificadas(STS,
antiguaSala4,de19demayode1987).Elobjetivodeesteprincipioesquelaactuacinadministrativasirva
conracionalidadalosinteresesgenerales(art.103.1CE)y,msespecficamente,aqueesaactuacinvenga

inspiradaporlasexigenciasdelprincipiodebuenaadministracin(STSSala3de11dejuniode1991).No
setratatantodeprohibiractuacionesadministrativasilcitas,cuantodelanecesidadporpartedelpoder
pblicodejustificarencadamomentosupropiaactuacin(STS,Sala3de17deabrilde1990).
Porotrolado,enloscasosenqueelCentroDirectivomantieneoregresadegradoalpenadocontradiciendo
lapropuestadelaJuntadeTratamientodelacrcel,sevulneraelart.25.2delaConstitucin.Eneste
sentido,sibien,segnjurisprudenciadelTribunalConstitucional(AutoTC15/1984;STC23defebrerode
1988), el derecho a la reinsercin y reeducacin no son derechos fundamentales subjetivos, stos son
mandatos del constituyente para orientar la poltica penal y penitenciaria... encaminada a la efectiva
reeducacinyreinsercinsocial.Porello,debeserdeclaradanulatodaresolucindelCentroDirectivoque
no se base encriterios psicolgicos, sociales, educativos, de evolucin personal, sino de estricta y mal
entendida defensa social, para lo cual, como ya hemos explicado, se suelen utilizar conceptos jurdicos
indeterminados que ponen en peligro la seguridad jurdica y el principio de legalidad (principio de
taxatividad).

26. Cada cunto tiempo se revisar el grado?


Elgradopenitenciarioserevisarcadaseismesescomomximo.Lanuevaresolucinsedebernotificaral
interesado(art.105.1RP).Nadaimpidequelaclasificacinpuedarealizarseantes;esms,elprincipiode
individualizacincientficaexigirunseguimientomscercanoquepuededemandarmodificacionesenel
grado de clasificacin, de manera que es la evolucin en el tratamiento la que determina la nueva
clasificacinynoeltranscursoocumplimientodeunosplazostemporales.Elcmputodelplazodelosseis
mesesdebeefectuarsedefechaafechadelasesindelaJuntadeTratamientoenlaqueseefectala
propuestadeclasificacinorevisindegrado,porloquenodebetomarsecomoiniciodelcmputoeldela
fechadelaresolucinclasificatoriadelCentroDirectivo,niladelJuzgadoencasoderecurso(I20/96).
Desdeelpuntodevistadelaeficacia,laI20/96sealaquesetratedeevitarlostraslados,salvoporrazones
inaplazables,delosclasificadosaquienrestemenosdeunmesparasuprximarevisin,porladificultadde
conocimientodelmismo.Pero,entodocaso,sepodrtenerencuentaelinformeemitidoporelcentro
penitenciariodeprocedencia.
CuandolaJuntadeTratamientoenlarevisindelaclasificacinnoconsidereconvenientemodificarel
gradoasignadoensuda,senotificarladecisinalapersonapresa.Estaresolucindeberestarmotivada,
esdecir,deberconstarenellalosmotivosporlosquesemantieneenmismogrado,pues,silaregresinen
gradoesalgoexcepcionalenunsistemaprogresivo,elmantenimientoengradodeberesponderacausas
perfectamenteprobadasynoasospechas,conjeturasehiptesis(AutodeAP5deMadrid,1005/1997de20
deoctubrede1997).Cuandoelmantenimientosemotiveconunosfundamentosdeterminados,stosdeben
probarse.Encasodedesacuerdoconlaresolucin,elpresopodrrecurriranteelCentroDirectivo(DGIP)
paraqueestudielaresolucindelaJuntadeTratamientoyresuelvaloprocedentesobreelmantenimientoo
cambiodegrado(Modelonmero16).EstanuevaresolucindictadaporelCentroDirectivo,senotificaral
presoconindicacindelderechoaacudirenvaderecursoanteelJuezdeVigilancia(art.105.1y2RP).
EnelrecursoanteelJuezdeVigilancia,oposteriormenteeldereformaanteestemismojuez,osisedeniega
anteelJuzgadooTribunalSentenciadorlaAudienciaProvincial,hayqueexponertodaslascircunstancias
personales,sociales,delacondena,deldelito,etc.(modelonmero9.a,14y15)yhacerreferencia,silos
trminosutilizadosenlaresolucinsonindeterminados,talycomoexplicamosenlapreguntaanterior,ala
arbitrariedaddeladecisindelacrcel.
Sisereiteraporsegundavezunaclasificacinenprimergrado,lapersonapodrsolicitarquelaprximase
hagaenlaCentraldeObservacin.Elmismoderechotienequienencontrndoseensegundogradohaya
cumplidolamitaddelacondena(art.105.3RP).
LaCentraldeObservacinenlaactualidadnotieneubicacinfsica.ExisteenlaDireccinGeneralun
equipodetcnicosquesetrasladaalosCentrosparaelestudiodelospenados.TraselcierredelaCentralde
ObservacinPenitenciariadeMadrid,elcarcterambulatoriodelostcnicosylanaturalezamscuantitativa
quecualitativa de las herramientasde evaluacinempleadas hahecho flaquearaun mselrigor delas
evaluacionesdeestaCentralambulatoria.
Cuando el tratamiento haya concluido o est prxima la libertad del penado se emitir un informe de
pronsticofinalenelquesemanifestarnlosresultadosconseguidosporeltratamiento,ascomounjuicio

deprobabilidadsobreelcomportamientofuturodelsujetoenlibertadquesertenidoencuentaparala
concesindelalibertadcondicional(art.67LOGP).
Difcilmentepuedenconsignarselosresultadosdeltratamientocuandoenlaactualidadapenasexiste.Yms
difcilespredecirunaconductaenelfuturocuandoapenassetienendatossobrelapersonapresa.Cuanto
msgrandeeslacrcel(macrocrcel),mayoreseldesconocimientoquetienenlosmiembrosdelEquipode
Tratamientorespectodelaspersonaspresas.
Esimportanteanalizarelcontenidodelosinformespsicolgicosemitidosporlosprofesionalesdelaprisin.
Muchos de ellos no indican los procedimientos utilizados para emitirlos, otros aportan datos que son
indiferentes en orden a determinar la incapacidad de vivir en semilibertad o libertad total libertad
condicional(ej.hbilyseductormanejodelasrelacionesinterpersonalestantoanivelverbalcomofsico)y
otrosofrecenvaloracionesquecaenenel mbitodelamoral(ej.Supersonalidadestconfiguradapor
escasossentimientosdeculpa,posibleomnipotencia)(Auto1425APMadridseccin5,de30denoviembre
de1998).

27. De qu depende la progresin en grado?


Laprogresinengrado,segnlaLey,dependerdelamodificacindeaquellossectoresorasgosdela
personalidadrelacionadosconlaactividaddelictiva.Estasituacinsemanifestarenlaconductaglobaldel
interno(art.65.2LOGPyart.106.1y2RP).Laprcticadelaadministracinpenitenciariaparaconcederel
rgimenabiertosebasaenunaseriedecriterios:queelpenadohayadisfrutadopreviamentedepermisos
ordinariosdesalidasinincidenciasnegativas,relativaproximidadalaspartesdelacondena,evolucin
favorableenelconsumodedrogas,buenaconductayevolucinpenitenciaria,valoracindelaprimariedad
delictiva, antigedad del delito, presentacin voluntaria, relaciones familiares vinculantes, efecto
intimidatoriodelapena,reconocimientodelhechodelictivo)
Nosparececuestionablequelamodificacindelapersonalidaddelictivasepuedadeducirdelaconductaen
prisin.Larealidadsociolgicadelacrcelennadaesparecidaalavidasocialenlibertad.Dehecho,existe
unadespersonalizacinyunadesocializacindelpresodentrodelainstitucinpenitenciariaquedesautoriza
laadopcinprecipitadadeconclusionesobtenidasenelmediocarcelarioysuautomticaproyeccinen
formadepronsticodevidaenlibertad.Detalmaneraque,aunquelaconductadealgunaspersonaspresas
seaadaptadaalrgimenpenitenciario,ellonoimplicaquestosseancapacesdevivirenlibertadrespetando
laley.Porelcontrario,personaspresasqueadoptanconductasdereivindicacinydeenfrentamientoala
institucinpenitenciarianonecesariamentesonacreedorasdeunmalpronsticodevidahonradaenlibertad.
La llamada falacia penitenciaria tiende a etiquetar a las personas presas y a formular pronsticos
principalmentedesdelaperspectivadisciplinar.
Enlaprctica,unodeloselementosbsicosparalaclasificacinpenitenciariaeslaaceptacinporelpreso
delsistemadevalorescarcelarios,basadosenlanegacindetodainiciativapropiayenlaobedienciaciegaa
laautoridad.Debidoaqueeltratamiento,confrecuencia,esapenasinexistente,laprogresinengrado
dependedelanaturalezadeldelito,deltiempoquequedeparallegaralastrescuartaspartesdelacondenay
desuconductaenlacrcel.
Habraquetomarenconsideracin,preferentementeparalaprogresindegrado,otroselementostalescomo
apoyossociales,familiares,posibilidadesdetrabajooderealizacindecursosdeformacinprofesional
(AutosdeJVPValenciade12deoctubrede1997yde16deoctubrede1997enelquelaexistenciade
trabajo en el exterior desempea un papel fundamental para la progresin en grado), superacin de la
toxicomanaoexistenciadeposibilidadesdeseguirunprogramaderehabilitacinenelexterior,laeventual
reparacindeldao,lacomprensindeldaocausado,etc.Estoselementos,enlaprctica,slotienenun
papel subsidiario respecto del delito cometido, de la conducta en prisin, y del tiempo que reste de
cumplimientodecondena.
Aestosefectos,"lapasadatrayectoriadelictivadelpenado,lassancionescanceladas,laaisladaincidenciaal
regresodeunpermiso,lagravedaddeloshechosquemotivaronlacondenayladuracindelapenano
debentenervalordecisivo,siendounasvariablesmsdelprocesodeclasificacin.Demaneraquesiqueda
acreditadaunabuenaevolucinconductualytratamental,laasuncindevaloressociales,arrepentimiento
porloshechos,existenciadeambientenormalizadoenelexterior,laprogresindegradodebeconcederse"
(AutoJVPdeBilbaode7deenerode1997).Enestesentido,cuandolosargumentosparadenegaruna

progresinengradoseanlatipologa,gravedaddeldelitoolargacondenasepuedealegarqueesosfactores
sonlosquehanllevadoalpresoaestar(xxxaosenprisin)yqueyanopuedentenerseencuentayaquesu
desvaloracin se fij en la sentencia condenatoria sin que en fase de ejecucin pueda apreciarse tal
circunstanciaSielargumentoeslaalarmasocialhabraquesealarquetras(xxaos)conelpasodeltiempo
noesposiblequesemantengayaqueelnombredelpresonoseasociapblicamentealpeligrooaltemor
(Auto900/1998APMadridseccin5de16dejuliode1998).
Porotrolado,siseargumentaseparalamencionadadenegacin"reincidenciaenlaactividaddelictiva"
habraquesealarqueestacircunstanciayafuetenidaencuentaparaagravaralgunasdelascondenasqueel
internoestcumpliendo(Auto411/99APMadridseccin5de29demarzode1999),ysisejustificasela
denegacindelaprogresinatercergradopor"drogodependencianosuperada"hayqueobservarsienel
expediente penitenciario existen datos que acrediten tal afirmacin (analticas) pues en ocasiones este
argumentoseaduceporlacrcelsinningntipodeacreditacin.Encuantoaladenegacinpor"trayectoria
irregular"ocurrelomismo.Debequedaracreditadoporpartedelacrcelnoslolassanciones,sinotambin
losdestinosquetieneohatenidoelinterno,lasrecompensasynotasmeritoriasafindevalorarlasen
conjunto(Auto411/99APMadridseccin5de29demarzode1999).Porltimo,sielargumentoparala
denegacinfueselaexistenciadejuiciospendientesesclaroque,desdeunainterpretacinconstitucional,no
tendraefectoalguno.Locontrariosupondravulnerarelderechofundamentalalapresuncindeinocencia.
El acusado/interno puede ser absuelto, en cuyo caso la valoracin del juicio pendiente como elemento
desfavorablelehabraperjudicadosinmotivo.Ysiescondenado,lacondenaproducirporssusefectos
penitenciarios(411/99APMadridseccin5).
Lalejanaenelcumplimientodelacondenanopuedeserelobstculoparalaprogresindegradopuesste
no supone el incumplimiento de la condena sino su cumplimiento en otras condiciones y aunque esas
supongan menor penosidad, tambin es verdad que al aproximarse ms a la vida en libertad preparan
especialmentebienparaellayfacilitanlalibertadcondicional.Elloapartelapenosidadsloesunvalorsise
contempla la pena en su mera dimensin de castigo sin otras perspectivas y, adems, de castigo
insuficiente.Enestecaso,lapenosidadmengua,peronodesaparecey,casiconcerteza,puededecirsequeel
castigo,dadalasingulardurezadelaLeypenal,nosersuficienteenabsoluto(AutoAPMadrid5de13de
juliode2000).

28. Cundo procede la regresin en grado?


Laregresinengradoprocedercuandoexistaunaevolucindesfavorableenelpronsticodeintegracin
social,enlapersonalidadoenlaconductadelapersonapresa(art.65.3LOGPyart.106.3RP).Delastres
variablesqueseindicanlamsdifcildeconcretareslaevolucinnegativadelapersonalidad,puesqu
variablesseadoptanparadefinirlapersonalidad?,quelementostienelaprisinparaundetalladoestudio
delamisma?
Mssencilloparecedeterminarunaevolucindesfavorabledelaconductaoenelpronsticodeintegracin
social,peroambasvariablesdebenanalizarsedesdeunpuntodevistaglobaldetodalasituacinsocial,
personalypenitenciariadelapersonapresa.Aesterespectohayquedejarclaroquelaletradelaleyseala
quesetratadeenjuiciaruna conducta ynodehacerunpronsticoapartirdeun datoohecho (p.ej.
introducirhachsparaautoconsumoenuncentrodergimenabierto)sinodetodoslosdatosdequese
disponeteniendoencuentaquelaintegracinsocialnopuedeentenderseenelsentidoticopositivodeque
elinternoasumalosvaloressocialesdominantes(noconsumirciertasdrogas)sinoeneljurdiconegativode
queelpenadonovuelvaadelinquir(Auto1192/98APMadridseccin5de19deoctubrede1998).
Enocasiones,delavaloracindelosdatosquelacrcelutilizaparaproponerunaregresindegradose
deducequelaactuacindelapersonapresamereceunreprochedisciplinario,peronolaregresindegrado.
Paranocaerenesteerrorsetrataraderealizarunavaloracinglobaldelaconducta.Aestefinhabraque
analizar toda la trayectoria penitenciaria y personal mantenida durante el cumplimiento de la condena
valorando,juntoalhechonegativoquepuedemotivarlaregresin,losdemsdatosqueseanpositivosen
orden a la reinsercin social. As, respecto del hecho que motiv la regresin se podra tomar en
consideracinlaconfesinacercadelaautoradelmismo(asuncinderesponsabilidadporelhecho).Si
aqultuvoqueverconelconsumodedrogashabraquetenerencuentaelsometimientovoluntarioaalgn
programadedeshabituacin/controldeladrogadiccinsealibrededrogasodereduccinderiesgoscon

metadona.Sielpenadoestabaentercergradoyseproponeunaregresinasegundohabraquevalorarlos
trabajosdesempeados(aportarcontratoynminas),ascomoloscursosdeformacinlaboraloeducativa
finalizados,ysihaconseguidociertaintegracinyapoyofamiliar.Siestuvieseensegundogradohabraque
tenerencuentaelcomportamientoanivelglobal:laparticipacinenactividades,lassalidasdepermisoysu
estadofsicoypsicolgico.
Cabe reiterar que la regresin en ocasiones es una medida desproporcionada a los juicios globales de
conducta e integracin social del penado, utilizndose por la administracin penitenciaria, con mucha
frecuencia,comomediomeramentesancionador,envezdeaplicarseparaestosfineselrgimendisciplinario
penitenciario.
Ademsdelasanterioresconsideraciones,paradecidiralgotanseriocomounaregresindegradohabra
quepartirdeciertaspremisas(Auto1192/98APMadridseccin5de19deoctubrede1998).Enprimer
lugarhadeconsiderarsequeenunsistemaprogresivodecumplimientodelaspenas,laprogresinhadeser
lanormaylaregresinlaexcepcin,pueslaprimeraestenlalneaprincipaldelsistemapenitenciario,
mientrasquelasegundaestenunalneasecundariaycomplementariaquetiendeacorregirloserroresolos
optimismosexcesivosolasevaluacionesapriorsticasnorespaldadasporlarealidad.Ensegundolugarla
ejecucindelapenaserigeporlaideadesancionartodolonecesario,perosolamentelomnimoposible,
conelfindeconseguirlosfinesdelapenaaunmnimocoste(principiodeintervencinmnimadelderecho
penalqueesextensiblealafasedeejecucin).
Enocasiones,cuandoadeterminadaspersonasselesclasificaentercergradoaefectosdeconcesinde
libertadcondicionalporenfermedadgraveeincurable(art.104.1RP),siposteriormentesedeniegasta,se
dictaporpartedelacrcelunapropuestaderesolucinderegresindegrado.Enestoscasos,elCentro
Directivo(DGIP)sueleestimarlaregresina2grado.
Estaprcticaesilegal.EnelAutoJVPOviedode2deabrilde1997seresuelveuncasosimilaralplanteado.
ElCentroDirectivoacuerdalaregresindegradopor:evolucinnegativadelaconductadelpenadodela
quesedesprendesuincapacidaddecontinuarelcumplimientoenunrgimendesemilibertad.Encambio,
segnelAuto,enelprotocolodeclasificacinpropuestaderegresindegradonoconstansancionesni
datoalgunoquereveleunatrayectoriairregular.LaJuezadeVigilancia,estimaelrecursodelpenado,
aduciendoquelaregresinalnoestarfundamentadaenunainvolucincomportamental,nopuedellevarsea
cabo.Estecasonossirvetambincomoejemploparajustificarloquecuestionesmsarribaexplicbamos;
la utilizacin por parte de la Direccin General de frmulas genricastipo, que no se ajustan a la
individualidaddelpenado.
OtrasituacinsimilarseresuelveenelAuto341/99APMadridseccin5de17demarzode1999.Estees
unaejemplodeactuacinarbitrariayclaramenteilegaldelaadministracinpenitenciaria.PorelloelAuto
mereceunexamenexhaustivotalycomoseexplicaacontinuacin.
Unapersonaprogresadaatercergradoenfebrerode1996alosefectosdelart.104.4RPaefectosdelibertad
condicional por enfermedad grave. El Juzgado de Vigilancia deniega la libertad condicional y, en
consecuencia, la Junta de Tratamiento de la crcel de Madrid V propone una regresin de grado a la
Direccin General de Instituciones Penitenciarias que sta acepta. Lo hace en base a tres informes:
psicolgico,educativoymdico.LaAudienciaProvincialenelrecursodeapelacinanalizaconrigorel
contenidodelosmencionadosinformes.
Respectodelinformepsicolgico:"rasgospsicopticos,carecedesentimientodeculpa,esmuypeligrosoy
multirreincidentetienelastrescuartaspartesparaelao2012,frialdadeindiferenciaafectiva,hostilidad
seria a las normas sociales, muy desconfiado y dominante, tiene muy interiorizado los valores
delincuencialesnoasumiendolafiguradelaautoridad...conestosaspectosydebidoaquelaenfermedadse
haestacionadoyelgradodepeligrosidadnohamermado,seinformafavorablealaregresindegrado".
Respectoaesteinforme,laAudienciaProvincialsealaque:"esclaroqueesteinformede241197,sin
entraravalorarsiesestrictamentepsicolgicoointroducedatosajenosaesecampoenloquetienede
descripcindelpreso,noserefierealoocurridoentrefebrerode1996ydiciembrede1997,puesnoes
razonablepensarquelafaltadesentimientodeculpa,lafrialdaddeindiferenciaafectiva,lahostilidadhacia
lasnormas...pornohablardelafechadecumplimientodelapenaolamultirreincidenciasiesqueestosson
datospsicolgicosfueroncaractersticasquesurgieronenlosltimos20mesesanterioresalinforme".De
todas maneras habra que preguntar al psiclogo si una persona encerrada en una crcel, y lo que ello
conllevaencuantopautasdeadaptacinaunrgimendevidadeprivacindelibertad,deposibilidadesde
ejercerlaresponsabilidad,deausenciadeexpectativasdefuturo,delimitacinmximadecomunicaciones

(40minutosatravsdeuncristal),desometimientoabsolutoalaautoridad,depermanentepeligro,etc...
puedecomportarsedeformadistinta,esdecir,sienvezdeserfroafectivamentepuedesercariosoy
emptico,sienvezdenotenersentimientosdeculpapodrallegaratenerlosenunespacioenelqueel
castigo/lmitessontandesproporcionadosrespectodelasseguridadesquerecibe,sienesteespaciopuede
ser confiado o tiene que ser desconfiado para poder sobrevivir, si la interiorizacin de los valores
delincuenciales no guardan relacin directa con la subcultura carcelaria en la que se encuentra, y si la
peligrosidadnoguardarelacinconlosmedios/posibilidadesquerecibanlaspersonasparapoderencauzar
suvidapositivamente.Entodocasohabraquepreguntarseeseinformecmosehizo,quepruebastcnicas
seaplicaron,cuantodurlaentrevistasiestehubiesesidoelmtodo.
Respectodelinformedeleducador:"realizaestudiosenlaUNEDDerecho,segundocursoparticipaenel
tallerocupacional,notienesanciones,lastienecanceladasdesde1996,mantieneunaactitudreglamentaria
conlosfuncionariosyrestodelpersonallaboral.Dadasutrayectoriapenitenciariasemuestrareacioyremiso
conlaactuacintratamentalmanifestandoentodomomentoaptitudesnegativasalrespecto". Sealala
AudienciaenelAutoque"elinformeespositivo;entodocasoelpresonotienefeensutratamientoperose
comportaconarregloalreglamento,carecedesanciones,estudiaytrabaja".Sepuedeobservarcomoel
educador utiliza trminos vacos de contenido y totalmente contradictorios con los datos objetivos que
aporta.
Respectodelinformemdico:"inmunodepresinseveraconcifrasCD4totalesinferioresa100/mm3desde
febrerode1996presentandoenagostode1997CD4totalesde45/mm3yde63/mm3enoctubrede1997.En
la actualidad est asintomtico, siguiendo controles peridicos en consulta de medicina interna del
tratamientoantiviral".
Puesbien,lamotivacindelapropuestaderegresindegradoporpartedelaJuntadetratamientoselee
textualmente:"elinternofueprogresadoatercergradovaartculo104.4RPporelJuzgadodeVigilancia
Penitenciaria con fecha 9296 en va de recurso. Con posterioridad en propio Juez deneg la libertad
condicional.Hoysenospresentainformemdicosegnelcualelenfermoestestacionario.Entendemosque
siharecuperadoestasituacindesaludnoexisteraznalgunaparamantenerloentercergradoentantoque
supeligrosidadseaimportantecomosedesprendedesuhistorialdelictivo,laprisinypersonalidad".
El Auto cuestiona esta fundamentacin sealando: "en definitiva la Junta de Tratamiento propone la
regresinenbasealinformemdicooasuinterpretacindelmismopueshablade"estadoestacionario"lo
quedichoinformenoafirma,yde"haberrecuperadoestasituacindesalud"cosaqueelinformemdico
niega al hablar de "asintomtico" y de "inmunodepresin severa". La propuesta si hizo en base a esa
interpretacin,peseaquelosdatospositivosobrantesenelpropioinformereferidosprecisamentealos
ltimosmesesdelavidadelinternoenlaactualidadsucomportamientoesadaptado,muyparticipativoen
todotipodeactividades,cancionesmltiplescanceladas,recompensas,estudios pueslosnegativoseran
anterioresa1996multurreincidencia,comportamientoconflictivoen1995,antecedentespenalesdefamilia".
Luego, "la Direccin General parece inventarse los datos, pues frente a los informes sorbe actividades
culturalesylaborales,notasmeritorias,adaptacinyparticipacinprecisamentetrassuprogresinatercer
grado,laresolucindelaDGIPafirma:delaevolucinnegativaenlaconductadelinternosedesprendesu
incapacidad, por el momento de continuar el cumplimiento en un rgimen de semilibertad"..."mxime
cuandosegn el informe mdico se ha producido una ostensible mejora en su estado de salud que de
momentonoreclamalaaplicacindelasprevisionesdelart.104.4RP".
Seala el Auto de la Audiencia Provincial que "en primer lugar este razonamiento es abiertamente
inaceptable.Enprincipioporquesebasaeninterpretacionesdiscutiblesdelinformemdicoquedecalificar
alpacientede"asintomtico"yde"inmunodepresinsevera"pasaaentendersecomounestadoestacionario,
aafirmarseque"harecuperadoestasituacindesalud"(frasesemiinteligibleporquenoseentiendequees
recuperarunestadoestacionario)enlapropuestadelaJuntadeTratamientoyterminaporconvertirseen
una"ostensiblemejora"enlaresolucindelaDireccinGeneraldeInstitucionesPenitenciarias.Ensegundo
lugar,yprincipalmenteporqueunahipotticamejoradelestadodesaludnoescausadelaregresinde
grado.Elloequivaldraasostenerquesloelempeoramientoprogresivooalmenoselmantenimientoenuna
situacindemximodeterioropermitiralacontinuidadenelgradoalcanzado,loquealfinalllevaraa
obligaralpresoaoptarporesforzarsealmximoencuidarsusalud,enseguireltratamiento,enprocurarya
que no la curacin definitiva (hoy no es posible respecto al SIDA) al menos la compatibilidad de la
enfermedadconunaciertacalidaddevida.Todolocualespositivoyticamentecorrectoperollevarala
regresindegrado;uoptarporlocontrarioeldescuidodelasalud,ladespreocupacinyelabandono,la

prdidadelasganasdevivirtodolocualesticamentenegativoperoconllevaraelmantenimientoenel
gradoalcanzado.Cuandolasconsecuenciasqueseobtienenalinterpretardeunaformadeterminadalas
normassonabsurdas,buenoesdarmediavueltaytomarotrocaminodeinterpretacin.Elmssencilloesla
interpretacinliteral:laregresindegradoprocedercuandoseaprecieenelinterno,enrelacinconel
tratamientounaevolucinnegativaenelpronsticodeintegracinsocialyenlapersonalidadoconductadel
interno(art.106.3RP).Laactituddelinternoentrefebrerode1996ydiciembrede1997fueclaramentede
mejora.Lamejoradelacausadesaludnoescausaderegresindegrado.Nohayraznpuesparaacordarla
regresindegrado"(Auto341/99APMadridseccin5de17demarzode1998).Tampocosepuederegresar
porunaltercadoenlaUnidaddependienteenqueseencontrabaypornoaprobartodaslasasignaturas
universitarias,puesnosepuedeconfundirlasrazonesparaaconsejarlabajaenelproyectoPadreArrupe,
conlasqueaconsejanlaregresindegradoAuto,AP,5Madridde27deoctubrede2000).
Enlaprcticalaregresindeterceroasegundogradoseproducepor:incumplimientodelascondiciones
impuestasporelrgimendevida(horariosdesalida,irregularidadesmanifiestasenlaactividadlaboraloen
elprogramadetratamientodedrogodependenciasuotros;porlacomisindeunpresuntodelitodurante
algunasalidaautorizada;noreingresotraseldisfrutedepermisosdesalida.
Enotroordendecosas,enningncasosepuederegresaraunapersonadegradoportenerotrosprocesos
penalespendientes,(niporqueaparezcannuevascondenasporhechoscometidosconanterioridadalingreso
en prisin (Acuerdo de los Jueces de Vigilancia penitenciaria). Si se pretende dar un contenido real al
derechofundamentalalapresuncindeinocencia,nopuedesercausaderegresindegradolaexistenciade
otrosprocesosentrmitecontral(AutoAPMadridseccin5375/1998de1deabrilde1998).Tambinla
presuncindeinocenciaadquierevalorcuandosequiereregresaraunapersonaporunasupuestatenencia
dehachsquehabasidoencontradoenlosbolsillosdeunpantalnpertenecienteatororeclusoystehaba
dichoqueeradesupropiedad;encuyocasonoprocedalaregresinaprimergradoporinadaptacina
rgimenordinario(AutoAPLLeidade2.11.2000).Cuandosedicteunaresolucinderegresindetercer
gradoasegundoverelmodelonmero9.b.
TampocosepuederegresarasegundogradoaquienllegaconretrasoalCentrodeInsercinsocialyconun
consumopositivodecocana,siconcurrenvariascircunstancias:queseaunhechoaisladodelquenose
desprendeunaevolucindesfavorabledelpenadoenrelacinaltratamiento;queelconsumodeesasustancia
no tenga relacin con la conducta delictiva que motiv el ingreso en prisin y que lleve varios aos
trabajando sin incidencia alguna, pues la situacin ha de ponerse en conexin con los principios de
proporcionalidad,concarctergeneralyenespecialconeldeprogresividadqueinspiranuestrosistemade
ejecucindepenas(Art.72LOGP)desuertequelaaplicacindelanormajamsresultesingularmente
flexibleparalaregresinyacentuadamentergidaparalaprogresincomopareceocurrirenmuchoscasos
cuandolacausadeunaoelobstculoparalaotranazcandefaltasdisciplinariaspropiasdeunrgimen
general y disciplinario, necesario, sin duda, imprescindible, incluso, pero singularmente ms intenso y
extensoqueeldelaspersonaslibres,porloquenoesidneocomovarademedirlaconductadeunapersona
ni la evolucin en su tratamiento a cuyo xito debe orientarse el rgimen, de forma que las funciones
regimentalesseanunmedioperonounfinsensmismas.(AutoAPMadrid,5de21dediciembrede2000).

29. Cundo la prisin puede regresar provisionalmente de tercer a


segundo grado?
Siunpenadoseencuentraentercergradoynoregresaalacrceldespusdehaberdisfrutadodeun
permisodesalidaodecualquierotrasalidaautorizadaseleclasificarprovisionalmenteensegundogrado,
enesperaderealizarunanuevareclasificacincuandovuelvaaingresarenuncentropenitenciario(Art.
108.1RP)Enlossupuestosdeinternosclasificadosentercergradoquefuesendetenidos,ingresadosen
prisin,procesadosoimputadosjudicialmentepornuevasresponsabilidades,elDirectorpodrsuspender
cautelarmente cualquier nueva salida y acordar la separacin interior que proceda y su pase a rgimen
ordinario,debiendoprocederlaJuntadeTratamientoinmediatamenteaunanuevareclasificacin(Art.108.3
RP)

30. Ante quin debe recurrirse la progresin/regresin de grado?


Ante la primeraclasificacin, oenlasposteriores que sean de progresin ode regresin de grado, los
recursosdebeninterponerseanteelJuzgadodeVigilanciaPenitenciaria(modelonmero9.a).SielJuezde
VigilanciadesestimaelrecursohayqueinterponerunodeReforma(modelonmero14)anteelmismo
Juzgado,ysistesevuelveadesestimar,unodeApelacinanteelJuzgadooTribunalsentenciador.Encaso
de que existan varios rganos judiciales sentenciadores, ser competente el que haya impuesto la pena
privativadelibertadmsgrave,ysihubierevariasdeigualgravedad,elquelaimpusieraenltimolugar.la
AudienciaProvincial(vermodelonmero15),paraelcualhayquepedircuandonotifiquenlaresolucin
desestimatoriaquesesuspendaelplazoparainterponerelrecursoyquesenombreabogadoyprocuradorde
oficioparainterponerelrecursorecurrirenapelacin.Lamismaoperacinhayquehacerpararecurriren
amparoanteelTribunalConstitucionalsilaAudienciaProvincialdesestimaelrecursoysevulneraalgn
derechofundamental.Paraunacompletaexplicacindelosrecursoshayqueacudiralcaptulo15deeste
libro.
Enlosrecursosesmuyimportantequeseexpliquen(porescritoenelrecurso,yatravsdeentrevistas)al
JuezdeVigilanciaoAudienciaProvincialtodaslascircunstanciasconcretasqueconcurrenenelrecluso
(personales,sociales,familiares,teraputicasetc.).Estascircunstanciastienenqueacreditarseatravsde
informes. En este sentido, los criterios de actuacin de los Jueces de Vigilancia sealan que la prueba
pericialnohadelimitarsenecesariamentealosinformesdelosEquiposdeObservacinyTratamiento,sino
queelJuezdeVigilanciapodrcontarconelasesoramientodelosmdicosforensesodeaquellosotros
expertosqueestimeconveniente(criterionm.12).

31. Puede suspenderse un tercer grado concedido por el Juez de


Vigilancia si el Fiscal recurre en apelacin ?
S.Cuandolaresolucinobjetodelrecursodeapelacinserefieraamateriadeclasificacindepenadoso
concesindelalibertadcondicionalypuedadarlugaralaexcarcelacindelinterno,siempreycuandose
tratedecondenadospordelitosgraves,elrecursotendrefectosuspensivoqueimpedirlapuestaenlibertad
delcondenadohastalaresolucindelrecursoo,ensucaso,hastaquelaAudienciaProvincialolaAudiencia
Nacionalsehayapronunciadosobrelasuspensin.Losrecursosdeapelacinaqueserefiereelprrafo
anteriorsetramitarnconcarcterpreferenteyurgente(DA5LOPJ,modificadaconformealaLO7/2003).
Estesistemaesclaramentenegativo.SedesconfadelJuezdeVigilancia.Adems,debidoalatramitacin
delrecurso(art.766LECrim)quesellevaacaboanteelJuzgadodeVigilanciapenitenciariapuedehaber
transcurridomuchotiempohastaquellegueelmomentoenqueelTribunaloJuzgadosentenciadortengaque
conocerdelrecurso.Porello,nocabemsremedioqueademsderealizarunavaloracinmuynegativade
estanorma,efectuarinterpretacionesrestrictivasdelamisma:
UnavezinterpuestoelrecursoysinnecesidaddeesperarasutramitacincompletaelJuezde
Vigilanciadeberadirigirsealrganocompetenteparaconocerdelaapelacinremitindolelosantecedentes
necesarios a los nicos efectos de que pueda pronunciarse sobre la necesidad de mantener o alzar la
suspensinqueseproduceporministeriodelaley.
nicamenteesaplicablecuandoelJuezdeVigilanciasehayalimitadoadesestimarelrecurso
interpuestocontraladecisindelaAdministracinPenitenciariapuesentalessupuestoslaexcarcelacinno
esconsecuenciadelaresolucinjudicial,sinodelapreviadecisinadministrativa.
Quesetratededelitosgraves,loqueexigequetengaunapenasuperioracincoaosdeprisin.
EncualquiercasoesimportantsimopresentarunescritoanteelJuzgadooTribunalSentenciadorparaque
ejecuteelautodetercergrado,antesdequedecidasobreelmismo(modelonum.12.b).

En caso de que el auto del Juez de Vigilancia no sea recurrido por el Fiscal, a fin de que la

progresin se haga efectiva tiene que llegar al centro penitenciario el auto de firmeza de la
resolucin del Juez de Vigilancia Penitenciaria. Si se retrasa es muy importante que alguien se
acerque al juzgado a solicitarlo o para que lo enven por Fax a la crcel.
32. Ante quin debe recurrirse el mantenimiento en grado?
Cuandosenotifiqueelmantenimientoengrado,lapersonadeberecurrirlo,enprimerlugar,alaDireccin
GeneraldeInstitucionesPenitenciariasafindequesepronunciesobreelmantenimientooprogresinde
grado(modelonmero16).Estaresolucinesrecurrible,posteriormente,anteelJuezdeVigilancia(art.
105.2RP).Estesistema,lejosdeagilizarelprocedimiento,lodilataindebidamente.Ellovaaperjudicar
notoriamente a los penados, sobre todo a aquellos que tengan cumplidas las tres cuartas partes para la
libertadcondicionaloestnmuyprximosaellaytenganbuenaconducta.Noobstante,sialostresmesesde
interpuestorecursoantelaDireccinGeneral,noseobtienerespuesta,sepuedeinterponerelrecursoanteel
JuezdeVigilanciaporsilencioadministrativo(Disposicinadicionalcuarta,RealDecreto1879/1994).
Pero, a pesar de todo lo expuesto, con independencia de la resolucin de la Direccin General de
InstitucionesPenitenciarias(CentroDirectivo),elJuezdeVigilanciapodradeclararsecompetenteparaello
segn lo dispuesto en el artculo 76.2.f, LOGP, norma sta de superior rango que el Reglamento
Penitenciario.

33. Puede el Juzgado de Vigilancia o el Tribunal Sentenciador la Audiencia


Provincial progresar a una persona de grado con los datos que concurran en
el

momento

consideracin

de
los

resolver
datos

el
que

recurso,
existan

solamente
en

el

pueden

momento

en

tomar

en

que

la

administracin penitenciaria dict la resolucin sobre el grado?


Ocurre,conciertafrecuencia,quedesdequelaadministracinpenitenciariadictaunaresolucinhastaqueel
Juzgado de Vigilancia y, posteriormente, en caso de recurso, el Tribunal Sentenciador la Audiencia
provincialresuelvenelmismo,transcurrenvariosmeses.Duranteestetiempo,esposiblequehayanocurridos
actos,hechosoaparezcandatosquepuedansertenidosencuentapararesolverelrecurso.Estecambiopuede
serenpositivoencomparacinconelmomentoenquelaadministracinpenitenciariadictlaresolucin
recurrida,enelsentidodequeexistaunaevolucinpersonalpositiva,oeneltratamiento,ounacancelacin
desancionesdisciplinarias,etc.Puesbien,enprincipio,tantolacrcel,comoelMinisterioFiscal,mantienen
quelaresolucinjudicial(JuzgadodeVigilanciaoTribunalSentenciadorAudienciaProvincial)solamente
puedetenerencuentalosdatosqueexistanenelmomentoquelacrceldictlaresolucinyqueluegofue
recurrida.
Nosotros mantenemoslasolucincontraria.Losrganosjurisdiccionalespuedentomarenconsideracin
todoslosdatosqueconcurranenelmomentodelaresolucinjudicialdelrecurso.Losmotivosquejustifican
esta posicin son: a) La jurisdiccinde vigilancia penitenciaria no puede ser estricta ni principalmente
revisoradeunaprecedenteactuacinadministrativaencuantoque"hacerejecutarlojuzgado"esactividad
esencialeirrenunciablementejurisdiccionalynoactividadadministrativa(art.117.3C.E.),demaneraqueel
poderjudicialnopuededeclinarenelejecutivo,siquieraporvaindirectadelimitarsealseguimientoy
controldesusresoluciones(Auto174/2000APMadrid,5,de9defebrerode2000)b)Porquelajusticia
imponeunpronunciamientosobrelarealidadactualpuesseragratuitoygravementeofensivoreconocerque
unapersonaestahoraencondicionesdeprogresardegradoperosedeniegalaprogresinenbaseaquela
resolucinadministrativaimpugnadaeraensumomentoadecuadaaDerecho;c)porquelaAdministracin
tambinhadispuestodelosdatosactualizadosenlasdosrevisionesquealmenoshadebidohacerdesdela
fechadelaresolucinimpugnada(conformealartculo64.4LOGP)ysinembargonohamodificadola
situacindelpreso.EnidnticosentidosemanifiestalaAudienciaProvincialdeMadridseccin5enel
Auto1117/2000de8deseptiembrede2000,c)Elcontroldelalegalidaddeunaresolucinadministrativa
porpartedelaautoridadjudicialnopuedellevara"purasfrmulasdeclarativasdelaidoneidaddeuna

resolucin"extunc"siesevalorsagradoqueeslavidahumanacontempladacomodiscursoycomounhaz
detrayectoriasdelapersonaynoslocomoantnimodemuertequedaconellosubordinadoaunencaje
superficialdelalegalidadaparenteconquiebrarealdelaley,delosprincipiosquelainspiran,ydesu
vocacindesolucionarconflictoshumanosynocrucigramasjurdicos,d)Laclasificacinformapartedel
tratamientoyestnenfuncindelmismo,yuntratamientoindividualizadoyhumanizadodebeestaralday
exige,tambinalTribunalqueresuelvaconlosdatoshoyconlosdatosdehoy".Auto348/99APMadrid
seccin5de18demarzode1999),e)Untratamientoindividualizado,mejoran,personalizado,atentoala
conductaglobaldelinternoexigeunaflexibilidadenlarespuestaaesaconductayalosprogresosenla
mismaqueconvertiraenpuradeclaracindebuenasintencioneselderechofundamentalalatutelajudicial
efectiva(art.24.1)(Auto511/2000APMadridseccin5de11deabrilde2000).
PorelloesconvenienteaportaralJuzgadodeVigilanciayalaAudienciaProvincial(encasoderecursode
apelacin)todoslosnuevosdatosdelosquesedisponga:permisosdesalidaconseguidos,ofertasdetrabajo
enelexterior,cancelacindesanciones,obtencindehojasmeritorias,destinos,trabajos,etc...

34. Qu consecuencias tiene en la clasificacin el no reingreso despus de


un permiso de una persona en tercer grado?
Cuandounapersonapresaclasificadaentercergradonoregresealacrceldespusdeunpermisoode
cualquierotrasalidaautorizada,seleclasificarprovisionalmenteensegundogrado,enesperadeunanueva
reclasificacin. Como medida cautelar, se le pasar a rgimen ordinario. Lo mismo ocurrir cuando la
personahayaingresadoenprisinporlacomisindeotrodelito(art.108RP).

35. Qu intervencin tiene el Ministerio Fiscal en las clasificaciones?


ElFiscal,arazdelaentradaenvigordelnuevoReglamentoPenitenciario,haasumidotieneunpapel
importante. Todaslas resoluciones de clasificacin oprogresina tercer grado adoptadas por el Centro
Directivo,tienenquenotificarsealFiscaldentrodelostresdassiguientesasuadopcin,afindeque
interponga,siloconsideraconveniente,unrecursoanteelJuezdeVigilancia,dentrodeloscincodashbiles
siguientesaldelarecepcindelanotificacin(art.107RP).
Noentendemosporqulasdetercero,ynotodas,afindevelarporelcumplimientodelalegalidad,yen
concreto,endefensadelosderechosreconocidoslegalyconstitucionalmentealospresos.Paraevitaresta
situacin,atodaslucesparcialeinjusta,hayquecomunicarpersonalmentetodotipodedenunciasyquejas
quesetenganrespectodecualquiersituacinqueocurraenprisin.LaprcticaesqueelFiscalestausente
deladefensadelosderechosdelospresospero,pocoapoco,hayqueirdenunciandocadasituacinpara
conseguirquesevayanimplicandoenladefensadelalegalidad.
EsmuycuestionablequelaadministracinpenitenciarianotengaquecomunicaralJuezdeVigilanciala
concesindeltercergrado;parecieraqueesunacartaquesedejaelpoderejecutivoatravsdelministerio
delinteriorparaconcederlasexcarcelacionesdepersonasvinculadasalpoderpolticooeconmicofuera
del control jurisdiccional; y aunque la intervencin del Fiscal en un eventual recurso ante el Juez de
Vigilanciapuedeayudarasolucionarestasituacin,nopodemosolvidarladependenciadeestainstitucin
delgobierno.Porello,losJuecesdeVigilancia,porsuparte,hanestablecidolanecesidaddequeseadopten
las medidas adecuadas para que la administracin penitenciaria ponga en su conocimiento para su
aprobacin,ademsdenotificaralfiscal,losacuerdosdeclasificacininicialdetercergradodetratamiento
penitenciarioylosdeprogresindelmismo,aefectosdecontroldelegalidad.Esms,mientrasseaprueban
las medidas oportunas, tomando conocimiento por cualquier medio, incluso requiriendo a los
establecimientospenitenciarioslainformacinnecesariasobrelaclasificacinoprogresinatercergrado
delinterno,yprevialaformacindelexpediente,losJuecesdeVigilanciapodrnrevocardeoficiodicho
acuerdo(criterio24,reuninJVPenero2003).

36. En qu consiste legalmente el tratamiento penitenciario?

Eltratamientopenitenciario,segnvienedefinidoenlaLeyOrgnicaGeneralPenitenciaria,eselconjunto
deactividadesculturales,educativas,deportivasyteraputicasencaminadasalaconsecucindelosfinesde
reeducacinyreinsercinestablecidosconstitucionalmenteparalaspenasprivativasdelibertad(arts.59y
ss. LOGP). Segn la LeyOrgnica General Penitenciaria, el tratamiento pretende hacer del preso una
personaconlaintencinycapacidaddevivirrespetandoalasociedad.Paraello,seprocurardesarrollary
potenciarenlaspersonaspresasactitudesderespetoasmismosyderesponsabilidadindividualysocial
respectodesufamilia,elprjimoylasociedadengeneral(art.59LOGP).
Paralaconsecucindelafinalidadresocializadoradelapena,elReglamentoPenitenciarioestablecequela
administracin penitenciaria disear programas formativos orientados a desarrollar aptitudes de los
internos,enriquecersusconocimientos,mejorarsuscapacidadestcnicasoprofesionalesycompensarsus
carencias. Asimismo, utilizar programas y tcnicas de carcter psicosocial orientadas a mejorar las
capacidadesdelosinternos,yaabordaraquellasproblemticasespecficasquepuedanhaberinfluidoensu
comportamientodelictivoanterior.Porltimo,potenciaryfacilitarloscontactosdelinternoconelexterior
contando,siemprequeseaposible,conlosrecursosdelacomunidadcomoinstrumentosfundamentalesen
lastareasdereinsercin(art.110RP).
Estas normas deben ser exigidas en caso de incumplimiento ante los Tribunales (Jueces de Vigilancia,
AudienciaProvincial,TribunalConstitucional)cuandolaadministracinpenitenciaria,bienconsuactuacin
oconsusresoluciones,encualquieradelosmbitosdeintervencinpenitenciaria,incumplalasobligaciones
queanteriormentevienenreseadas.Laintervencindelaadministracinenestetemanoespotestativa,sino
imperativa; a este respecto, el art. 110 RP citado expresamente seala que se disear programas
formativos,utilizarprogramasytcnicas,potenciaryfacilitarloscontactosconelexterior.Elloes
exigenciadelprincipiodelegalidadenlaejecucindelaspenasprivativasdelibertad.

37. Qu principios orientan el tratamiento penitenciario segn la Ley


Penitenciaria?
Losprincipiosquedebeninformareltratamientoson(art.62LOGP):
a) Estudio cientfico de la constitucin, temperamento, carcter, aptitudes, actitudes, sistema
dinmicomotivacionalyaspectoevolutivodelapersonalidad.Estosdatosserecogernenelprotocolode
personalidad.
b) Guardar relacin directa con un diagnstico de la personalidad criminal y con un juicio
pronstico inicial que sern emitidos tomando como base los datos recogidos en el apartado anterior.
Tambinsetendrencuentaunresumendesuactividaddelictivaydetodoslosdatosambientalesyasean
individuales,familiaresosociales.
c) Ser individualizado, aplicando mtodos mdicobiolgicos, psiquitricos, psicolgicos,
pedaggicosysociales.
d)Sercomplejo,alconsistirenlaintegracindetodoslosmtodosanteriores.
e)Serprogramado,fijndoseelplangeneralquedeberseguirseensuejecucin.
f)Sercontinuoydinmico,dependiendodelaevolucindelapersonalidaddelinternoduranteel
cumplimientodelacondena.
Como se deduce de la normativa penitenciaria anteriormente expuesta, los mtodos de intervencin
teraputicapropuestoscentranelproblemadelacriminalidadenlapersona.Seignoraalgoelemental:el
delitoesunfenmenosocial,ycomotal,debesertratado.Solamentedetectamosestasensibilidadsocialen
algunasresolucionesdeJuzgadosdeVigilanciaPenitenciaria.Enestesentido,cuandoelpenadohavividoen
determinadassituaciones enlas que el ambienteen determinadospaseso ciudadesha determinadoel
delito,eltratamientorecomendadohadeserlaopcinrealyposibledeunavidadignaycompleta(contodo
lonecesarioparaelpenadoysufamilia)(AutodeJVPnm.1deMadridde27dejuniode1989).Eneste
caso,alpenadoseleprogresatercergradoparaqueencontrasetrabajoremunerado,yapartirdeah,
realizarunseguimientodesuconducta.

38. Qu caractersticas legales tiene el tratamiento penitenciario?

Comoapenasexistetratamientoporfaltademediosmateriales,humanosysobretodo,porfaltadevoluntad
polticadecrearlos,estacuestinslosepresentancuestionesdoctrinaleseideolgicas.
SegnlaLeyOrgnicaGeneralPenitenciaria,eltratamientodeberespetarelderechoaserdiferente,alno
exigirlaasimilacinporlapersonapresadelosvaloresyactitudessocialesmayoritarias,sinolacapacidad
devivirrespetandolaleypenal,ascomodesubvenirasusnecesidades(art.59LOGP)
Pero,encambio,debeposibilitarsolucionesalasdeficienciaspersonalesysocialesqueseanorigendela
conductacriminalolainadaptacinsocialdelapersonacondenada.Eltratamientohadeservoluntario,de
maneraquesilapersonapresarechazaonocolaboraenlarealizacindecualquiertcnicadeestudiodesu
personalidad,ellonotendrningunaconsecuenciadisciplinaria,regimental,nideregresindegrado(art.
112.3 RP) Se estimular a la persona condenada a la participacin en su planificacin y ejecucin. La
personapresapodrcolaborarparaqueenelfuturoseacapazdellevar,conconcienciasocial,unavidasin
delitos(art.61.1LOGP).

39 En qu consiste en realidad el tratamiento?


Frentealosprincipiosyobligacioneslegalesanteriormenteexpuestas,eltratamiento,enlarealidad,es
prcticamenteinexistente.Laescuelasiempretieneunaampliaoferta,peromuypocoseguidaporlospresos,
como denuncia el Defensor del Pueblo en su informe de 1996. En alguna prisin se trabajan tcnicas
encaminadasamejorarlaaptitudsocialhabilidadessociales,controldelaconductaagresivaytratamiento
paradelitossexuales.Lacasitotalidaddelaspersonascondenadasvenpasarlosdas,losmesesylosaosen
elpatio,inactivos.
Cada ao, coincidente con cada curso escolar, se establecen unos criterios para la elaboracin de la
programacindeactividadesenloscentrospenitenciarios(laltimaI2/2002enlaqueseelaboraelplan
para 2002/2003). Las lneas de intervencin son: trabajo productivo, enseanza reglada no universitaria
(posibilitateneraccesoaunordenadoralosnicosefectosdesuutilizacinenfuncindesusestudiosAuto
de AP Pontevedra de 10.3.2003) , enseanza reglada universitaria, actividades culturales y deportivas,
talleresocupacionalesyformacinparalainsercinsociolaboral,todoellodirigidoaserdesarrolladoporel
propiocentropenitenciariooporONGs.Perolasactividadesquerealmenteaportanenseanzaslaboraleso
habilidadessocialestilesparaelfuturosonescasas.Lasqueexistensonmsbienocupacionales,temporales
(enveranotodaslasactividadescesancompletamente),dependientesparasucontinuacindelaexistenciade
fondoseconmicos(algunasseparalizanenlamitaddeldesarrollo),condicionadasalrgimen(horarios,
visitas, cacheos, dependencias, traslados, rgimen disciplinario) y, si quienes las imparten son personas
externasalacrcel,comoocurreconmuchafrecuencia,sucontinuacinsehacedependerdesuactitud
acrticaconlainstitucinysustrabajadores,puesdelocontrario,esaspersonasnoseguirnimpartiendola
actividad.LaInstruccin5/200regulalaintervencindeorganizacinnogubernamentalesenelmbito
penitenciariobasndoseenlaLey6/1996,de15deenero,delvoluntariado,elAcuerdodelConsejode
Ministrosde24dejuliode1997,elRealDecreto1901/99,de17deseptiembreyelmarcodelanormativa
reglamentaria:art.62marcogeneraldeparticipacinycolaboracinconONGs,art.17.6fomentodela
colaboracinconlasUnidadesdemadres,art.80.4colaboracinconentidadespblicasyprivadasparala
ejecucindeunidadesdependientes,art.111.3paralaadecuadaejecucindeactividadesdetratamientose
facilitarlacolaboracinyparticipacinciudadana,art.116.2encoordinacinconelPlanNacionalde
Drogasserealizarnprogramasdeatencinespecializada,art.117penadosensegundogradoqueseles
permitaacudirunainstitucinexterioraprogramasconcretosdeatencinespecializada,art.182,penados
clasificados en tercer grado para trabajar problemas de toxicomana en unidades extrapenitenciarias,
art.182,3conveniosconadministracionespblicasoentidadescolaboradorasparaejecucindemedidasde
seguridadprivativasdelibertad,art.185.2relacinconadministracionespblicasparalacontinuacindel
tratamientopsiquitricounavezpuestosenlibertad,art.195regulaelexpedientedelibertadcondicional
enelquedebeconstarcompromisodeacogidaporpartedesufamilia,personaallegadaoinstituciones
socialesextrapenitenciarias,art.196regulacindelalibertadcondicionalparaseptuagenariosyenfermos
incurablesparalosquesenecesitaavaldeacogidafamiliaroinstitucinextrapenitenciaria.
LaI5/2000establecelasgrandeslneasdecolaboracindelvoluntariado:facilitarlalabordelvoluntariado,
simplificandolostrmites;garantizarunamnimapermanenciadelasintervencionesdemaneraquenosea

slounperodoanual;tenderhaciaelestablecimientodecriteriosgeneralesyprioridadescomunesagrupos
de centros; fomentar la participacin de las organizaciones no gubernamentales en el seguimiento y
evolucindesuspropiosprogramas;favorecerlaformacindelvoluntariadoydelpersonaldelainstitucin;
orientarlasintervencionesofreciendoalasorganizacinnogubernamentaleslosmapasdenecesidades
plurianualesdecolaboracin.Contodoelloelmapadetrabajopuedeserdedicado,segnlaI5/2000a
programasdepreparacinparalainsercinlaboral,programadeintegracinsocial,atencinacolectivos
especficos,programassanitariosycondrogodependientes,programaseducativosydecolaboracinenel
cumplimientodemedidasalternativasalaprisin.
Elprocedimientodeparticipacineselsiguiente:laadministracinpenitenciariaatravsdelorganismo
Autnomo de Trabajo y Prestaciones Penitenciarias (OATPP) establecer el mapa de necesidades de
colaboracin de colaboracin conONGs, ante de 30 de abril de cada ao. A continuacin las ONGs
presentarnsusprogramasdeintervencin.ElOATPP
resolvervalorandolaintervencinencuantoasusobjetivosymediosempleados,ascomolaautorizacin
delosvoluntariosimplicadosenelprograma.
Quprogramasespecficossobrelosproblemasdedrogodependenciassedesarrollan?
Enalgunascrcelesexistentratamientosteraputicosparadrogodependientes.Aunsiendounainiciativamuy
positiva presentaunaseriedeproblemasdedifcilsolucin.Lasplazassonmuylimitadas,ylaeficacia
teraputica,alargoplazo,escuestionabledebidoaquelaprisinnoesunentornoteraputicoeficaz,ni
normalizador,paratratarlosproblemasdetoxicomana.Entrelasdificultadesquepresentapodemoscitar:
sometimientoalrgimendelacrcelytodoloqueelloconlleva:traslados,sanciones,cacheos,entreotras
cuestiones;laconvivenciaenlosmdulosconotraspersonasqueestnconsumiendodrogas;lasactitudes
que son necesarias cambiar (relaciones, afectos, honestidad, responsablidad, sentimientos) y que son de
imposiblecumplimientoenunsistemadevidatanviolentoyagresivocomoeselquepredominalaprisin.
Sobrevivirenlacrcel,ensumsampliosentidodeltrmino,implicaasumirunasnormasypautasde
comportamientoajenascompletamentealasquesepudiesenpensarcomomnimamenteidneasparaeste
tipo de tarea recuperadora. Por ello, el tratamiento debe ser en espacios totalmente ajenos al fsico y
regimentaldelacrcel,oalmenosrealizarseenmdulosconregmenesdevidaalternativosydistintos.
Ello tiene un problema aadido. Con la justificacin de que existen tratamientos dentro de prisin, las
excarcelacionesainstitucionesextrapenitenciariasparatratarladrogodependenciasevenmuyreducidas.
Actualmente,atravsdeladistribucindelametadona,unopiceo,seintentapaliardealgunamanerael
problemadelasdrogas.Sinrestarleutilidadaestasustancia,sobretodoalaspersonasconunaadiccinmuy
graveycrnica,susnicasfuncionessondecontrol.Conestasustanciasereduce,enparte,laconflictividad
entrelosreclusos,ysesupedita/sometealpresoaunasustanciaquesuministralapropiacrcel.Deesta
forma,elpresodependedelacrcelnosloenelrgimendevida,sinotambinenloqueafectaasu
organismo.Apartirdeestasituacin,cabensituacionesexcepcionalesperoposibles,deuntrasladocomo
sancinencubiertaenelquelapersonapresaseveaprivadodeesasustancia.Lasconsecuenciasfsicasde
estasituacinsonmuygraves.Siestoocurriera,ypudierademostrarse,aunquenoesdifcil,habraque
presentarunadenunciaanteelJuezdeGuardiaporunpresuntodelitodelesiones,encomisinporomisin.
Anuestromododeentenderlamaseficacessonlasquefomentanunacontactoconelexterior:permisosde
salida, salidas programadas, medidas del rgimen abierto (unidades dependientes, centros de insercin
social), medidas regimentales del art. 117 RP para los clasificados en segundo grado, internamiento en
centroserehabilitacinextrapenitenciarios(art.182RP).

40. Dentro del marco penitenciario, es posible que la persona adquiera la


capacidad y la intencin de vivir respetando a la sociedad?
Setratara,segnsedesprendedeltextolegal,deresocializaratravsdelainteriorizacinporpartedela
personapresadeunosdeterminadosvaloresquepromuevanunaconductaderespetohacialosmiembrosde
lasociedad.Estoserealizar,segnlaley,atravsdeltratamiento.Pero,quclasedetratamientoharafalta
paralatransmisindevaloresderespeto?Esposiblequestosseadquieranestandoenunpatiodurantetodo
eldayviviendocontinuamenteenunarelacindeviolencia,despersonalizacin,desresponsabilizaciny

sumisin?,esposibleunrespetohacialasociedadcuandoseaslaysegregadestaynoseintervieneenlas
instanciassocialesyenlascausasquehandeterminadolaconductadelictiva?
Lascrcelesestndiseadasdetalmodoquehacenimposibleunaintervencineducativa.Estnorganizadas
para que la persona presa interiorice determinadas formas de conducta especialmente polarizadas en la
sumisinaladisciplinacarcelaria.Lamayoradelaspersonaspresastienequeadaptarsealadinmica
desestructuradoradelaprisinparapodersobrevivircadada.Enlaprctica,dehecho,nosebarajanms
indicadoresobjetivosdemaduracinpersonalquelosdisciplinarios,ynoexiste,desdeluego,ningunoque
detectelosdeteriorospersonalesqueinevitablementeproducelaprogresivaprisionizacinenlaspersonas
recluidas.

41. Es posible que el tratamiento consiga desarrollar y potenciar actitudes


de respeto de las personas presas hacia s mismos y de responsabilidad
individual y social respecto de la familia, el prjimo y la sociedad en
general?
Unanlisisdetrabajosdesociologaypsicologa,unidosalconocimientodelarealidadpenitenciaria,nos
conduceaafirmarqueladinmicapenitenciariaimposibilitaquelapersonapresaadquieraestosnivelesde
responsabilidadindividualysocial.
El profesor Manzanos Bilbao, seala que la prisin se organiza bajo un rgimen que, adems de
despersonalizar y disocializar origina, en las personas presas, graves problemas de desestructuracin
personal.Laspersonasrecluidaspasanaserunacifra,unaunidadquesemueveentornoaunsistema
automticodevidaafindeconformarestrictosesquemasdedominioydisciplina.

42. En qu consiste y qu funciones tiene la accin despersonalizadora de


la prisin?
La accin despersonalizadora de la crcel tiene como funcin la adaptacin del preso al sistema
penitenciario.Ladisocializacincomienzaconunainterrupcino,comoocurreconfrecuencia,conuna
prdidadelarelacindelapersonapresaconsumediofamiliar,socialylaboral.Estarupturaconelmundo
exterior va a provocar el comienzo de procesos de distanciamiento y desarraigo. Adems, implica el
alejamientodelosvalores,delasnormasdecomportamiento,ydelasleyesdelmundoexterior.Deesta
formaseoriginaunsentimientodedesamparo,devaconormativo,yderechazosocial.
Lapersonapresaempiezaasufrirunaindeterminableexperienciadeconvivenciaqueleconduce,atravsde
una adaptacin anormalizadora, a un medio social caracterizado por la omnipresencia de relaciones de
dominacin,disciplina,obedienciairracional,estanciaobligada,sumisinpermanente,ytensinviolentaen
las relaciones. Mediante el proceso adaptativo al medio carcelario se origina una quiebra del yo y una
prdidadefinitivadelosrolesystatussocialesanterioresalingreso.
Laadquisicindeunanuevaidentidad,comoconsecuenciadelaalteracindelaformadeseranterior,viene
impulsada por el aislamiento de su entorno social y la imposicin de los nuevos marcos de referencia
psicolgicosyrelacionalesdelaprisin(paraunmayorconocimientodeestetemaacudiralinteresantsimo
librodeValverdeMolina,LaCrcelysusConsecuencias,Popular,Madrid,1991).

43. En qu consiste la accin desestructuradora de la prisin?


La persona presa tiene que afrontar una situacin desconocida de incierta duracin, de relacin de
dominacin/sumisin,depermanentepeligro,enlaqueesimposiblecontrolarlosacontecimientos.Porotra
parte,alteralosritmosvitales,yoriginaunadependenciaabsoluta,faltadeiniciativayunaausenciade

expectativasdefuturo.Todoello,unidoalashumillaciones,amenazas,monotona,violacindelaintimidad,
originanuevaspautasdecomportamiento.
La actitud permanente de desconfianza ante todos los que le rodean, frente a los compaeros, a los
funcionarioseinclusoconlapropiafamilia,sehacemanifiesta.Estaactitudvienemotivadaporlanecesidad
dedesarrollarmecanismosdedefensaydeautoconservacinenunambientehostilyagresivo.
Alserlainstitucinpenitenciariaunaestructurapoderosafrentealacualelreclusosevivenciaasmismo
comodbil,seveobligadoaautoafirmarsefrenteaesemediohostilparamantenerunosnivelesmnimosde
autoestima.Enestecontexto,elpreso,confrecuencia,adoptaunaactitudviolentayagresiva.Ellooriginala
intervencindelosmecanismospenitenciariosdedisciplina que motivanlaprdida deposibilidadesde
obtenerpermisos,progresionesdegrado,imposibilidaddeaccederasituacionesdecontactoconelexterior,
aislamiento,etc.,estadosomodosdevidaqueconllevanunagravamientoenlaanormalizacinyenla
desestructuracinpersonal.

44. Qu condiciones se dan en la persona presa a la salida de la prisin y


cmo influye en el proceso de normalizacin de vida?
Alsalirdelaprisinexistenunaseriedecondicionesobjetivasqueinfluyeneneldesarraigosocial.Eneste
sentido, los graves trastornos psquicos originados por la crcel, la falta de posibilidades de trabajo, la
carenciadehabilidadessociolaborales,lasituacinfamiliarydelentornosocialprximoy,ennopocas
ocasiones, la necesidad de un tratamiento sociosanitario ante graves problemas de salud creados
frecuentementeporelconsumodedrogas,hacencasiimposiblelainsercinsocialylanoreincidenciaenlas
conductasdelictivas.Lacrcelsumergeamuchossumergidos.Lasociedadylosmediosdecontrolsocialse
encargarnderatificarlo.

45.Qu caractersticas tiene el consumo de drogas dentro de prisin?


El consumo de droga en la crcel es un fenmeno habitual 4. Segn diversas fuentes las personas
drogodependientesencerradassuperanel60%5,llegandohastael80%enalgunoscentrospenitenciarios.
Espaa es el segundo pas europeo con ms presos toxicmanos6. La condicin de drogodependiente y
nmero de entradas en prisin es directa y proporcional. Las personas con problemas de toxicomana
reingresanmsvecesenlacrcelquelasquenolotienen.Elinforme"Milvocespresas"realizadoporla
Universidad Comillas ha revelado que los que han ingresado una sola vez, "solamente" el 35% son
drogodependientes.Entrelosquellevanyadosingresosenlacrcel,elporcentajedetoxicmanoscrece
hastaun50%.Subehastaun64%entrelosquellevantresingresos,yfinalmente,quieneshanpasadoyapor
lacrcelcuatroomsveces,laproporcindedrogodependientesseelevahastalas3/4partes(74%).Quienes
llevan ms de 10 ingresos son casi en su totalidad drogodependientes (84%). Por otro lado, la droga
indirectamenteconduceamuchaspersonasalacrcel.Enestesentido,esnumerosoelcolectivodepersonas
inmigrantesqueseencuentrancondenadospordelitoscontralasaludpblicapromover,favorecer,facilitar,
traficar....Ambasrealidadesdescritashacenconcluyenteunarealidad:lacrcelyladrogavanntimamente
4

Essignificativoqueel85%delosdelitoscometidosen1999lofuerancontraelpatrimonio,mientrasquelosdelitoscontrala
libertadsexualsupusieronel08%ycontralaspersonasel198(EstadsticasdelaPolicayGuardiaCivil.Loquerevelaque
estamosenunasociedadmarcadaporladesigualdadeconmica;yquemuchosdeellosguardanrelacinconelconsumodedrogasy
lanecesidaddesufragarelconsumo.
Reconocerelconsumopasadoopresentenoaportanadapositivoalpreso,sinotodolocontrario.Lepuedeacarrearproblemasala
horadeprogresardegradoodeobtenerpermiso.Deahconcluimosquelosdatosexistentesesmayorqueelrealmentedeclarado.
SegnelDefensordelPuebloAndaluz,ensuinformesobrelasituacindelaspersonaspresasenlascrcelesandaluzas,el80%de
lospresossondrogodependientes;segnlasestadsticasdelaDireccinGeneraldeInstitucionesPenitenciariasel58%;ysegnel
estudiodeinvestigacin"milvocespresas",el59%.SegnelInformedelObservatorioEspaolsobreDrogasde2001,aseguraquede
los44.197reclusosquehabaenestepasen1999,fueronatendidosporsudrogodependencia30.934.Esdecir,el70%delos
internosmantenaunaestrecharelacinconlosestupefacientes.ElInformedelaAsociacinProderechosHumanosdeEspaaseala
queel75%consumadrogasalentrarenprisin.ElinformerealizadopordosdiputadosdelaComunidadAutnomadeMadrid
sealaqueel80%delospresosingresadosenlasprisionesdeestacomunidadautnomasondrogodependientes.
Diario"Elmundo"de25denoviembrede2001.

unidas7.Estereflejodelarealidadnosllevaaplantearqueeltratamientodeladrogodependenciaesesencial
si se quiere evitar no slo la comisin de delitos, tanto dentro como fuera de prisin, sino la misma
reincidenciaenellos.
Un66%delosconsumidoresdedrogaenprisinnoestnrealizandonihanrealizadoantesdelingreso
algntratamientoderehabilitacin.Lacuestinsecentraenelanlisisdelosesfuerzosestatalespordar
solucinaestegraveproblema.Nocabedudaquelaadministracinpenitenciaria,dependientedelMinisterio
delInterior,tieneresponsabilidadalcarecerdevoluntadpolticaydemediosadecuadosparaabordaresta
compleja y grave situacin; pero es, a su vez, subsidiaria respecto de la actuacin de los rganos
jurisdiccionalesencargadosdeaplicarlasmedidaslegalmenteestablecidasparaevitarelingresoenlacrcel
ybuscarsalidasalternativasadecuadasparaabordaresteproblema.Responsabilidadqueseextiendealos
legisladoresdelCdigoPenal,talycomonosreferiremosalolargodeesteartculo,quehanconfiguradoun
elencode medidas suspensivas ysustitutivas, escaso, ineficaz e irreal para el perfil de toxicmano que
delinquen.

46.Qu consecuencias que genera la existencia de la droga en la crcel?


Lavidaenlacrcelesunautnticosistemasocialalternativoenelqueladrogaylosactosqueconllevasu
consumo (venta, consumo, deudas, conflictos, comisin de delitos, ajuste de cuentas), constituyen un
elementoesencialsobrelosqueseestructuralaconvivenciaylasrelacionesdepoder.Estaconfiguracin
sociolgicageneraunaseriedeconsecuencias:
Violencia psicolgica yfsica. Quienes poseen la droga controlan el patio pues a ellos quedan
sometidos las personas que necesitan droga. Existe un mayor sometimiento cuando la sustancia se va
consiguiendoabasedeprstamoscondicionadosadevolucinenelfuturo,bienporquesesupagosevaa
efectuarenelexteriordelacrcel,bienporquelacantidadadeudadaseprometeintroducirenprximas
comunicaciones"visavis",obienporqueseprometaintroduciralreingresodeunpermiso.Perocuandoesta
devolucin no se ha podido hacer la violencia psicolgica provocada por la presin se transforma en
violenciafsicayaparecen"losajustesdecuentas"yconellaslasconsiguienteslesionesymuertes8.
Aumentodelacomisindehechosdelictivosdentrodeprisin.Unelevadonmerodelosdelitos
cometidosenprisinguardanrelacindirectaconlasdrogas.Enestesentidopodemoshablardedelitos
contra la salud pblica (donar, promover, favorecer, traficar...), delitos para sufragarse el gasto (robos,
hurtos),obiendelitoscometidosbajosusefectos(delitosdelesiones)obienprovocadosporlasrelacionesde
estructuracindepoderydeudas(delitoscontralavidaylaintegridadfsica).Loquegeneramscondenay
mstiempodecrcel.
Estructuracindepoderycontroldelacomplejaredquesuponelacrcelcomosistemasocial
alternativo. Quien controla la droga controla la crcel, y a ellos se encuentran subordinados los
consumidores. Las consecuencias de esta subordinacin son ms graves toda vez que el preso ya est
subordinadoalpodercuasiomnmododelasadministracin.Deestamaneralosmrgenesdeautonoma
personal son prcticamente nulos. Con la droga, la crcel, como estructura, imposibilita an ms las
relacionesdeverdadygarantizaelfracasosiponemoselvalorenlapersona.
7

ElinformedelosDiputadosdelaComunidadAutnomadeMadridsealaqueseranecesariouncambioprofundodelaspolticas
estatalesenrelacinconlasdrogasilegales,consuconsumoysutrfico.Tardeotempranoalgnestadodarlasalidaauncambio
radicalquenormaliceelusodeesassustanciasyquerompalalgicadelmercadoparaestataldelasdrogasilegales.Veninmoralla
"demonizacin"deladrogaporunladoy,porotro,laalimentacindesumercadonegro(Aunqueenlaactualidadlalgicaque
mueve la droga se rige por los parmetros clsicos del libre mercado), se ensaa sobre miles de personas que directa o
indirectamentesufrenlasconsecuenciasdelprohibicionismo.
8
Enmuchasocasiones,estosataquessuponenautnticosretosavidaomuerte.Estaformadeenfrentamientoesunaformamshabitual
desolucionarlosconflictosexistentesenlaprisin.Noexisteunamnimareflexinniempataquepuedaanticiparlaprevisindelas
consecuenciasnegativasdelcomportamiento.Lomsimportanteessalvaguardarlaimagen,quedarporencimadelotro,noparecerdbil
parapoderseguirmanteniendounstatusmnimoquelepermitasobrevivirdentrodelaprisin,omantenerlaposicindeprivilegioo
poder.Estaformadecomportamientoprovocagrandesdificultadesenelmomentodelaincorporacindelpresoalavidaenlibertad,
pueslosproblemasnosepuedensolucionar prescindiendodelareflexin,deformainmediata yviolenta.Situacinquegenera la
dificultadderelacinsocial.

Aumentodelaaplicacindelaparatodisciplinariodelacrcel.Esevidentequeelconsumode
drogasprovocacomportamientosprohibidosenlaLeyPenitenciarianoyasloporelpropioconsumo,sino
porlasconductasnecesariasparaconseguirla,caracterizadasporlaviolencia:coacciones,hurtosyrobos.
Estoscomportamientoslaintervencindelaparatodisciplinariodelaprisinqueahondaenlaprisionizacin
ydesestructuracindelrecluso(aislamientos,regresinaregmenescerradosetc...).En elinforme"Mil
vocespresas"obtuvimoscomodatoacreditativodeestaafirmacinqueel81%delosencuestadosquese
declaraban drogodependientes haban sido sancionados, mientras que entre los no drogodependientes
solamentelohabansidoel56%.Adems,lasmedidasregimentalesdecontrolaumentan(cacheosyrequisas
enceldas)ysegeneransituacionesdeconflictoentrefuncionarioypreso
Reduccindelaconflictividadpresoinstitucin. Lainstitucinesconscientedelaltonmerode
personaspresastoxicmanasqueexistenenlasprisiones.Igualmenteesconscientedequeenlacrcelse
mueveladrogacasiconlamismafacilidadcomoenlacalle.Apesardeellosehacemuypocoporremediar
estasituacin.EnelinformedelaAsociacinProderechosHumanosdeEspaasobrelasituacindela
prisionesespaolas(1999),sesealaquealgunosprofesionalesdelainstitucinpenitenciariaaceptanla
existenciadedrogaenlospatioporquestahacequelospresosestnmstranquilos.
Aumentodeenfermedadesporcontagio(VIHyhepatitis).Aunqueenlosltimosaoselnmero
decontagiosvadescendiendoporlainformacin,porlosnuevoshbitosdeconsumo(fumadaenvezde
inyectada),porlaimplantacindealgunasprisionesdeprogramasdeintercambiodejeringuillasylosplanes
demetadona.Esobvioquequienesconsumendrogatienenpeorsalud(57%delospresosencuestadosenel
informe"milvocespresas",frenteal30%quedicenestarenfermosperonoserdrogodependiente).Con
independenciadequeelcontagiohayasidodentroofuera,enlaactualidadlaspersonasenfermasdeVIHen
lacrcelsuponenentornoal25%.Todasellassondrogodependientes9.
Limitaciones regimentales. El consumo de drogas es un elemento que impide la concesin de
permisos,noporquenosetenganlosrequisitoslegalesparaobtenerlo,sinoporelriesgodequebrantamiento
delpermisoodecomisindedelitosquesetiene.
Aumentodelasmuertes.Laconsecuenciamsgravedelconsumodedrogaeslamuerte,bienpor
sobredosis,bienporelconsumodedrogaadulterada,ademsdelasqueseprovocanporlosajustesde
cuentasencasodedeudas.Estasmuertessucedennosoloconlasdrogasilegales,sinotambinconlas
legalizadas (metadona), debido a que se mezclan con otras sustancias v. Gr. benzodiacepinas,
principalmenteconAlprazoln,frmacocuyousopatrndeabusoesfrecuenteenusuariosdePMMporlos
notables efectos sumatorios, ocasionando riesgo para la vida incluso a dosis bajas de metadona y
frecuentementeindetectableenanalticadeorinaparaelcontroldeconsumo.Elnmerodefallecimientos
de1997,1998yprimersemestrede1999depersonasrelacionadosconlasdrogasasciendea100.Deellos20
fuerondurantepermisospenitenciarioyelrestofueron80fueronenlacrcel.Delos80,28estabanen
tratamientoconmetadonay52no.10

47. Qu tratamientos existen en la crcel?


Elart.25delaConstitucinestableceque"laspenasprivativasdelibertadylasmedidasdeseguridad
estarnorientadashacialareeducacinyreinsercinsocialynopodrnconsistirentrabajosforzados" 11.El
tratamientodedeshabituacinesprisinsepresentadesdeundoblembito:eldesaludyeldereinsercin
social.Desdelaperspectivasanitarialaadministracinpenitenciariatieneeldeberdevelarporlavida,la
integridadylasaluddelosinternos(art.3LOGP).LosJuecesdeVigilanciaPenitenciariaensureuninde
2003establecenquetodointernoquedeseeuntratamientodedeshabituacinseletienequeproporcionar
con independencia de que cual sea su situacin penal o penitenciaria (criterio 45) y se insta a la
administracin penitenciaria a que incremente eficazmente los recursos necesarios para completar la
9

10

11

AunqueeltemadelVIHnoespropuestoparasestartculo,queremoshacerunabrevereferencia.Lospresosconestasenfermedades
noestsiendoatendidasenigualdaddecondicionesqueelrestodeenfermosenlibertad.Lostratamientossemodificanenfuncin
decriteriospresupuestariosynodeeficaciaparaelpaciente;lashospitalizacionesserealizanencasosdegravedadextrema;los
presos enfermos estn atendidos por mdicos generalistas y no especialistas, siendo, adems el personal sanitario muy escaso.
InformedelDefensordelPuebloAndaluz
EnriqueJ.AcnGarca.EstudiosobrelamortalidadrelacionadacondrogasenIIPPen,manejodepacientesentratamientocon
metadonaencentrospenitenciarios,MinisteriodelInterior,Segovia,diciembrede1999abrilde2000.
Este fin de la pena no excluye otros como la prevencin general o el carcter retributivo. El Tribunal Constitucional se ha
manifestadoenestesentidoenvariasocasiones.Ver,entreotrassentencias,STC,4.7.1991,150/1991,BOE29.07.1991.

actividad que viene desarrollando con los programas de sustitucin de opiceos o de intercambio de
jeringuillas(criterio48)Entantoquelaadiccinadrogastxicasafectanalasaluddelaspersonasprivadas
de libertad en las crceles, la Administracin penitenciaria tiene que articular mecanismos en orden a
posibilitarlasuperacindeaquellas.Porotrolado,larelacinentredrogaycomisindedelitosnosconduce
a la idea del tratamiento penitenciario vinculado a la posibilidad de superacin del problema de la
drogadiccinodereduccindeldaoafin dequelapersonapresa puedavivirenlibertadfuturaconuna
calidaddevidadigna12(enelmismosentidolaCirculardelaDGIP5/1995).
Antelasituacindescritaalolargodetexto,quedapatentequeladrogaesunimportantefactorcrimingeno
ydeconflictividadpersonaleinstitucionaldentrodelacrcel.Sehacenecesarioelabordajedelproblemade
ladrogodependencia,noslodesdeelpuntodevistadeordenyseguridadciudadana,queeselenfoque
desdeelquetrabajaenlaactualidad,sinodesdeunenfoquequepermitaalaspersonasconestaadiccin
podervivirconunacalidadvidadigna,biensinconsumirlasoconsumindolas.Lamentablementelapoltica
desdeelMinisteriodelInteriorescasiconexclusividaddecontrol.Setratadelapolticabasadaenfines
exclusivos de seguridad ciudadana. Por ello, en vez de fomentar las excarcelaciones a centros
extrapenitenciarios(art.182RP,art.117RP)seabordalaposiblesolucinalconflictoconescassimos
mediospersonalesyprofesionales13.SegnelInformedelaAPDHE,delospresostoxicmanos,solamente
un 27% dicen estar llevando a cabo un tratamiento de rehabilitacin. En cambio, un 70% de los
consumidoresdedrogaenprisinnoestnrealizandoalgntratamiento.SegnelinformedelDefensordel
Pueblo Andaluz, de los aproximadamente 7.700 toxicmanos de las prisiones andaluzas, slo estn en
tratamiento2.152personas,habiendoiniciadoestetratamientofueradeprisinlamayora.Deestas2.152
personas.1.198estnenprogramasdemetadona,generalmentedemantenimientoyelresto,suelenestaren
programasdenaltrexona.Esciertoquelaresponsabilidaddequeelpresoacudaauntratamientonoes
necesariamenteresponsabilidaddelCentropenitenciarioyaqueenellointervienedeformafundamentalla
voluntaddelrecluso.Noobstante,supuestaunamismaconductaporpartedelpresoentodosloslugares,el
hechodequeenunascrceleselporcentajedelpresosquenorealizatratamientoseamuysuperioralamedia
sugiereque,enesoscentros,elaccesoaestosprogramas,suestmulo,seguimientoocalidad,noessuficiente
paraatender"lasnecesidades"delrecluso14.
Dentrodelacrcelexistenalgunostratamientosderehabilitacin,peroaelloslleganmuypocaspersonas.
Dentrodeloscentrospenitenciarioslaofertadeatencinpblicaparadrogodependientesesmuyinferiorala
queseofrecealaspersonasqueestnenlacalle.Elaccesoaestosrecursossecontemplaslocomouna
alternativaalaprisinocomounaopcincuandoconsiguenlalibertad,nocomounrecursoteraputicoy/o
sanitario que pueda ofrecerse a personas drogodependientes que estn presas15. En general, existen los
siguientessistemasdetratamiento:
Tratamientosdedesintoxicacin.Estndestinadosasuperarelsndromedeabstinenciaorgnico.
Puedenserdecarcterambulatoriouhospitalario,conutilizacindefrmacososinellos.Enlaprisin
solamentesecontemplanlostratamientoconfrmacos,sobretodoansiolticos,yelprogramadereduccin
demetadona,noplantendoseenningunasituacinlaposibilidaddeofrecerladesintoxicacinhospitalaria.
Estoobligaaquemuchaspersonasseveanobligadasadesintoxicarsesolasysinfrmacos16.
Tratamientosdedeshabituacin/rehabilitacin. Suobjetivoesconseguirestabilizarlaabstinencia.
12

13

14

15
16

ElinformedeldefensordelPueblode1998recuerdaque"hasealadoendiversasocasioneslanecesidaddequelaAdministracin
penitenciaria posibilite que los internos tengan acceso a tratamiento rehabilitador. Progresivamente se va extendiendo y
generalizando la puesta a disposicin de los internos de programas de apoyo, informacin, tratamiento y rehabilitacin de
toxicmanos,noobstantesedebecontinuartrabajandoenlalneadeampliarlostratamientosyfacilitarquelleguenaunmayor
nmerodeinternos...Juntoaunamayorvariedaddetratamientoylaextensinaunmayornmerodeusuarios,tambinsehade
hacerhincapienlanecesidaddequeseestablezcanloscontrolesprecisosparaevitarquepuntualesfracasosdeestosprogramas
pongan en peligro su continuidad. Asimismo se hace preciso que estas actuaciones, que van dirigidas fundamentalmente a la
proteccindelasaluddelosinternos,estnincardinadosensuprogramade tratamientopenitenciariocomounfactormsdel
mismo"(InformedelDefensordelPueblo1998).
Simsdel8%delospresossondrogodependientesenlascrcelesandaluzas,essignificativoqueun0'02%delosfuncionariosest
dedicadoconexclusividadaatenderelproblemadelasdrogodepedencias,esdecir1de3.449.DelosdatosextradosdelInforme
General1998elaboradoporlaDireccinGeneraldeInstitucionespenitenciarias,nosencontramosconqueelpersonalqueseocupa
delaboresderetencinycustodiarepresentael79%;mientrasqueeldestinadoareeducacipnyreinsercinsonel9%.
InformeAPDHE.1999.EnAlmeranorealizanprogramasel93%,enValdemoroel85%,enHerreradelaManchael84%,elPuertoI
el82%;encambioenMadridIVNanclaresdelaOca,Foncalent,lorealizanel30%.
Vid.InformedelDefensordelPuebloAndaluz,op.cit.
Vid.InformedelDefensordelPuebloAndaluz,op.cit.

Suelenllevarseacaboconlaayudadefrmacosy/oactividadesocupacionales,realizndoseseguimiento
personalyapoyopsicosocial.Estostratamientoestnnegadosalacasitotalidaddelosdrogodependientes,
salvoqueseleshayaconcedidoeltercergradoart.182cumplimientoenunidadextrapenitenciariao117RP
posibilidaddesalidadiariadurante8horas.Estaimposibilidadestsiendoagravadaconlalejanaenque
seencuentranlosnuevoscentrospenitenciariosrespectodelosncleosurbanos.Concarctersustitutivose
ponenenmarchaotrasactividades,peromeramenteocupacionales,sinirdestinadasaltratamientodelas
drogodependenciasyalquepuedenaccedermuypocaspersonas.Enalgunaprisinseorganizaalgngrupo
deterapiaporalgnprofesionaldelainstitucin.Enalgunasprisionesalgunasentidadesprivadasintentan
trabajarladrogadiccincomounacomunidadteraputica(ProyectoHombre,PuntoOmega).Anvalorando
comopositivalapresenciadeestasinstitucionesnopodemosolvidarlaperspectivacrtica17.
ElReglamentode1996prevestaposibilidad;perosalvoenalgncentropenitenciarioenelqueseestablece
unmduloespecficoparatrabajarelproblemasdelasdrogodependencias(entreotros,MadridV,oeldel
CP de Villabona), no existen por diversas razones; el alto coste de profesionales destinados a estas
comunidades, la estructura arquitectnica de muchas crceles destinadas a las funciones de retencin y
custodia, la inestabilidad de la poblacin reclusa (excarcelaciones, cambios de situacin penal,
conducciones,sancionesdisciplinariasetc.)
18
TratamientodemantenimientoconmetadonaAtravsdeestesustitutivodelaheronasebuscala
consecucindelanormalizacindelavidadeldrogodependiente19.Esteopiceo,presentacomocuestiones
positivaslassiguientes:disminuyelaconflictividadtodavezquelaspersonasquelasconsumen,engeneral,
notienenque"buscarse"lavidaenelpatio,porloqueseevitalacomisindenuevosdelitos,ahorabien,no
todostomanestasustanciaexclusivamente,sinoquelacomplementanconotrascuyamezclaeslesivae
inclusomortal;lametadonadisminuyelaconflictividadypermiteunamejorcalidaddevidaporelcontrol
mdicodelasustancia;segnunestudiodelNationalInstituteofDrugAbusedemostrquelosprogramas
demantenimientoconmetadonareducenlamortalidadenun70%,reduceelusodelaheronaenel70%,
reducelaactividaddelictivaenel57%20.Previene,adems,elcontagiodeenfermedades.Perotambin
existen cuestiones crticas: su utilizacin desde perspectivas de control social y no desde enfoques
biosquicosociales,todavezqueexcepcionalmenteseveacompaadadegruposdetrabajopsicoteraputicoy
social.Asimismo,sisuofertaesgeneralizable,muchaspersonasquepodraniniciarprogramaslibresde
drogaseninstitucionesextrapenitenciarias,nolohacen,bienpornoestarmotivadosalsermscmodala
metadona,bienporquelapolticarestrictivadeseguridadciudadanadelaadministracinpenitenciarialo
impide.
Lapersonaencargadadelprogramademetadonaenlascrceleseselsubdirectorojefemdico,realizandoel
suministroalgnATSoAuxiliar.El20%deloscentrospenitenciariosconsideranecesarioincrementarlos
recursossanitariosyel53%demandanunaintervencinmultidisplinar21.Segnlasprisionesnosuelehaber
retrasosenelsuministrodemetadonaenaquelloscasosenlosquelapersonaingresaconeltratamiento
desdeelexterior.Lonicoquenecesitanesconfirmarsutratamientoyladosisconelcentrodereferencia.
Perocuandoelpresohaingresadoelfindesemana,nopuedenconfirmarlohastaellunessiguiente,conlo
17

18

19

20

21

Supresencialegitimalacrcelcomonicasolucinalosconflictos;laadministracinpenitenciariareducelaaplicacindelart.182
RPparacumplirlapenaencentroextrapenitenciarioderehabilitacinconelargumentodequeyasetrabajadentro,olvidandoque
lacrcelnoesunespacioadecuadoparaeltrabajoteraputicoclaramentenoloes;seignoranlasconsecuenciasnegativasque
puedetenerparalapersonaundeterminadotrabajoteraputico(honestidad,sentimientos,empata)cuandotienequeabandonarel
programaperoseguirenlacrcel;decisinporpartedelosrganoscolegiadosdelacrcelsobreelfuturolegalyregimentaldelos
presos lo que provoca, en ocasiones, situaciones injustas expulsiones por motivos regimentales, denegacin de progresiones a
rgimenabiertopormotivosdeseguridadpocoobjetivos,traslados...);"limpiar"laimagendelaadministracinpenitenciariaantela
opininpblicayorganismosinternacionalesdandoalaparienciadequeelproblemadelasdrogasseabordaconrigor,seriedady
conlosmediosnecesarios,siendoestaafirmacinfalsa.
Elcostedeltratamientoconmetadonaporinternoesde14.081pts/ao;esdecir38pts/da.(eldesglosedegastosesel374%en
analticas,214%vasosdedispensacinyrecogidadeorina,187,elfrmacodelametadona,134%transporte,3%inversiones.En
SanzSanz,J;Lostratamientosconmetadonaenloscentrospenitenciarios,en"Manejodepacientesentratamientoconmetadonaen
centrospenitenciarios",Segoviadiciembre1999,abril2000.Lanormativaqueregulalostratamientodemetadonason:Ordende20
demayode1983,Ordende31deoctubrede1985,realdecreto75/1990,de19deenero,Realdecreto1131/1990,de14de
septiembre,realDecreto5/1996,de15deenero;Circular5/1995.
Los planes de reduccin de riesgos se introdujeron por varios motivos. 1) la elevada prevalencia de consumo de drogas,
especialmentedeherona,puestodaslasevidenciasapuntanaqueEspaafueunodelospasesdeEuropaOccidentaldondeel
consumoalcanznivelesmsaltos.2)elempleodelavaparenteralcomovaprincipaldeadministracin,loqueconllevaalas
posibilidadesdeinfeccinporVIHydesobredosis.3)LaintroduccindelVIHdeformaprecoz.
HarwoodHj,societalCostofheroinaddiction.EffectiveMedicaltretamentofheroinaddiction.NIHConsensusDevekopmen
ConferenceNov.1719,1997;5356.
SanzSanz,J;Lostratamientosconmetadonaenloscentrospenitenciarios,op.cit..

cual,segnlosinternosentrevistados,sedanmuchoscasosenlosqueeldrogodependienteestvariosdas
sintratamiento,paliadoportranquilizantes.
Elnmerodepresosquesehanidoincorporandoaprogramasdetratamientodemetadonahaascendidoen
losltimosaos:1992:90pacientes;1993:135pacientes;1994:696pacientes;1995:2041pacientes;1996:
6606pacientes;1997:10577pacientes;1998:16284yen199918.899pacientes22.
Intercambiodejeringuillas.Sonprogramasbasadasenelusodevasmenosagresivasyqueincidan
enlostilesaemplearenelconsumoconelfindeproteccindelasaludindividualycolectivaenordena
prevenirelriesgodeinfeccinyreinfeccinporvirusdetransmisinsangunea.Sehanimplantadovarios
planes piloto de intercambio de jeringuillas, usadas por nuevas: crcel de Basauri (I 11/97), crcel de
Pamplona(I15/98), crceldeTenerife(I6/99),crceldeALama(12/2000),crceldeSanSebastin(I
2/2000);laInstruccin5/2001amplaesteprogramapaulatinamenteatodosloscentrospenitenciariossegn
laplanificacinqueelaborelaSubdireccinGeneraldeSanidad.Enestasprisionessemodificanlasnormas
dergimeninternoafindeconsiderarquelasjeringuillasnosonobjetoprohibidodentrodelacrcel,
siemprequeseencuentrendentrodelplanpiloto.

48. Hacia donde caminar?


Caminarhacialasustitucinyprogresivadesaparicindelacrcelcomomediodesolucindeconflictos.
Frentealacentralidaddelapunicinesnecesariaunajusticiaypolticacriminalbasadasenlareparacindel
dao,eldilogoylaresponsabilidadsolidaria,enlareformulacindelderechopenaldesdela"vctima"que
enprincipioescompatibleconlarecuperacindelapersonasdrogodependientes,ascomoeltrabajosobre
lascausasqueproducenlaexclusinyeldelitoynosolamentesobresusconsecuencias.Estoconllevar
programasrigurososenlaintervencinyenpermanenteinnovacin.
Caminarhacialaconstruccindeunasociedadmsjustaeigualitaria.
Caminardesdeladisidenciaconaquellasactuacionesdelaadministracinpenitenciariayjudicialqueno
seanacordesconladignidadhumana.Enestesentido,sedeberaasegurarlaasistenciajurdicaatodaslas
personaspresasylaentradaenlacrceldetodosaquelloscolectivosyasociacionescuyarazndeserseael
seguimiento, acompaamiento y acogida de personas con problemtica social y penal. Tambin el
acercamientodetodaslaspersonaspresasacrcelescercanasasusdomicilios.
Caminarhacialacreacindepuentesmediadoresentreelsistemajudicial(jueces,fiscales,funcionariosde
prisiones) y los agentes educativoteraputico, foros de encuentro y de trabajo con estos agentes
institucionalesquetambinparticipanenlositinerariosdelaspersonasprivadasdelibertadysusfamilias,
conelobjetodeintercambiasexperienciasycriteriosdeintervencin.
Implantacin de Programas de Mediacin Extrajudicial para la bsqueda de reparacin del dao y
sustitutivospenales.
Caminarhaciaunarespuestaglobalizada.Laglobalidaddelascausasquellevanalapersonaadelinquiryle
conviertenenunapersonaprivadadelibertad,conllevaunaglobalidadenlasrespuestasdeintervencin
alternativas a la prisin y de las intervenciones realizadas dentro de prisin. Por ello, es necesaria la
bsqueda de soluciones globales desde el entramado social (instituciones y tejido social asociativo). El
origendelamayoradelassituacionespersonalesporlasqueatraviesanlaspersonasprivadasdelibertadse
encuentranenlasociedad.Noobstante,existeunaausenciadeconcienciasocialrespectoaestaspersonas
quesemanifiestanenactitudesderechazo,deciertorecelo,dedistancia,quenohacesinoampliarlas
distanciasentreellasyelentramadoderelacionessociales.Laigualdaddeoportunidadesenestesentidoha
depasarpordarnosnuevamenteunaoportunidaddesocializacin,rehaciendoelvnculosocial.Eneste
sentidoseentiendequeenlamedidaenquesearticulenmedidasquebusquenresolverlaproblemticadela
drogadiccindesdeunaperspectivaunilateralyglobal,losesfuerzosresultaninfructuosos.Elloconllevala
necesidadderealizarprogramasmultidisciplinares.
Solamenteesposibleunaintervencindentrodelrecintopenitenciarioconprogramasderehabilitacinsi
fueradelcentropenitenciarioseintervieneconprogramasalternativosalapenaprivativadelibertadycon
apoyosyseguimientosalentramadosociofamiliardelapersonaprivadadelibertad.Adems,claroest,con
unaactitudcrticahacialadesigualdadestructuralylaviolenciainstitucional.
22

SanzSanz,J;Lostratamientosconmetadonaenloscentrospenitenciarios,op.Cit.

Caminarhaciaplanteamientosdetrabajomultidisciplinaryglobal.Sirvanamododeejemplolaenumeracin
dealgunoscriteriosdetrabajo:Personalizacin:reconociendoacadaunoloquees,consusposibilidadesy
proponiendoitinerariosadecuadosacadapersonaysuscircunstancias.Atencinglobalizada:incidiendoen
losdiversosaspectosqueconfiguranlarealidadpersonaldecadauno.Atencinparticipativa:haciendoque
cadaunoseaprotagonistadesuplanpersonal.Porelloelprocesodenegociacindeuncontratoteraputico
comoinstrumentoparaarticularlaparticipacin(bsquedadelaabstinenciaodisminucindeconsumode
reduccinde riesgo, incrementode los hbitos de no consumo, cuidados fsicos, habilidades sociales y
empleo del tiempo libre, terapia y apoyo sobre dificultades psicolgica concretas). Atencin integral:
tomando en consideracin el conjunto de relaciones familiares y sociales que configuran a la persona.
Atencinregeneradoradevnculossocialesrotos:Facilitandolaintegracinsocialmediantemedianteunas
relacionesnormalizadas.

Captulo 4

TIPOS DE CRCELES Y RGIMEN DE VIDA

1. Por qu motivo se establecen diferentes clases de crceles?


La normativa penitenciaria impone la necesidad de establecer distintos regmenes de vida (cerrado,
ordinario, abierto) para que se puedan desarrollar con ms eficacia los diferentes tipos de tratamiento
penitenciarioatravsdelaconsecucindeunaconvivenciaordenadaypacficaquepermitaalcanzarel
ambienteadecuado(art.73RP).Labsquedadelordenydelaseguridadeslgicadebidoalaexistenciaen
cada prisin y en cada departamentos de numerosas personas obligadas forzosamente a convivir en un
espacioreducido.Cadargimendevidasecorrespondeconuntipodecrcel.

2. Resulta eficaz la existencia de diversos tipos de crceles?


La existencia de diversos tipos de crceles o de mdulos poco aporta realmente a una intervencin
recuperadora, debido a que tal pluralidad queda, de hecho, homologada por la comn configuracin
arquitectnica,porelgeneralizadoincrementodelnmerodemacrocrcelesenlasquesehiperdimensiona
laseguridadolvidandoeltratamiento(vulnerando,portanto,lapropiaLeyPenitenciaria),porelprogresivo
distanciamientodelascrcelesdelosncleosdepoblacin,yporlaescandalosayobjetivabledesproporcin
entre los recursos humanos y materiales empleados en la vigilancia, por un lado, y los dedicados a la
reinsercinsocial, por otro.Todoello,unidoa otrosfactoressociolgicosintrnsecos ala prisin, hace
difcilmenteconciliableelobjetivoeducativoysocializadorotorgadoconstitucionalmentealapena,conla
divisin y clasificacin de las crceles en diferentes tipos. Esta conclusin es generalizable con
independenciadelaclasedecrcelqueconsideremos.

3. Cules son los medios materiales de infraestructura que segn la Ley


Penitenciaria deberan estar dotados las crceles?
Segn la Ley Orgnica General Penitenciaria, los establecimientos penitenciarios se basan,
arquitectnicamente, en dos ideas esenciales: la construccin en horizontal y la celda individual, en
complejos de, a lo sumo, dos plantas de altura, realizados con materiales, funcionales y modernos,
debindose prestar atencin en su construccin a todas las actividades que desarrolla la persona presa,
partiendodelsupuestodequesushorassevanarepartirentreeldescanso,eltrabajo,eltratamiento,la
educacinylasactividadesrecreativas,deportivasoreligiosas,porloqueseexigequelascrcelescuenten,
enelconjuntodesusdependencias,conserviciosidneosdedormitoriosindividuales,enfermeras,talleres
amplios y ventilados, en zonas que no estn en contacto con dormitorios u otras salas comunes, con
dispositivoscontraincendios,patios,peluquera,cocina,comedor,locutoriosindividualizados,etc.(art.12,
13,14,19y52LOGP).
EnelReglamentoPenitenciarioseestableceelprincipiocelular,demaneraquecadapersonapresadebe
disponerdeunacelda,salvoqueporsusdimensionesycondicionesdehabitabilidadpermitan,preservando
laintimidad,alojaramsdeunapersona,apeticindelamisma,ocuandolapoblacinpenitenciariasupere
elnmerodeplazasindividualesdisponibles(art.13.3RP)siemprequenoexistanrazonesdetratamiento,
mdicasodeseguridadquelodesaconsejen(art.13.1RP).Esteartculoapenasvaatenereficaciaprctica,
porque,porunlado,comorealmenteocurreenlascrcelesespaolas,lasceldasestnocupadaspormsde
unaodospersonaspresas.Lascamassesueldanunasobreotrayseconviertenenliteras,demaneraque
celdas que estaban preparadas para una persona, son compartidas por varias. Los Jueces de vigilancia
penitenciaria muestran su preocupacin porque el principio celular que debera ser la regla general, se
presente como excepcin, y la excepcin de varios internos en la misma celda se presente como regla
(Criterio57reuninJVPenero2003).
Hayqueresaltarquelanuevalegislacin,enloscasosdeenfermedad,seguridadotratamiento,noprohibe
quesecompartanceldas,sinoquesimplementelodesaconseja.Esdecir,quesetratadeunacartablancapara
queladireccindelacrcelhagaloquequiera,sincontrollegalalguno.
De todas formas, cuando una persona presa sea obligada a compartir celda con otra que padezca una
enfermedadinfecciosaporenfermedad,oqueconsumadrogasportratamiento,debeinterponeruna
QuejaanteelJuezdeVigilanciaafindequeordenealadireccinquelecoloqueenunaceldaindividual,
todavezquelaadministracintieneeldeberdevelarporlavidaeintegridadfsicadelosreclusos,ascomo
evitartodamedidaregimentalquepuedaentorpecerlanormalizacinorecuperacindelaspersonas.
Deigualmanerahabraquerecurrirsiseobligaacompartirceldaconotrapersonaqueconsumadrogas,o

tengatalrelacindesuperioridadquepuedaatentarcontrasuintegridadfsica.
Loscentrospenitenciariostienesubdivisionesestructuralestalescomo:
Unidades:sonlasmayoresestructurasindependientesqueexistenenloscentrospenitenciariosque
suelenalbergargruposdeinternosquetienesituacionessimilares(preventivos,penados,mujeres).
Mdulos: Es la subdivisin de una unidad y que tiene espacios independientes en la que se
encuentranencerradoslospenadosquetienescaractersticassimilares(reincidentes,primarios,condestinos,
losquesalendepermiso,largascondenas,jvenes,,necesitadosdemayorobservacin,etc...)
Galeras:Sonloscorredoresopasillosquealberganlasceldas.

4. Qu tipos de crceles existen?


Las crceles pueden ser de preventivos, de cumplimiento y especiales (art. 7 LOGP). El Reglamento
Penitenciariode1996introducenuevostipos deprisionesy de unidadeso departamentos dentrode las
crcelespolivalentes;centrosdeinsercinsocial,unidadesdependientes,crcelesodepartamentosmixtos,
departamentos para jvenes, unidades de madres, unidades extrapenitenciarias y crceles psiquitricas o
unidadesdeestanaturaleza.Cadatipodecrcelydedepartamentotienediferentesfinalidades,estructuras
organizativasyregmenesdevida.Todasdebentenerlosserviciosgenerales,lasprestacionesadecuadaspara
cumplirlosfinesespecficosalosqueestndestinados,ylosobjetivosgeneralesdelsistemapenitenciario
(art.12.2RP).Enestesentido,enlaregla63delConjuntodeReglasaprobadasporlaResolucin663de1
dejuliode1957delConsejodeEuropa,seestablecelanecesidaddeestablecimientosadecuadososecciones
especializadassegnlascategorasdelosreclusos.

5. Cules son las caractersticas principales de las crceles de preventivos?


Soncrcelesdestinadasalaretencinycustodiadedetenidosypresospreventivos(personasenesperade
juicioodelafirmezadelasentenciacondenatoria).Enellas,tambinsepodrncumplirpenasprivativasde
libertadquenoexcedandeseismeses.Deberexistir,almenos,unacrceldepreventivosporprovincia(art.
8.1LOGP).

6. Cules son las caractersticas principales de las crceles de cumplimiento?


Estascrcelesestndestinadasa la ejecucin de las penasprivativas delibertad. Aligual quepara las
crcelesdepreventivos,eltextolegalestablecelaexigenciadequeloshombres,lasmujeresylosjvenes
estnseparados.
Se considera joven a las personas de uno y otro sexo que no hayan cumplido los veintin aos.
Excepcionalmente,yteniendoencuentalapersonalidaddecadapreso,podrnpermanecerdestinadosen
estas crceles o departamentos quienes habiendo cumplido los veintin aos, no hayan llegado a los
veinticinco(art.9.2LOGP).
Enlascrcelesdemujeresexistendepartamentosespecialesparalasmujeresqueingresenconniosqueno
hayanalcanzadolaedaddetresaos.LasUnidadesdeMadreshandetenerpersonalespecializadoun
especialista en educacin infantil, y un pediatra. En estas Unidades se han de programar actividades
formativasyldicas.Enellassegarantizarnlashorasdedescansoquelosniosnecesiten(arts.178181
RP).

7. En qu tipos de crceles se dividen las de cumplimiento?


Estascrcelessondetrestipos:dergimenordinario,abiertoycerrado(art.9.1delaLOGP).Sibieneneste
artculosolamentesehacereferenciaalosdosprimerostipos,lascrcelescerradasseregulanenelart.90.1
LOGP

8. Qu caractersticas tiene la vida en las crceles de rgimen ordinario?


Enlascrcelesdergimenordinario,lasfuncionesdeseguridad,ordenydisciplinatienensurazndesery
sulmiteenellogrodeunaconvivenciaordenada(art.76.1RP).Enestascrceles,segnlanormativa
penitenciaria,laspersonaspresassernseparadasenatencinalasnecesidadesoexigenciasdetratamiento,a
losprogramasdeintervencinyalascondicionesgeneralesdelacrcel(art.76.2RP).
Lamentablemente la realidad se distancia mucho de la legalidad. Los principios de orden, seguridad y
disciplinaestnhipervalorados,predominandodescaradamenteloregimentalsobreeltratamientoentodos
losrdenesdelavidacarcelaria,apesardequeelartculo73.2delReglamentosealequeestosprincipios
slosonmediosparaalcanzarunambienteadecuadoparaelxitodeltratamiento,ascomoquenosernun
obstculoparalaejecucindelosprogramasdetalcarcter.
Enlaprctica,lasactividades,suprogramacinyparticipacindependenconexclusividaddelrgimen.Con

todo,elprincipalobstculosedacuandoendeterminadascrcelesnoexistenactividadesdeestetipoo,
existiendo,sonmnimas.
No obstante, cuando se establezcan limitaciones a actividades de tratamiento donde las hubiera por
razonesregimentales,sepuedeinterponerQuejaanteelJuezdeVigilanciasobrelabasedelprincipiode
legalidaddefinidoenelartculo3delReglamento,enrelacinconel73.2delmismotextolegal.
Entodacrceldergimenordinarioexistenactividadesobligatorias(higieneyaseopersonal,limpiezay
ordendelacelda).Existeunhorariobase,quetienequesercumplidosportodos(art.25.1LOGP)ycuyo
incumplimientoconllevaconsecuenciasdisciplinarias:7.30iniciodelda.Hastalas8,laspersonaspueden
asearseyserealizaelprimerrecuento.Alas830seacudealcomedorparadesayunaryposteriormente,
hastalas1330serealizanlasactividadesoseestenelpatio.Alas1330seprocedealrepartodelacomida
yapartirdelas1430sevuelvealaceldayhayunnuevorecuento;enellaseesthastalas1630,momento
enquesevuelveasaliralpatiooserealizanactividades.Alas1930sevuelvealcomedoracenary
posteriormentehastalas2100enquesevuelvealaceldaseestenelpatio.Alas930serealizaotro
recuentoyalas0000seapagalaluz.

9. Qu personas presas van destinadas a las crceles de rgimen ordinario?


Aestascrcelesvandestinadasconcarctergenerallaspersonasclasificadasensegundogrado,lasque
hayan sido condenadas y an no estn clasificadas, y las detenidas que no estn en una crcel de
preventivos(art.74.1RP).

10. Puede concederse a una persona que se encuentre en rgimen ordinario


(2 grado) la posibilidad de acudir regularmente a un centro externo de
rehabilitacin?
S.Elart.117RPpermitealosclasificadosensegundogradodetratamientoquepresentenunperfildebaja
peligrosidadsocialynoofrezcanriesgosdequebrantamientodecondena,quepuedanacudirregularmentea
unainstitucinexteriorparalarealizacindeunprogramaconcretodeatencinespecializada,siempreque
esteseanecesarioparasureeducacinyreinsercinsocial.
ParaconseguirestassalidasacentrosexternossenecesitaquelaJuntadeTratamientoloplanifique.Estar
condicionadaaqueelpresoprestesuconsentimientoysecomprometaformalmenteaobservarelrgimende
vidapropiodelcentroexternocorrespondiente,ascomolasmedidasqueseestablezcanenelprogramaque,
en ningn caso podrn consistir en el control personal realizado por policas ni guardias civiles. Es
importantehacerhincapienlanaturalezanocontractualdeestassalidas.Decimosestoporqueenalgunos
centros penitenciarios estas salidas se formalizan a travs de un "contrato de insercin sociolaboral".
PensamosquelonicoqueelReglamentoexigeesunconsentimientopersonalyuncompromisoformal
(modelonmero17.b).
La duracin de estas salidas no ser superior a ocho horas, y se requerir la autorizacin del Juez de
Vigilancia.Sielprogramarequieresalidaspuntuales,laautorizacincorresponderalCentroDirectivo.
Laparticipacinenelprogramapodrserrevocadapordecisinvoluntariadelinterno,porincumplimiento
delascondicionesestablecidasoporcircunstanciassobrevenidasquejustifiquenladecisin.
Este supuesto puede ser utilizado para aquellas personas que se encuentren realizando, previamente al
ingresoen la crcel, programas de rehabilitacin de toxicomana en centros cerrados o en tratamiento
ambulatorio.Tambinpuedeaplicarsealosqueconposterioridaddecidaniniciarlo(hayquepresentarescrito
delcentroderehabilitacinquesecomprometaarealizareltratamiento),ocuandoseestsometidoaalgn
tipodetratamientoexternoespecializadoparalareinsercinsocialcursosprelaborales,talleres,etc.(vid.
entreotros,elAutodelJVPdeCastillaLennm.1de15deoctubrede1996yelAutodelJVPdeBilbao
de14deoctubrede1997).
ParalatramitacindelassalidasesnecesarioaportaralaJuntadeTratamiento,conlamayorbrevedad,una
peticin de art. 117 RP en el que conste las circunstancias personales y penitenciarias del preso, la
metodologayorganizacindelaactividad,ascomolosobjetivosaconseguir.Silapersonayaestuvieraen
esecentro/programaantesdelingresoenprisindeberanaportarseademslosinformesdeseguimiento.Si
laJuntadeTratamientorechazalaposibilidaddesalida,hayquerecurriralJuezdeVigilanciaPenitenciaria,
yaportartodaladocumentacin(modelonmero17.a).SielJuezlodenegasehabraquehacerunrecurso
dereformaanteelmismoJuezdeVigilancia(conelmismocontenidoperoponiendoenpartedearribaque
setratadeunrecursodereforma).Siestelovolvieseadenegarhabraquepedirabogadoyprocuradorde
turnodeoficiopararecurrirenapelacinalJuzgadooTribunalSentenciadoralaAudienciaProvincial.
Es muy importante dar seguridad y garanta de que no se va a quebrantar la condena. Por ello, es
fundamental que existan personas (familiares, educadores de barrio, amigos) que se hagan cargo del
seguimientodelpresoenlassalidas;adems,claroest,delcompromisodelcentroderehabilitacinde
realizarinformesperidicosdeevolucin.Estasgarantashayqueexpresarlas(oral)yformalizarlas(por
escrito)antealgunodelosmiembrosdelEquipodeTratamiento,oensucaso,anteelJuezdeVigilancia
Penitenciaria.

Enalgunasocasioneselcentropenitenciariodeniegalaconcesindeestassalidasporelhistorialdelictivode
la persona presa, la no aprobacin anterior de permisos de salida y el no aseguramiento de la escasa
peligrosidadsocialdelinterno.Contraestosmotivossepuedeargumentar,siguiendoelAutoAPBarcelona
seccin9de17demarzode2000,que"nielReglamentoPenitenciarioexigelaprimariedaddelictivadel
interno,nimuchomenosexigelaaprobacinpreviadepermisosdesalida,institucinqueningunarelacin
tieneconlaposibilidadreglamentariadelartculo117msalldesunaturalezapropia,aconsiderarcomo
otramedidadetratamientoconunafinalidadespecfica.Lavaloracindelperfildebajapeligrosidadsocial
debeponerseenrelacinconeldelitoodelitosporlosquecumplecondenaelinternoyconaquellosfactores
personalesydecomportamientoquepermitanrealizarunpronsticosobrelaadecuacindelprogramaalos
fines que le son propios. En tal sentido, es de desear que la propuesta formulada sea suficientemente
motivadaatravsdelosinformesdelEquipodeObservacinyTratamientopero,enelpresentecaso,la
ausenciadelosmismosnoesreveladoraensmismadequenosecumplaelrequisitomencionado,desde
queseinformalapositivaevolucindelinternoensucomportamientopenitenciario;comotampocoeldelito
porelquecumplecondena,dentrodelagravedaddelacontravencinquecomporta,puedeconsiderarseen
smismoreveladordealtapeligrosidad,almenosconlosdatosdequesedispone".
En algunos casos se ha aprobado, en va de recurso, la salida a una clnica para una mayor atencin
psicolgicaenbasealtratamientopenitenciarioencuantomedioparaconseguirlareeducacinyreinsercin
social,ascomolacapacidadparavivirrespetandolaLeypenal(art.59LOGP).Entrelosmediosposibles
estn las salidas programadas del art. 117 RP para la realizacin de programas concretos de atencin
especializadacuandoseanecesarioparasutratamientoyreinsercinsocial(Auto760/00APMadridseccin
5de7dejuniode2000).

11. Qu caractersticas tiene la vida en las crceles de rgimen abierto?


Losprincipiosdeordenydisciplinaquesehandeexigirsernlosnecesariosparaunaconvivencianormal.El
rgimendevidasecaracterizaporlaausenciadecontrolesrgidos(formaciones,cacheos,requisas,intervencinde
visitasycorrespondencia)pues,lopropiodeestergimeneslaconfianzaenlapersonapresa,ascomoelfomento
delaresponsabilidad(art.81.1RP).Paraello,sealaelReglamento,seatenuarnlasmedidasdecontrol,se
fomentarlaautorresponsabilidadmedianteelestmuloquesuponelaparticipacindelaspersonaspresasenla
organizacindeactividades,setenderaunanormalizacinsocialproporcionandoalapersonaatencinatravsde
losserviciosgeneralesdelacomunidad,serealizarnaccionesdeprevencinparaevitarladesestructuracin
familiarysocial,ysepotenciarlacoordinacinconorganismoseinstitucionespblicasoprivadasdeatencina
lospenados(art.83.2RP).Nosllamalaatencinqueellegisladorquieraprevenirladesestructuracinconlas
medidasdeltercergrado,cuandoestadesestructuracinfamiliarysocialdebeintentarprevenirse,conmsahnco,
desdeelmismomomentodeingresoenlacrcelconlapotenciacindelospermisosydelascomunicaciones.
Estasinstituciones,lamentablemente,siguenunapolticaexcesivamenterestrictivayseencuentranensuaplicacin
prcticamuyalejadasdelprincipiobsicodeevitacindeladesestructuracinfamiliarysocial,trminoquepor
olvidodellegisladordebeampliarsealmbitopersonal,afectivo,psicolgicoyemocional.
Dentrodelrgimenabiertosepuedenestablecerdistintasmodalidadesenelsistemadevida.Ellovaa
dependerdelaevolucinpersonaldelpenadoysuscaractersticas,delosgradosymediosdecontroldurante
lassalidasalexterior,ylasmedidasdeayudaquenecesiteparaatenderasuscarencias(art.84.2RP).
Lassalidasdelestablecimientoseregulanenelart.86RPenelqueseestablecequelaspersonaspueden
salirparadesarrollaractividadeslaborales,formativas,familiares,detratamientoodeotrotipoencaminadas
asuintegracinsocial(art.86,1RP),poruntiempoqueseconsiderenecesariopararealizarlaactividady
desplazamientos (art. 86.3 RP). Estas salidas tendrn que ser planificadas y reguladas por la Junta de
tratamiento, sealando los mecanismos de control y seguimiento que se consideren convenientes. Se
estableceuntiempomnimodeestanciaenlacrcel:8horas,salvoqueseacepteundispositivotelemticou
otrosmecanismodecontrolsuficientes(art.86.4RP).

12. En qu consiste el rgimen abierto restringido?


Existeunamodalidaddergimenabiertoquesedenominarestringidoqueseextiendehastaqueseencuentre
trabajo,sehaganinnecesariaslasrestricciones,oseconcedalalibertadcondicional.Laspersonasquese
encuentranenestergimendevidasiguencumpliendocondenaencentrosdergimenordinarioylanica
circunstanciapositivaquetienenesquepuedensalirdefindesemana(art.87RPycriterio37reuninJVP
2003),adems,claroest,depoderaccederalalibertadcondicionalcuandosecumplanlosdemsrequisitos.
Noobstante,enunainterpretacingramaticaldelanormareglamentariaypuestaenrelacinporrazones
sistemticasconlosapartados3art.82(lamodalidaddevidadeesteartculotendrcomoobjetivoayudar
alinternoaqueinicielabsquedadeunmediodesubsistenciaparaelfuturoo,ensudefecto,encontrar
algunaasociacinoinstitucinpblicaoprivadaparasuapoyooacogidaenelmomentodesusalidaen
libertad)y3(estamodalidaddevidaseasimilar,lomsposible,alosprincipiosdelrgimenabiertoa
queserefiereelartculosiguiente),nohabraproblemaenqueelpenadopuedasaliralabsquedade
empleo,oarealizaralgunasactividadesconcretasenelexteriordelacrcel,oenlaciudad,puestoqueeste

rgimenrestringelasituacindelrgimendetercergrado;yesarestriccinescompatibleconlassalidas,
esosmsrestringidasylimitadaseneltiempoquelosqueseencuentranentercergradonormal.Porotro
lado, la norma reglamentaria habla de salidas de fin de semana en vez de permisos, por lo que el
rgimendeconcesinesdistintounodeotro,porloquepuedenserlimitadasorestringidas,peronunca
anuladas;poresoseestablece,enlaprctica,laconcesindesalidasdefindesemanacada15das,como
mnimo,enfuncindelamodalidaddevidaestablecida,desuevolucineneltratamientoydelasgarantas
decontrolnecesarias(art.87RP).
Enlaprcticaselessueleadscribiraundestino(formativo,ocupacionalodemantenimiento),oseleincluye
enalgunaactividadteraputica,oselesconcedenalgunassalidasalexteriorparaactividadesconcretasyse
lesregulaunplandesalidasdefindesemana.
Estergimenrestringidoseaplica(art.83.1),segnlanormativapenitenciaria,aaquellaspersonasque
tienenunapeculiartrayectoriadelictiva(conductasdelictivasalolargodelavidaysuvaloracinrespectode
laposibilidaddecomisindenuevosdelitos),quecuentanconunapersonalidadanmala(trastornosmental
o psicolgico que genere una alta probabilidad de comisin delictiva) o poseen condiciones personales
diversas(drogodependencianotratada);asimismo,cuandonopuedantrabajarenelexterior(aunquesera
convenienteenestecasoquesefacilitelaposibilidaddebsquedadeempleooformacinlaboral,concursos
ytiempoparalabsqueda;enestesentidosemanifiestalaAudienciaProvincialdeMadridseccin5al
progresar a rgimen abierto a una persona con evolucin positiva con el nico inconveniente de tener
dificultades de insercin sociolaboral, debiendo ser la Junta de tratamiento quien disee las actividades
encaminas asolucionartalesobstculosAutode19dediciembrede2000)oloaconsejeeltratamiento
penitenciario(pensemosenpersonassometidasatratamientodedrogodependencias,aunque,claramente,en
este caso, puede aplicarse el rgimen del art. 182, para la continuidad del tratamiento en un centro
extrapenitenciario). Tambin se suele aplicar este rgimen restringido a quienes carecen de medios de
subsistencia;pero,enestecaso,debenpotenciarselassalidasparalabsquedadeempleoodemedioslcitos
devida(pensiones,apoyosyayudasdeasociacionesetc...)
Enestoscasos,laJuntadeTratamientopuedeestablecerlamodalidaddevidaadecuadayrestringirlas
salidasalexterior,estableciendolascondiciones,controlesymediosdetutelaqueseannecesarios(art.82.1
RP).
Ahorabien,laaplicacindergimenrestringidoesunaexcepcin,debiendoserelrgimenabiertopleno
normalelqueseaplique;demaneraquesilaevolucinespositivaporalabandonodeconsumosdedrogay
eldisfrutesinincidenciasdelospermisosdesalida,ademsdelapoyofamiliar,laprogresindeltercergrado
restringidoalabiertoplenodeberealizarseautomticamenteenelmomentoenquetengatrabajo(autoAP5
Madrid,de2dejuniode2000)yunavaldeacogidaensulugarderesidencia(AutoAP5Madrid,de31de
mayo de 2001). Esta regulacin, compuesta por conceptos jurdicos indeterminados, que se utiliza para
aplicarelrgimenabiertorestringido,puededarlugaradecisionesarbitrariaseinjustas.
Porque,Quseentiendeporpersonalidadanmala,oporcondicionespersonalesdiversas,oportratamiento
penitenciario?Anteestaregulacintangenrica,quedeporsgeneraunaenormeinseguridadjurdica,ya
findeevitarresolucionesinjustas,sehacenecesarioquelacrcelfundamentedeformaobjetiva,conhechos,
datos,circunstanciasconcretasysuvaloracincausalrespectodelaaltaprobabilidaddelacomisinde
conductas delictivas, de las razones por las que se ha aplicado el rgimen abierto restringido y no el
ordinario.EnestesentidosemanifiestaelAutodelJVPdeOviedode25dejuniode1996.
LaAudienciaProvincialdeLaRiojaensentenciade30..4.2001,estimaelrecursodeapelacininterpuesto
paralaprogresindeltercergradorestringidoalterceroabierto,aunapersonacondenadaa20aosde
prisinconbuendesempeodepuestosdetrabajoproductivo,realizacindecursosydestinos,permisos
disfrutadossinincidencias,observanciadebuenaconductaylogrodeobjetivospropuestos.Perofrentea
estosdatosexistenprdidasdecontrolyposiblesrespuestasagresivasasituacionesconflictivas,ascomoun
elevadotiempodecondena.Apesardeello,laAudienciaestimaelrecursobasndoseenuninformedel
psiclogodelaprisinenelqueseestableceque:lacontinuidadnaturaldelprocesodecontactoconel
mediolibreatravsdepermisosqueseprolongapormsdedosaosymedio,deberaserelaccesoaun
rgimendesemilibertadelquepermitasureintegracinsociolaboralconelestablecimientodeloscontroles
queestimennecesarios.Enconsecuencia,afirmaelauto,todavezquecuentaconofertadetrabajoycon
independenciadeltiempodecondenaquequedaporcumplir,elrgimenmsadecuadoeseldeltercergrado
(AutoAPLogroode30.42001)
Enelcasodelasmujeresclasificadasentercergrado,aunquenotengantrabajo,peropuedandesempear
laboresdomsticasensudomiciliofamiliar,selespuedeconcedereltercergradorgimennormal(art.82.2
RP).Ladudaquesenospresentaesestadistincinconloshombres,alosefectosdesalvarelderechoala
igualdaddelart.14delaConstitucinespaola.Enunainterpretacinanalgicapodraconcederseuntercer
gradoalhombrequenotengatrabajoperopuedadedicarseensudomiciliofamiliaralastareasdomsticas
(comida,limpiezaycuidadodeloshijosodelospadresmayores).

13. Quines van destinados a las crceles de rgimen abierto?


Aestascrcelesvandestinadaslaspersonasclasificadasentercergradoporestimarque,bieninicialmente,
bienporsuevolucinfavorableensegundogrado,puedenrecibirtratamientoenrgimendesemilibertad
(art.74.2RP).
Deformageneral,lasresolucionesdelCentroDirectivoselimitanaexpresar,sinmotivacinnifundamento
algunoquesemantieneenrgimenordinarioporlatipologadelictiva,laausenciadelrgimendepermisos
ylafaltadeparticipacinenprogramasdetratamiento.Enestecaso,sisepudieseacreditarquelospermisos
sesolicitaronperosedenegaron,quenoseofreciparticipacinenprogramaalguno,siadems,losmotivos
delainadaptacinqueexpresanenlaresolucindelcentropenitenciarioconstanenunmeroformulariosin
acreditacinnifundamentacindeningunodeellos,elrgimenabierto,enalgunaocasin,sehaconcedido
siconstapropuestadetrabajo,apoyofamiliaroasociativoyconstanaspectospositivosenelexpediente
(AutoAP1Crdobade30.4.2003).

14. Puede una persona clasificada en tercer grado no acudir a dormir al


centro de rgimen abierto en el que se encuentre destinado?
S,enaplicacindelart.86.4RP.EsunadelasinnovacionesdelReglamentode1996queprevqueunpreso
cuandovoluntariamentelosolicitenodeberpernoctarenlacrcelsiaceptaelcontroldesupresenciafuera
delacrcelcondispositivostelemticosadecuadosyproporcionadosporlaadministracinpenitenciaria,o
medianteotrosmediosdecontrolsuficientes,encuyocasosolamentedeberpernoctarenlacrcelduranteel
tiempofijadoensuprogramadetratamientoparalarealizacindeactividades,entrevistasocontroles.Esla
formadepotenciarlaautorresponsabilidaddelpenado,deatenuarlosmecanismosdecontrol,buscarla
normalizacineintegracinsocial,ascomoevitarladesestructuracinfamiliar.
Esindependientequeelsolicitanteestcondenadoapenascortasolargas.Essuficientequeestclasificadoen
tercergradodetratamientoyquedeseesuaplicacindemaneravoluntaria.Adems,lapropuestadebehacerseal
EquipodeTratamientoparaqueestudielosmediosdecontrolmsadecuados,enestesentidosemanifiestaelJVP
deBilbaoensusAutosde19demayode1997y8dejuliode1997.
Entreestoscabenlassiguientesopciones:visitasdeunprofesionaldelacrcelallugardetrabajouocupacin;
presentacindelapersonapenadaenunaunidaddelaadministracinpenitenciaria;presentacionesdelinternoen
dependencias policiales o Guardia civil, comunicaciones telefnicas en uno u otro sentido; comprobaciones
relativas a la documentacin de carcter laboral; controles sobre actividades teraputicas, entrevistas de
profesionalespenitenciariosconelpenado;entrevistasconlosfamiliaresdelpenado(I13/2001).controltelefnico,
garantaotorgadaporotrainstitucinocentroenelqueseencuentre,presentacinporlanocheyporlamaana,
informesdeseguimiento,etc.
Lospenadosquesesometanalprogramademonitorizacinelectrnicatienenquepasaruncontrolpresencialcada
quincedas.Sinoexisteesteprogramayseaplicanotroscontroles,almenosdosdasporsemanatienequehacer
actodepresenciaanteelCISyunodiarionopresencial(I13/2001).
Esterecursolegalpuedeutilizarsecuandoexistaunasituacinfamiliargrave,cuandosedunreingreso
motivadoporcausasjudicialesanterioresalaobtencindelalibertadcondicional,cuandosetrabajeporla
noche,cuandohayaque finalizarprogramasderehabilitacinenunidadesextrapenitenciariassinhaber
terminadodecumplirlacondena,porconvalecenciasmdicas,porlaasuncindecuidadoyatencindeuna
hijamenordeedadcuyacustodiafueasumidatraslaseparacinmatrimonial(I13/2001DGIP)y(AutoAP3
Gironade13.1.2000)...oanteotrassituacionessimilares.
Laacreditacindeestacapacidaddelinternodebeserlomsobjetivaposibleyrequiereunaevaluacin
detalladayglobalporpartedelaJuntadeTratamientoquedebetenerencuentalosfactoresdecarcter
personal,social,delictivoypenal(I13/2001).EstaInstruccinaportaclavesparaello:lapermanenciaenel
tercer grado de tratamiento durante el perodo mnimo necesario que permita valorar la capacidad de
autorresponsabilidaddelinternoenmedioabierto.Valoracinpositivaensuprogramaindividualizadode
tratamiento.Nohabercometidodelitodeespecialalarmasocial.Disponerdeunasituacinestablelaboral,
sociofamiliarypersonal.Podertenerunpronsticofavorabledereinsercinsocial.
Alasmadresconhijosselesaplicaunrgimenespecficoqueencuentrasujustificacinysuslmitesen
garantizarlaatencinintegralporpartedelamadreodelpadreenausenciadeaquellaaloshijosmenores.
Lamedida seaplicarsiemprequenoexistan,traslavaloracindelascircunstanciasdelamadre,otras
alternativaspreferiblesparalosinteresesdelmenorcomopuedesereldestinoaunaUnidaddependiente
especfica.Enestoscasosdebecomprobarsepreviamentequeelmedioenelqueseencontrarelmenor
cuentaconlasnecesariascondicionessocioeconmicasquegaranticensuatencin,ascomoquelamadre
poseelasadecuadascaractersticasdecapacidadyestabilidadpersonalparaello;estascircunstanciastienen
queacreditarseeninformessocialesypsicolgicos(I13/2001).
Lomismoocurreparalasconvalecenciasmdicas.Sejustificaporladebidaatencinalderechoalasaludde
losinternosrecogidoenelart.3.4LOGP.
Sufinalidadespermitiralpenadoentercergradolarecuperacinensudomiciliodeunaenfermedado
intervencinquirrgica, siemprequelasmismasnopuedanllevarseacaboconlasmismagarantasenla

crceldedestino.Parasuacreditacinesnecesarioelinformeocertificadomdicooficial,avaladoporel
mdicodelacrcel,enelqueconsteelpronsticoinicialdelaconvalecenciaylosplazosparasurevisin(I
13/2001).
Elprocedimientoparaaplicaresteart.86.4ypernoctarfueradelcentropenitenciarioeselsiguiente:laJunta
deTratamientodeoficiooapeticindelpenadoelaboraruninformepropuestamotivadoenelqueconstela
motivacinespecfica,laposibleduracindeterminadadelamedida,informesespecficos(mdico,socialo
psicolgico) relativos al caso concreto; dispositivos de control, medidas de tutela a aplicar y forma de
seguimientodesucumplimiento.LaresolucinfinalseradoptadaporlaDireccinGeneraldeInstituciones
Penitenciarias(I13/2001).Estamedidaserrevisadacadatresmeses.Sisobrevienencircunstanciasque
suponganunriesgodequebrantamiento,malusoocomisindenuevodelito,eldirectorpodrsuspender
provisionalmentesuaplicacinhastalacorrespondienteresolucin(I13/2001).

15. Qu caractersticas tiene la aplicacin de dispositivos de localizacin


telemtica?
VienenestablecidasenlaInstruccin13/2001delaDireccinGeneraldeInstitucionesPenitenciarias.Quien
quierasometerseaestetipodecontrol(art.86.4RP)tienequetenerensudomiciliolainfraestructurapara
queelpersonaldesignadoinstaleeneldomiciliodelinternoelreceptordesealascomoeltransmisorensu
persona(enlamuecaoeneltobillo).Enningncaso,nicuandoseestdepermisosepuededesinstalar,
salvoquesepidavoluntariamentelabaja.Elpresodebeaceptardeformaexpresaelsometimientoalas
condicionesdeaplicacindelosdispositivostelemticosynopuedecambiarsededomicilionidenmerode
telfono,sinprevioaviso.Tambintienequeprestarelconsentimientoparaqueelpersonaldesignadoenel
programaaccedaaldomicilioparalainspeccin,reparacinoretiradadecualquieradeloselementosdel
equipotcnico.Elinternoserresponsabledelusoycuidadodeloselementostcnicosysielaparatosufre
algndaotienequenotificarloinmediatamentealosencargadosparasuseguimiento.
Eltiempodepermanenciaobligadaenellugarquecorrespondasercomonormageneralde8horas,salvo
queporrazonesdetratamientoestetiemposeainferior.Duranteelrestodelajornadadiaria,elinternotiene
quesometersealasactividadesprevistasensuprogramaindividualdetratamientoenelmbitolaboral,
formativooasistencial,ascomoaotrasmedidasdeseguimientoprevistaparcadacaso(analticas,visitasal
lugardetrabajo,controlespresencialescadaquincedas).Paralaaplicacindeestesistema,laJuntade
Tratamiento,alavistadelosestudiosllevadosacaboporelEquipotcnicosobreelinternoysusituacin
sociofamiliar,elevarpropuestaalasubdireccingeneraldegestinpenitenciaria.sta,unavezvalorados
todoslosfactoresconcurrentes,comunicaralacrcellaconformidadoeldesacuerdoconlamedida.

16. Qu tipos de crceles de rgimen abierto existen?


Estas crceles pueden ser: Centros Abiertos o de Insercin Social, Secciones Abiertas y Unidades
Dependientes(art.80.1RP).

17. Qu son los Centros de Insercin Social?


Soncrcelesdestinadasalcumplimientotanto,delaspenasprivativasdelibertadenrgimenabierto,como
delaspenasdearrestodefindesemana.Tambinsondestinadasalaejecucinyseguimientodecuantas
medidaspenalesalternativasalaprivacindelibertadseestablezcanenlalegislacinpenal,cuyaejecucin
seatribuyaalosservicioscorrespondientesdelMinisteriodeInterior.Tambinsededicarnalseguimiento
delosliberadoscondicionalesquetenganadscritos(art.163.1RP).Enestasdependenciassuelenexistirdos
modalidadesdevida:1)acogida,quevadesdeelingresohastalaprimerareunindelaJuntadetratamiento.
Enellalapersonapenadanopuedesaliralexterioryademsdeinformarledelprogramadeintervenciny
delsistemadefases,seevalasusituacinpersonalyseleofrecefirmaruncontratoconductual.2)Rgimen
abiertoprogresivoquevadesdeelsistemarestrictivohastalaintegracinplenaenlaquelasactividadesenel
exteriorsondominantessalenatrabajardiariamenteylosfinesdesemana;seleconcedeestaposibilidad
cuandosehacomprobadoquetienetrabajoenelexterior.LaJuntadetratamiento,atravsdeleducadory
deltrabajadorsocialrealizanelseguimientodeesasactividadesextrapenitenciarias,conllamadasalcentro
detrabajo,convisitas,entrevistas,analticasparadetectarconsumosdedrogastxicas.Lassalidasdefinde
semanasern,normalmente,desdelas1600delvierneshastalas800dellunes,ademsdelosdasfestivos.
EstassalidaspuedentenerotroshorariossiloapruebaelCentroDirectivo.Suregulacinserrealizada,de
formaindividualizada,enfuncindelamodalidaddevidaestablecidaparacadapersona,desuevolucinen
eltratamientoydelasgarantasdecontrolnecesarias(Art.86.4RP).

18. Qu son las Secciones Abiertas?


Son departamentos que existen dentro de las crceles polivalentes destinados a presos de tercer grado
preferentementeenrgimenabiertorestringido.Enestasdependenciasseestablecenlasfasessimilaresalas
existentesenloscentrosdeinsercinsocial.Enestasseccionestambinsepuedendesarrollarlasactividades
delrgimenabiertorestringido.
Los Jueces de Vigilancia penitenciaria propusieron en su reunin de 2003 (criterio 24) la creacin de
seccionesodepartamentosdergimenabiertoentodaslasprovinciasafindeevitarperjuicioalosinternos
que,porsuscondiciones,podranestarclasificadosentercergradoydisfrutardeunaactividadlaboral.En
lugardelasseccionesabiertasseproponealaDireccinGeneraldeInstitucionesPenitenciariaslacreacin
deCentrosdeInsercinSocialalejadosdelcentropenitenciarioydebidamentedotadosdemediospersonales
ymateriales.

19. Qu son las Unidades Dependientes?


Son unidades ubicadas fuera del recinto de las crceles, en viviendas normales, sin distincin externa,
gestionadasporasociacionesprivadas.Tienenvinculacindirectaconlaadministracinpenitenciariaque
participarenlastareasconpersonalpropio;adems,ejercerelcontrolquelecompete.TodaslasUnidades
Dependientesdeberntenernormasdefuncionamientointerno,ascomodeorganizacinyseguimiento
destinadasalcontroldelfuncionamientoporpartedelaadministracinpenitenciaria.Laspersonaspresas
quepuedenserdestinadasaestasUnidadesdebenestarclasificadasentercergradoydebenserseleccionadas
por la Junta de Tratamiento. Estos casos deben ser puestos en conocimiento del Juez de Vigilancia
Penitenciariaporpartedeldirectordelacrcel(arts.166167RP). Enlarealidadprcticalasquems
predominansonlasdemujeresconhijos,ascomoenfermosdeSIDAyparaestudiantesdelaUNED.

20. Puede una persona cumplir el tercer grado en un centro de rehabilitacin


de drogodependencias?
S,enaplicacindelart.182RPquepermitealaspersonasclasificadasentercergradoquepresentan
problemas de drogadiccin y que necesiten tratamiento especfico, la posibilidad de que la condena se
cumplaeninstitucionesextrapenitenciarias.Sielproblemaprincipalparalaevolucineneltratamientoesla
drogodependenciayassehaceconstarenelexpedientepenitenciarioatravsdeanalticaspositivasatales
sustancias,ynoconstaningndatoms queevidenciaunamalaevolucinrespectodelosfactoresdel
tratamientopenitenciario,selepuedeclasificarentercergradorgimenrestringidoysupeditadoalingreso
enunCentroderehabilitacindedrogodependientes;elloconlacondicinderegresinasegundogradosi
loabandonaraofueseexpulsado.(AutoAP,Madrid5de15denoviembrede2000)
HayquesolicitarlaexcarcelacinalEquipoTcnico(subdirectordetratamiento)acompaadodeuninformedel
centroderehabilitacinenelquevaaingresar.Ellopuedehacerse,comoyaseexplic,solicitndoloenlaprimera
clasificacin,orecurriendoelmantenimientoensegundogradoanteelJuezdeVigilanciaPenitenciaria(Modelos
nmeros9.a,11,12).Noobstante,podrasolicitarselaprogresinatercergradoparalaexcarcelacinauncentrode
rehabilitacinencualquiermomentosintenerqueesperaralareclasificacin,todavezqueeltiempomximopara
quelaJuntadeTratamientoestudieindividualizadamentealospenadosesdeseismeses,peronoexisteobstculo
legalalgunoparaquesearealizadoantesdeeseplazo.
Paralaconcesindeestaexcarcelacinsevaloraconvenientementelabuenaconducta,laparticipacinen
actividadesdetratamiento,culturales,deportivas,ylamuestradeintersymotivacinparaeltratamiento
(AutosdelJVPdeBilbaode11deseptiembrede1997y23deoctubrede1996).

21. Puede una persona ser clasificada inicialmente en tercer grado -art. 182
RP- para continuar un programa de tratamiento?
S.Enocasiones,personasqueseencuentraningresadasenCentrosderehabilitacindedrogodependientes
tienenquecumplircondenaspordelitoscometidosconanterioridadaliniciodelprogramaderehabilitacin.
Esestassituacionesesmuyimportantequelaprimeraclasificacinseaentercergradoparaquecontineel
tratamiento(art.182RP).
Legalmenteesposiblelaclasificacininicialentercergradoencualquieradesusmodalidades.Comoquiera
quehayqueatenderalespritudelaLeypenitenciariaenelquelareinsercinsocialatravsdeltratamiento
eselcriterioprincipalparalaadopcineinterpretacindelanormativapenitenciaria,pensamosquelo
conveniente para no interrumpir el tratamiento terapias de grupo, trabajo de sentimientos, actitudes,
responsabilizacin, construccin de red social o bsqueda de empleo es la continuacin en el
centro/programaderehabilitacin.Silapersonasevieraobligadaaingresarenrgimenordinariodentrode
unacrceloinclusoenuncentrodeinsercinsocialenrgimenprevistoenelart.82.1RPtendraqueira
dormiraprisin,convivirconpersonasqueestnconsumiendodrogas,rupturadelclimateraputicodel

centroenelqueseencuentra,someterseacontrolespenitenciariosdiariosy,portanto,veradificultadoel
tratamientoiniciado,hechoquecontradiceelespritudelaLeypenitenciariaydelaConstitucin(art.25.2
CE). En todo caso, el Centro de rehabilitacin debe informar mensualmente al Centro penitenciario de
referencia(Auto1479/98APMadridseccin5de16dediciembrede1998).
Estoscentroseducativosydetratamientodedrogodependenciasnotienenporquesercerrados,aunqueenla
prcticasevengaexigiendoestacircunstancia.Noobstante,pensamosqueseraposibleestarsometidoaun
programadetratamientoqueensusprimerasfasesfuesetratamientoambulatoriosiporrazonesteraputicas
seestimamsconveniente,puesesteeselfundamentoesencialdeestaalternativa.Entodocasosetieneque
exigir que el centro de rehabilitacin se comprometa en la acogida del interno, a disear un programa
teraputicoespecficoyacomunicarcualquierincidenciaqueseproduzca.
En la I 20/96 se establecen los pasos administrativos a seguir en estos casos. Salvo que lo autorice
directamenteelJuezenvaderecurso,lapropuestatienequevenirporpartedelaJuntadeTratamientodel
centropenitenciariocorrespondiente.Enesapropuestadebenconstartodaslascircunstanciasqueacrediten
la conveniencia de esta medida y el consentimiento de la institucin y el penado. El Centro Directivo,
autorizar,onoelingreso;siempreloharsieselJuzgadodeVigilanciaPenitenciariaquienloautoriza.
Traslosoportunoscontactosconlainstitucinenlaoficinadergimenseprocederalaanotacinenel
expedientepersonaldeldadelasalidayapartirdeestemomentoseiniciaelplandeseguimientoycontrol
convenido(entrevistasoinformes).

22. Qu ocurre si una persona est clasificada en tercer grado y continua en


un mdulo de rgimen ordinario?
Puedeocurrirqueunapersonaestclasificadaentercergrado(restringidoonormal)yestubicadoenun
mduloogaleradergimenordinario.Estasituacinesilegal.
Eltercergradodeterminalaaplicacindelrgimenabiertoencualquieradelasmodalidades(art.101.2RP)a
fin de que pueda continuar el tratamiento en semilibertad (art. 74.2 RP). De manera que una persona
clasificadaentercergrado(bienseargimenrestringido,onormal)nopuedeestarubicada,enningncaso,
enmdulosdecumplimientoordinario.Debenestardestinadasenalgunodeloscentrosdergimenabierto
sealadosenelReglamentoPenitenciario,preferentementeenlosCentrosdeInsercinSocial(AutodelJVP
deOviedode10dejuniode1996).
SiestasituacinocurrierahayquehacerunescritodeQuejaalJuezdeVigilanciaysolicitarsertrasladadoa
unCentrodeInsercinSocial,oaotrainstitucinreglamentariamenteestablecida(modelonmero18).

23. Las personas extranjeras pueden acceder al rgimen abierto?


S, no existe obstculo legal alguno. Necesitan los mismos requisitos que las personas de nacionalidad
espaola.Apartirde la reforma del cdigo penal(L0 11/2003), lospenadosextranjerosqueno tengan
residencialegalenEspaayqueseencuentrencondenadosapenasigualesosuperioresaseisaos,cuando
selesclasifiqueentercergrado,puedenserexpulsadosdelterritorionacionalsienlasentenciacondenatoria
constalasustitucindelapenadeprisinporlaexpulsin(art.90CP)

24. Qu modalidades de rgimen de vida existen en el rgimen cerrado?


Dentro del rgimen cerrado se establecen dos modalidades segn las personas presas sean destinadas a
departamentosespeciales,o,acrcelesomdulosdergimencerrado(art.91.1RP).
a)Departamentosespeciales:Aestosdepartamentosserndestinadaslaspersonaspresasquehayansido
protagonistasoinductoresdealteracionesregimentalesmuygraves,quehayanpuestoenpeligrolavidao
integridaddelosfuncionarios,Autoridades,otrosinternosopersonasajenasalacrcel,tantodentrocomo
fueradelamisma,ascomolosqueevidencienunapeligrosidadextrema(art.91.2RP).Estasalteraciones
tienen que quedar fundamentadas y probadas con hechos para poder realizar la aplicacin del rgimen
cerrado,puesdelocontrarionosepodraplicar(AutoAPMadrid,5,de29dejuliode2000).
Laspersonasenestergimendevidatendrn,comomnimo,treshorasdiariasdesalidaalpatioque
podrn ampliarse hasta tres horas ms para la realizacin de actividades programadas. Diariamente las
personasserncacheadasysusceldasseregistrarn.Cuandoexistanfundadassospechasdequelapersona
poseeobjetosprohibidosy,adems,existanrazonesdeurgencia,losfuncionariospuedenrecurriraldesnudo
integralporordenmotivadadeljefedeservicios,dandocuentaaldirector.Enlassalidasalpationopueden
permanecermsdedospersonasjuntas,pudiendoaumentarsehastacincoparalarealizacindeactividades.
Lasvisitasdelosmdicossernperidicas.
Se disearn, segn el Reglamento, modelos de intervencin y programas genricos de tratamiento

destinadosalaprogresivaadaptacindelpresoalavidaenrgimenordinario(art.93.1RP).Esnecesario
que el Juez de Vigilancia Penitenciaria visite peridicamente los departamentos de aislamiento y a las
personasqueallseencuentranparapoderconocerlasituacinreal(AutoAPPalenciadede2.1.2001).
Ennuestraopinin,laaplicacindeestanormativagenerasituacionesdetorturapsicolgica,motivadas
porlaincomunicacinconotraspersonas,porlasoledad,porlaviolacincontinuadelaintimidadyporla
humillacinquesuponelaprcticarutinariadecacheoscondesnudointegral.Aesterespecto,nodeberaser
suficientelaautorizacindeljefedeserviciosparauncacheocondesnudointegral,todavezqueelderecho
fundamentalalaintimidadyaladignidaddebenexigirunplusdecontrol.Lamentablemente,estaregulacin
legalvaafacilitarabusosdepoderporpartedealgunosfuncionarios,almargendelcontroljurisdiccional.
Porotrolado,nollegamosaentenderlarazndelcacheodiarioalaspersonasyelregistrodelasceldas.Por
unlado,suponereconocerlaincompetenciadelosfuncionariosquelaspracticaroneldaanteriordebidoala
incomunicacinabsolutaquetieneelaisladoconelrestodelospresos;yporotro,parecequeelobjetivo
ltimoesaumentardeliberadamenteelcastigo,lasoledad,lahumillacinyeldolorqueyasupone,pors
mismo,elaislamiento.Entendemosquelanormativadelart.93.2RPesinconstitucionalalestablecerun
cacheodiario,juntoconlaposibilidaddequeserealicesobrelanicaexistenciade"fundadassospechas"en
lugarde"motivosconcretosyespecficosyrazonescontrastadaseindividuales"(art.68RP),ascomoporla
previsindelcacheocondesnudointegralcomoformaextremadelesindelderechoalaintimidad,sinla
msmnimaapoyaturalegal.ComosealaelDefensordelPueblo"...elart.93.2delRP.ignoralosrequisitos
delTribunalconstitucionalalahoradeconsideraradmisiblesenderechoyajustadasalaConstitucinlas
medidas de registro personal con desnudo integral. p. 51 (DEFENSOR DEL PUEBLO "Situacin
penitenciariaydepsitosmunicipalesdedetenidos:19881996"ServiciodePublicaciones1997).
Porello,hayquesolicitaralosJuecesdeVigilanciaqueinapliquenelart.93.2RPporsercontrarioala
Constitucinenbasealart.6LOPJ(modelonmero21.b).Lomismohabraquedecirsobrelosregistrosen
celdadiarios(modelonmero.21.c).
Amayorabundamiento,lanuevaregulacinesunretrocesorespectodelReglamentoanteriorencuanto
quelasvisitasdelmdicoyanoserndiarias,sinoperidicas.
Laaplicacindeestanormativapuedevulnerarlosartculos10.1,15y25.2CE,elartculo1LOGPyel
artculo2 RP que establecen: el derechoa la dignidad, a la intimidad, y a la reinsercin social de los
condenados.Esms,comosealaelDefensordelPueblo,"laregulacinreglamentariadelrgimendevidade
losdepartamentosespecialeshaignoradoquesonlosinternosenprimergradoaquellosque,detodoelsistema
penitenciario,precisandemayoresfuerzodelasAdministracionesPblicasparahacerrealidadlaorientacin
quealaAdmnpblicaimponelaConstitucinespaola.p.50
DEFENSOR DEL PUEBLO "Situacin penitenciaria y depsitos municipales de detenidos: 19881996"
ServiciodePublicaciones1997.
b)Crcelesomduloscerrados: Aestascrcelesserndestinadaslaspersonaspresasquemuestrenuna
manifiestainadaptacinalosregmenescomunes(art.91.3RP).
Laspersonasdestinadasenestascrcelesomdulostendrn,comomnimo,cuatrohorasdiariasdevida
encomn,quepodrnseraumentadashastatreshorasmsparalarealizacindeactividadespreviamente
programadas.
La regulacinconcreta se establece enla Instruccin 21/96 Paraelcontroldepresosespecialmente
peligrososyconflictivosseintensificanlosmecanismoscontroladoresllegando,ensusconsecuencias,hastala
negacinabsolutadelaintimidady,portanto,deladignidad:

Almenosdosvecesporsemanaseregistrarntodasycadaunadelasdependenciasdelacrcely
diariamentelasqueseconsiderenvulnerablesporlosinternosquelasalbergan.

Inspeccionesocularesperidicas.

Datosdiariosaljefedeserviciosobrecacheosrealizados(adiario),actitudes,relacionesconotros
internos,incidentes.(Esosdatossecomunicandiariamentealasubdireccindeseguridad).

Cambiosperidicosdecelda.

NopuedenestardospresosFIESenunamismacelda,nisituadosendoscontiguas.

Lasrondasnocturnasdebernhacerserespetandoladignidaddelapersonapresaylashorasde
descansonocturno.Tienenquellevarseacaboconlaperiodicidadqueseconsidereadecuada,enfuncindelos
distintostiposdergimenFIES,enunintervalonosuperioraunahora.Surealizacinylasnovedadesque
pudieranproducirse,debernserregistradasenunlibroatalfin,quesecustodiarenlajefaturadeservicios.
Nossorprendequeseestablezcalanecesidaddequeseobserveelrespetoaladignidadylashorasdedescanso
descripcinformaldequelaprcticadecontrolsehaceconformealalegalidadyposteriormenteseseale
quelosintervalosnuncasernsuperioresaunahora.
Quentiendenpordignidadloslegisladorescarcelarios?Estasituacinsuponelanegacinmsabsolutadela

intimidad:21horasenceldasiestnclasificadosenprimergrado,cambiosdeceldacontinuos,cacheosdiarios,
ycontrolnocturnocadahora.Comoyafundamentaremosmsadelanteestasituacinsuponelavulneracindel
derechoaladignidadyalaintimidad.
En caso de que las comunicaciones estn intervenidas, las cartas, tanto de entrada como de salida, se
fotocopiarntodoslosdasyseremitirnalaCoordinacindeSeguridad.Existeunanormativainternaque
disponequecuandotranscurranmsde15dassinquelaCoordinacindeSeguridadhayacontestadosed
trmitealasmismas.Loquequieredecirquelascartasserecibenalmenoscon15dasderetrasosobreelda
enquehanllegadoaprisin.Estaintervencin,enlamayoradeloscasos,esportiempoindefinido.Seva
renovando trimestral o mensualmente, aunque no haya existido novedad alguna durante el tiempo de la
intervencin. Parapodercomunicarconamigosporlocutoriogeneral,lospresosFIEShandesolicitar
autorizacinquesecursaatravsdelaCoordinacindeSeguridad(DGIP),enlaqueseindicarnnombrey
apellidos,ascomoelDNI.Estasolicitudtardaensercontestadaentremesymedio,ydosmeses.Unavez
recibida lacontestacin de la Coordinacin de Seguridad, se les autoriza una comunicacin durante un
perododetresmeses,yencasodesertrasladadosdecrcel,laautorizacinpierdelavalidez.Seestablece,
adems:uncacheoalaentradaysalidadesucelda,cacheoyrequisadiariadelasceldas,colocacindel
internoalfondodelaceldaconlasmanosvisiblescadavezqueentreelfuncionario,salidaindividualdela
celdaacompaadodedosfuncionarios,ropayenseresparausodiario,autorizacindetelevisindesu
propiedadylacomidaselepasaporunpasabandejassinabrirlapuerta,

25. Qu ocurre con la planificacin y desarrollo de actividades en los centros


y mdulos de rgimen cerrado?
Enmuchascrcelesnoexisteinfraestructuraparalarealizacindeactividades,nitampocovoluntadrealde
ponerlasenprctica.Enalgunoscasos,laexistenciadeactividadesculturalessejustificaconlapresenciaen
lasceldasdelmaestrotresdasporsemana,yladeactividadesdeportivasporlaexistenciaenunasalade
algunaespalderaycolchoneta.Ahorabien,noexisteniinfraestructura,niprogramacinculturaladecuada
comoparapropiciareldesarrolloporpartedelospresosdeactividadesformativasydeocio.Alospresosse
lesniegalaposibilidaddeacudiralospolideportivosaduciendomotivosdeseguridad;sinembargo,carecen
derecintocubiertoalquepuedanaccederparahacerdeporte,contandoexclusivamenteconpatiosabiertos.
Esteproblemaseagravaenpocadeinvierno,dondelastemperaturasylaslluviashacenimprescindiblela
existenciadeestospatioscubiertos.Estasituacinhaceempeoraranmslasituacindeincomunicacin,ya
deporsgravosa;yhacenrestringirelrgimendevidadelyarestringidoprimergrado.
Esta situacin ha sido denunciada por el Defensor del Pueblo. En reiteradas ocasiones ha sealado la
conveniencia(particularmenterespectodeestosinternos,sometidosaintensosperodosdesoledadencelda
yenlosquelaconcurrenciadepatologasdendolepsquicasepresentaconmayorfrecuenciaeintensidad),
y al tiempo, se les ofrezca tratamiento a cargo de profesionales de la salud mental. Sin embargo, las
previsionesreglamentariasnosuponenningunaespecficavinculacinparalaadministracin,limitndosea
sealarquelosserviciosmdicosprogramarnlasvisitasperidicasaesosinternos,informandoaldirector
sobresuestadodesalud1
AlgunosJuzgadosdeVigilanciaPenitenciariaobliganalosresponsablesdelascrcelesahaceralgunas
modificaciones de infraestructura y de programacin de actividades. As, por ejemplo, el Juzgado de
Vigilancianm.1deMadridobligaalosresponsablesdelacrceldeMadridVaquehabilitenelrecinto
cubierto e instalen material adecuado para que los internos puedan utilizarlo como gimnasio pues el
departamentocarecededichadependenciaynocabeconsiderarquelasespalderasylascolchonetasquehay
enlasaladedadotenaestahabitacindelcarcterpropiodeungimnasio...PorotraparteelcentroDEBE
programaractividadesculturalesydeocio,conlaparticipacindeinternoshastaunmximodecinco;
mensualmentedeberinformaralJuzgadodelasactividadesprogramadasydelospresosqueparticiparnen
lasmismas(Autode1deoctubrede1997);consimilarfundamentacinlosAutosdelJVPdeOviedode16
demarzode1995yde17deabrilde1996,yeldelJVPnum.2deCastillaLende26dejuniode2000,yel
deJVPnum.1deValladolidde13dejuniode2000.EnelmismosentidosemanifiestaelautodelJuzgado
de Vigilancia de A Corua de 13 de marzo de 2000: "la junta de tratamiento deber programar ms
actividadesculturales,deportivas,recreativasoformativas,laboralesuocupacionalesquesesometernala
aprobacin del Consejo de Direccin. Igualmente se deben incrementar el nmero de horas para la
realizacindeactividadesprogramadasdelosinternosenlosdepartamentosespecialesymdulosocentros
cerrados por considerarse insuficientes las existentes actualmente. Conforme al art. 77 del Reglamento
Penitenciario, elvese propuesta a la Direccin General de Instituciones Penitenciarias instando que se
cubran las plazas vacantes de funcionarios del Centro penitenciario de Texeiro, especialmente las de
monitores,alrepercutireneltratamientodelosinternos,enconcreto,losquecumplenprimergrado".En
estemismosentidosemanifiestaelAutodelJVPValladolidde28/10/99alexpresardesdemitomade
posesinmehabahechopercibirdirectamentequelosinternossometidosaestergimendevidanies

posiblequesereeduquenniseresocialicen,yelloengranparteporqueeltratamientoindividualizadonose
puedellevaracabosinoseamplanloshorarioslaadministracinpenitenciariaestobligadaadesignarel
personalnecesarioalosfinesexpuestosenelautorecurrido.Hayquesolicitareldiseodetratamiento
individualizadoalsubdirectordetratamiento(modelonmero20.a);sisedeniegahayquehacerunrecurso
alJuzgadodeVigilanciaPenitenciaria(modelonmero20.b)..

26. Se pueden suspender las tres horas de actividades los fines de semana?
Elhorariodeactividadesparalaspersonasqueestnenestergimencerradonopuedesuspenderselosfines
de semana. En algunas crceles, las horas de patio se cumplen, pero las dos o tres que se tienen de
actividades se suspenden porque, segn se alega por parte de la crcel, no hay personal suficiente. El
reglamentonohacerestriccindehorarioslosfinesdesemana;esms,elart.93.1.6RPsealaquese
designarelpersonalnecesarioatalfin(AutodelJVPdeOviedode25dejuniode1996).Porello,encaso
de que esto ocurra hay que hacer un escrito de queja al Juez de Vigilancia Penitenciaria y solicitar el
cumplimientodeesashorasdeactividades(modelonmero19).

27. La normativa reglamentaria relativa al diseo de actividades genricas de


tratamiento, puede ser nula de pleno derecho?
S,porvariosmotivos:
a)SegnelReglamento,lacrceldebeaplicarmodelosdeintervencinyprogramasgenricosde
tratamientodestinadosalaprogresivaadaptacindelpresoalavidaenrgimenordinario(art.93.6RP).
Estanormativareglamentaria,segnelDefensordelPueblo,escontrariaalesprituyalaletradelaLey
OrgnicaGeneralPenitenciariaqueimponequelosprogramasdetratamientodirigidosalosinternoshande
serindividualizados,yprecisamenteenfuncindestos,habrndeestablecerselasprevisionesregimentales
queaseguranelbuenxitodeltratamiento.
Laintervencindelaadministracinenestetemanoespotestativa,sinoimperativatodavezqueelmandato
del art. 25.2 CE cuyo contenido se concreta en el art. 1 de la LOGP determina que las instituciones
penitenciariasreguladasenlapresenteleytienencomofinprimordiallareeducacinylareinsercinsocial
delossentenciadosapenasymedidasprivativasdelibertad. Paragarantizarestederechoelart.4RP
establececomoderechoaltratamientopenitenciarioyalasmedidasqueseprogramenconelfinde
asegurarelxitodelmismo.Eltratamientopenitenciario,segnvienedefinidoenlaLeyOrgnicaGeneral
Penitenciaria,eselconjuntodeactividadesculturales,educativas,deportivasyteraputicasencaminadasala
consecucin de los fines de reeducacin y reinsercin establecidos constitucionalmente para las penas
privativasdelibertad(arts.59yss.LOGP).SegnlaLeyOrgnicaGeneralPenitenciaria,eltratamiento
pretendehacerdelpresounapersonaconlaintencinycapacidaddevivirrespetandoalasociedad.Para
ello, se procurar desarrollar y potenciar en las personas presas actitudes de respeto a s mismos y de
responsabilidadindividualysocialrespectodesufamilia,elprjimoylasociedadengeneral(art.59
LOGP).
Elhechodeestarclasificadoenprimergradonoimpideelaccesoaltratamientoindividualizadotodavezque
elart.10LOGPsolamenteestablecequesolamentesecaracterizarporunalimitacindelasactividadesen
comn de los internos y por un mayor control y vigilancia sobre los mismos en la forma que
reglamentariamentesedetermine.
Encoherenciaconlanormativaconstitucional,tratndosedepresosespecialmenteconflictivosyviolentos,
esnecesarioiniciaresquemasindividualizadosdetratamientoquetratendeacercarsealinternoparaconocer
suconductaytratardemodificarlapositivamente(AutodelJVPdeCastillaLennm.1de8deoctubrede
1991).EnestaresolucinseexigealEquipodeTratamientoqueestudieindividualmentealosinternos
cumpliendolapropiacircularde2deagosto,yenbaseaellopedirlesqueplanteenunplandetratamientoe
intervencinindividual,quenosupongaquelosinternosvegetenensuspropiasceldas22horasdiarias,pues
ello, slo servir para incrementar su odio a la institucin, a la sociedad y al Estado, acentuando su
prisionizacinymarginndolosanms,buscandoenlaviolencialanicasalidaposibleasusituacin.
b)Porotrolado,elart.93.6RPsuponeunavulneracindelprincipiodejerarquanormativagarantizado
enelartculo9.3delaConstitucin,todavezqueelReglamentodebelimitarseacompletarcuestionesde
detallequenoentrenencontradiccinconlaleyquedesarrollanni,ensucaso,invadanelcontenidopropio
delaleyensupuestosdemateriareservadaalamisma(SSTC13denoviembrede1981y18deabrilde
1982).
A esterespecto,existelaposiblenulidaddeplenoderechodeestanormativarestringidadeldiseode
intervencin de programas de intervencin generalizados, toda vez que el Reglamento debe limitarse a

establecerreglasynormasprecisasparalaexplicitacin,aclaracinypuestaenprcticadelospreceptosde
laley,peronocontenermandatosnormativosnuevosymenosrestrictivosdeloscontenidoseneltextolegal
(STS10dejuliode1992).
c) A mayor abundamiento, el diseo de actividades genricas en funcin del rgimen supone una
limitacinyrestriccindederechosindividualesdelapersonapresatodavezquetantoelart.25.2comoel
art.60LOGPestablecenquelosserviciosencargadosdeltratamientoseesforzarnporconocerytratar
todaslaspeculiaridadesdepersonalidadyambientedelpenadoquepuedanserobstculoparalasfinalidades
indicadasenelartculoanterior.Paraello,debernutilizarse,entantoseaposible,todoslosmtodosde
tratamientoylosmediosque,respetandosiemprelosderechosconstitucionalesnoafectadosporlacondena,
puedanfacilitarlaobtencindedichasfinalidades.Asmismo,laLOGPconfiguraeltratamientocomoun
derechodelinternoalordenarquesefomenteyestimulelacolaboracindelosinternoseneltratamientoy
planificacin(4.2y61LOGP).Enidnticosentido,paralaconsecucindelafinalidadresocializadoradela
penaprivativadelibertad,laadministracinpenitenciara(art.110RP):

A) Disear programas formativos orientados a desarrollar las aptitudes de los internos,


enriquecer sus conocimientos, mejor sus capacidades tcnicas o profesionales y compensar
sus carencias.
B) Utilizar los programas y tcnicas de carcter psicosocial que vayan orientadas a mejorar las
capacidadesdelosinternosyaabordaraquellasproblemticasespecificasquepuedanhaberinfluido
ensucomportamientodelictivoanterior.
C) Potenciaryfacilitar loscontactosdelinternoconelexteriorcontando,siemprequeseaposible,
conlosrecursosdelacomunidadcomoinstrumentosfundamentalesenlatareadereinsercin.
En consecuencia de todo lo expuesto anteriormente hay que solicitar un diseo de tratamiento
individualizadocontodoslosdetallesqueestableceelart.62delaleyOrgnicaGeneralPenitenciaria,
haciendouso,ensucaso,delasposibilidadesdergimenytratamientoqueofreceelart.100RP:"no
obstante,conelfindehacerelsistemadeclasificacinmsflexible,elequipoTcnicopodrproponerala
juntadeTratamientoque,respectodecadapenado,seadopteunmodelodeejecucinengradosenelque
puedancombinarseaspectoscaractersticosdecadaunodelosmencionadosgrados,siempreycuandodicha
medidasefundamenteenunprogramaespecficodetratamientoquedeotraformanopodrserejecutado.
UnavezdiseadosenecesitalaaprobacindelJuezdeVigilanciapenitenciaria".Enelmismosentidose
manifiestaelAutoAPPalenciade27.3.2000).

28. Se puede tener ms de las tres o cuatro horas de patio establecidas


reglamentariamente y de las tres de actividades?
Elartculo93.1RPestablecequelosinternosendepartamentosespecialesdisfrutarncomomnimo,de3
horasdepatio(elartculo94.1RPde4paralosingresadosenmduloscerrados)quepodrnampliarsehasta
treshorasmsparalarealizacindeactividadesprogramadas.
ElReglamentorealizaunamerarecomendacinquelasJuntasdeRgimenpuedennoacatar,todavezqueno
estableceunlmitemximodehorasdepatio,tansloestableceunmnimo.Enconsecuencia,silaJuntaes
competenteparafijaresaduracin,ylamismanovienecontradichaporningunanormalegaloreglamentaria
queimpongaunnmerodehorasdepatioconcreto,esprecisohacerunaseriedeconsideracionesrespectode
laampliacindelhorariofueradelacelda:
Consideracinhumanitaria.34horasdelibertadenelpatio,frentealas2120deencierro,se
traduceenunclarotratoinhumano.
Consideracin constitucional: el aislamiento priva de todos los sentidos y anula cualquier
posibilidaddeestructuracinpersonalypsicolgica.Porello,unrgimendevidabasadoexclusivamenteen
elaislamientoesabiertamentecontrarioalaConstitucinart.25yalaLeyOrgnicaGeneralPenitenciaria
art.1quesealanlareeducacincomofinprincipaldelaspenasprivativasdelibertad.Encambio,un
rgimendevidacomoeldescrito,solamenteatiendeafinesexclusivamenteretributivos.
Consideracin legal. En modo alguno puede aceptarse ni desde el punto de vista jurdico
constitucionalnipenitenciario,laequiparacindeunrgimendevidarestringidoconelrgimendevidade
sancinenaislamiento:soncuestionesconcausay,sobretodo,confinesdiferentes.Lociertoesqueparala
sancin en celda la norma prev 1 hora de paseo. Esta sancin ha sido calificada por el Tribunal
Constitucionalcomonounamsdelasqueestnadisposicindelasautoridadespenitenciarias,sinoque
slodebeserautorizadaencasosextremos...,restriccionesquelaLeyyelReglamentoestablecenparala
aceptacinresidualdeestetipodesancin...sloconlasgarantasqueparasuimposicinyaplicacin
establecelalegislacinpenitenciariavigentenopuedeserconsideradacomounapenaotratoinhumanoo
degradante(STCde21deenerode1987).

Enconsecuencia,siparalosassancionadosseestableceslo1horadepatio,noparecesuficientequepara
unrgimendevidadenosancionado,pormuyrestrictivoycontroladoqueseaesergimen,seestablezca
slo dos horas (vid. Auto del JVP nm. 3 de Madrid de 27 de diciembre de 1993). Esta misma
argumentacinvaldraparavalorarlaactuallegislacinqueaumentdedosatresycuatrohoraseltiempo
depatio.
Consideracindeseguridadyordenpenitenciario.Laampliacindehastaseishorasdepationo
comprometeenmodoalgunolaseguridaddelacrcel.Porloquenosepuedenaducirestasrazonesparano
ampliarelhorariodepatio,mscuandoelderechoconstitucionalalareeducacinespreferentedadoel
rangoconstitucionaldelanormaquelosustenta.ElAutodelJVPdeOviedode25dejuniode1996ampla
elhorariodepatio.
Enloscasosenlosqueunapersonallevealgntiempoenprimergrado(msdeseismesespodraser
suficiente)podrasolicitarlaaplicacindelart.100.2RPqueconsisteenelprincipiodeflexibilizacinde
losregmenesdevidaafindequeseamplenlashorasdepatioydevidaencomnconelrestodelos
penados.Demaneraque,porestesistema,sepuedenconseguirhastalasseis(3ms3,enprimerafase)o
siete horas previstas (4 ms 3, de actividades en comn) sin que pueda decirse que es una situacin
equivalenteaestarclasificadoensegundogrado(AutodelaAP1Pontevedrade10.3.2003).Encualquier
casolaaplicacindelart.93deberahacerseensusmnimosynoensusmximosparapodercumplir
mnimamentelosfinesdereeducacinsocial(AutoAPPalenciade27.1.2000)

29. Cuntas personas presas pueden salir al patio juntas?


Nomsdedospersonasenlosdepartamentosespeciales(art.93.3RP)ynomsdecincoparalarealizacin
deactividadesenlosmduloscerrados(art.94.2RP).
Enalgunosmdulosdeaislamientoocurrequealserimparelnmerodepresos,obliganaqueunosalgaal
patioensolitario.Estoesilegal,salvoquealgunapersonaloquieravoluntariamente,oqueporjustificadas
razonesdeseguridadassehaga.
Lasalidaalpatioensolitarioconvierteaestegradodeclasificacinenunasancindeaislamiento,yelloes
contrarioalart.90.2RPqueestablecequeenningncasoelrgimendevidaparaestosinternospodr
establecerlimitacionesregimentalesigualesosuperioresalasfijadasparaelcumplimientodelasancinde
aislamientoencelda.Y,entodocaso,cuandosedenestassituacionesespreferiblequesalgabeneficiado
algnpresoporexceso(quesalgantresjuntos),queperjudicadootropordefecto(slosalgauno)(Autodel
JVPdeOviedode18dediciembrede1996).EnelmismosentidosemanifiestaelAutodeJVPdeCastilla
Lennm.1de26dejuniode1997.

30. Qu cuestiones no pueden ser restringidas a las personas en rgimen de


aislamiento?
Nosepuedeprohibirelaccesoaperidicos,radio,televisores,niacursarestudios,puessurestriccinno
aportarazndeseguridadalguna(arts.55.3,58LOGP,93.5RP)(AutodelJVPdeCastillaLennm.1de8
deoctubrede1991).Enocasiones,parajustificarlaprivacindelusodeltelevisor,stesehaequiparadoala
privacin de actos recreativos comunes, justificndose tal medida como un incentivo para que el preso
observebuenaconducta.Puesbien,ellosuponeunailegalidadtodavezquelaradionosepuedeconsiderar
actoderecreo,porloquesevulneraelprincipiodelegalidad(principiodetaxatividad),ydeseguridad
jurdica.Asimismoprivandeunderechofundamental(arecibirlibreinformacin),accesoalaculturayala
formacin,osimplementedeunderechosubjetivo:eldegozardeocioydisfrutardeactosrecreativos,
constituyndoseenunaverdaderasancinalprivardederechos,sinqueestcontempladolegalmentedeesta
forma(AutodeJVPdeGranadade15dejuniode1994).
Tampocosepuedeprohibirelaccesoaproductosdeeconomato,salvolacomplicacinquepudieraderivarse
de un envasado peligroso, ni el acceso a productos de higiene y aseo reglamentarios con las medidas
precautoriasconsecuentes(AutodeJVPdeSevillade30deenerode1992);delamismamaneranosepuede
prohibirgrabadoraporsutamao,nibolgrafodemetal(AutoJVPdeSevillade22demarzode1996).
Tampocopuedenprohibirseelaccesoacomunicacionestelefnicas,escritasuorales,nidevisavis(Auto
JVPSevilla22demarzode1996).
Adems,nosepuedenprohibirelaccesoalasrevistasdelaprisin,oajugarcampeonatosdeajedrez,
parchs,damas,ftbolobaloncesto.Elartculo24LOGPobligaapermitirlaparticipacindetodoslos
presosenactividadesrecreativas,deportivasyculturales.Elartculo10.3LOGPestablecequeelrgimen
deestoscentrossecaracterizarporunalimitacindelasactividadesencomndelosinternosyporun
mayorcontrolyvigilanciasobrelosmismosenlaformaquereglamentariamentesedetermine.Deellose
deriva que dichas actividades no pueden ser prohibidas ni siquiera a los internos ubicados en los
departamentosdergimenespecial,sibienpuedenadoptarselasmedidasdeseguridadqueseconsideren
pertinentes.Esms,elreglamentoobligaalaJuntadeTratamientoaqueprogrameestasactividades,aunque
luegodebanseraprobadasporelConsejodeDireccinysupervisadasporelCentroDirectivo.

EncasodequealgunadeestasactividadesoderechosseprohibahayqueinterponerunrecursodeQueja
anteelJuzgadodeVigilanciaPenitenciaria.

31. Se puede trasladar rutinariamente de celda a los presos clasificados en


rgimen cerrado?
No.Confrecuenciaalosclasificadosenprimergradoyalospresosincluidosenlosficherosdeespecial
seguimiento(FIES)selescambiadecelda.Ellosuponeunaprcticailegal.Esciertoquelaubicacinenlas
crcelesdependedelaadministracinpenitenciaria,peroalJuezdeVigilancialecorrespondecontrolarque
talesdestinossellevenacabosiempresinperderdevistaelfinjustificativodelaexistenciadelascrceles:
laresocializacindelaspersonasmedianteunescrupulosorespetoaladignidadhumana(arts.25.2CEy1y
3LOGP).
Elcarcterrutinariodelostrasladosdeceldahadeexcluirse.Suponeunperjuicioinnecesarioeimplicaun
durogolpeparalaestabilidademocional.Elserhumanoaborrecelarutina,peroalavezlapersigue,pues
enellapuedeencontrarlaseguridadnecesariaparaeldesarrollodesupersonalidad(art.10CE).lospresos
noescapanaestascaractersticas...sobredimensionanelhechodetenerunespaciopropio(reducidsimo)
(AutodeJVPdeLasPalmasde6deagostode1994).Noesacordeconlosprincipiosdenecesidady
proporcionalidadelsometimientoaunconstanteyperidicocambiodecelda,medidaqueencualquier
persona,yportantomsanenquiensigueunrgimendevidasumamenterestrictivo,provocaunaprdida
deintimidad,deunmnimoreductodelopropioopuntodereferencia,unasensacindedesorientacino
desubicacin innecesaria a los fines pretendidos y contrario a los principios del art. 71 RP, pues cabe
alcanzar la seguridad pretendida mediante los diarios registros de celda normativamente previstos y
realizadosconeldebidorigor(AutoAPPalenciade17.4.2001).
Solamente podra justificarse cuando el traslado obedeciese a causas concretas de seguridad, o de
tratamiento,yencualquiercaso,debidamenterazonadas,puesdelocontrario,elactoadministrativoque
emanadeldirectordelaprisin(ordendetraslado)esnuloporvulnerarelart.43delaLeydeProcedimiento
Administrativoquedisponequelos actos que limitanderechossubjetivos sernnulossiadolecende la
fundamentacinnecesaria(arts.47yss.delaLPA)(AutoJVPdeMlagade27dejuniode1994)(modelo
nmero21.a).
Esdifciljustificaruntrasladoporrazonesdeseguridad.Desdeelpuntodevistadeseguridadinterior,eltrasladode
celdanofavoreceesafinalidaddebidoaquecuandosetrasladaaunapersonaaotracelda,stasiguesiendo
sometidaalmismorgimenderegistrosycacheos.Porotrolado,desdelaseguridadexterior,esciertoqueel
cambiocontinuodeceldaimposibilitaconocerlaubicacindelpresodentrodelacrcel,yellodificultauna
posiblefuga.Noobstante,existenotrosmecanismosmseficacesymenosdainosparaconseguirestosobjetivos
(vigilancia externa del centro, y excepcionalmente, con las garantas adecuadas la intervencin de las
comunicaciones...)(AutodeJVPdeLasPalmasde6deagostode1994enestecasoelJuezdeVigilanciaobligaa
mantenerenlamismaceldaalapersonarecurrentealmenosdosmesescomomnimo).
El traslado, cuando sea legalmente adoptado (razones de seguridad y debidamente justificado), debera
realizarseaceldasdesimilarescaractersticasycondicioneshiginicas,yaquelasmedidasdeseguridad
debenejecutarsedelaformaquemenosperjudiquealinterno,sinqueredundenparalnuevascargaso
perjuiciosfcilmenteevitables(AutoJVPdeCeutade22deoctubrede1991).

32. Se puede cambiar de celda a una persona clasificada en primer grado


para cumplir una sancin de aislamiento?
No.Lasnormasreglamentariasreferentesalrgimencerradonoloregulan,cuando,encambio,sseocupan
de regular otros aspectos (arts. 89 a 95 RP). Por otro lado, las normas reguladoras de la sancin de
aislamientotampocoloestablecen(art.43LOGPy254RP).Solamenteseexigeporrazonesdelapropia
seguridaddelpreso.Paraellodebervalorarsecadacasoconcretosegnlascircunstanciasconcurrentes.No
puedetrasladarseindiscriminadamenteatodopresoclasificadoenprimergradoaunaceldadistintadelaque
habitualmenteocupacuandotengaquecumplirunasancindeaislamientoencelda(AutoJVPdelPuertode
Sta. Mara de 27 de diciembre de 1996). En estos casos, la direccin de la crcel siempre argumenta
genricamenterazonesdeseguridaddebidoalainadaptacinalosregmenesordinario,ogravedaddelos
delitoscometidos.Estosargumentosgenricosnosonsuficientes.
CuandoestoocurrahayquerecurriralJuezdeVigilancia.

33. Cmo debe ser el control mdico en los casos de aislamiento o rgimen
cerrado?
Lavigilanciamdicadebeserparticularmentecuidadosa.Elmdicodebevisitardiariamentealaspersonas
presasdelaprimerafasedeestegrado,elevandouninformesemanalsobreelestadopsicofsico,rgimen
alimenticioycondicionessanitariasgenerales.
Sinembargo,nosiempresehace,yaqueaveceseselfuncionarioelquepreguntaalapersonapresasiquiere

veralmdico.Porello,losdirectoresdecadacrcel,lasinspeccionesyenltimainstancia,laadministracin
penitenciariadebenexigirelmsestrictocumplimientodeestanorma.Esunaprcticailegallanovisita
diariadelmdico.Cuandoestoocurrelosresponsablesdealgunasprisionesaducenfaltadeprofesionales
sanitarios.EnestoscasoshayqueinterponerunaquejaalJuezdeVigilanciaafindequelaprisinreclame
msprofesionales(AutodelJVPdeCastillaLende21deenerode1997).
Laorden45/95ylacircular7/95establecequelavisitaseefectuarmedianteelsistemadeabrirpoco.El
mdicosiemprevaaacompaadodeunfuncionario.Esdifcildecomprendercomoelexamenmdicose
puedarealizaratravsdeunatrampilladelapuertadelacelda.Esimposiblequeunaexploracinfacultativa
yelconsiguientediagnsticopuedahacerseadistancia.

34. Por dnde tiene que entregarse la comida a los presos aislados?
Estasituacinsloplanteaproblemasendeterminadasprisionesenlasquelasceldasdeaislamientotienen
dostrampillas;unaarasdesueloyotraamediaaltura.Necesariamentelabandejadecomidanopuede
entregarsealpenadoporlatrampillaqueseencuentraarasdesuelopordosmotivos(AutoJVPAlicantede
11demarzode1997):
a)Laposibilidaddecontagiodegrmenesobacterias.
b)Necesidaddelpresodeagacharseylahumillacininnecesariaqueellosupone(arts.15y25.2CE,2y3
LOGP).Eltratodegradanteoinhumanoestprohibido,sobrelabaseaotorgaralciudadanopresotodoslos
derechosfundamentalesquenoseencuentrenlimitadosenlasentencia.
Porello,elAutoarribamencionadoordenaalosfuncionariosdelacrceldeAlicantequeenlasceldasde
aislamientosesuministrelacomidaaunaalturamnimadeunmetrodelsuelo.

35. Existen malos tratos en los mdulos de aislamiento?


Enlosmdulosdeaislamientolaviolenciafsicaseintensifica.Nosepuedecaerenmaniquesmossealandoal
presocomonicavctima,peroesciertoqueeslapartemsvulnerabledelarelacinAdministracin/ciudadano
preso,yporelloesmsproclivealaindefensinpersonalyjurdicaenlassituacionesdemalostratos.Con
independenciadelapresenciadedeterminadasvariablespersonalesendeterminadaspersonaspresas,elestricto
control de actitudes, decisiones ycomportamientos, la anulacin del espacio y del tiempo, la ausencia de
expectativas, el miedo, la ansiedad, la prdida de identidad, la omnipresencia del control provoca
acciones/reaccionesviolentas,tantoporlapersonapresa,comolapersonafuncionaria.
Noesmuyinfrecuentelaexistenciadehechoscomoelsiguiente:"Queelda23deabrilde1999varias
personasquetrabajancomofuncionariosenelmdulodeaislamientoentraronenlaceldaymeesposaronala
cama;deestaformametuvierontresdas,meorinsobremipropiocuerpoyluegomequitaronlasesposasy
meobligaronaquelorecogiera,aloquemeneguymesancionaron..Reconozcoquehaexistidounasituacin
violentaprevia,nofuicapazdecontrolarmeantelasituacindesesperadaenlaquemeencuentro,peroan
reconociendomipartederesponsabilidad,lepuedodecirquealgunaspersonasquetrabajanenestemdulo
comofuncionariosmeprovocancontinuamente,igualquehicieronenestecaso.Posiblementeestaspersonas
estntanincapacitadascomoyopararespetarmecomopersona,peroselesexige,porqueessutrabajo,que
aprendanarespetaralserhumanoyqueintentenpararseapensar,aunqueseamnimamente,lasituacinde
indefensin,detensin,deansiedad,enlaquemeencuentro.
Comotodainstitucin/sistemadecontrolabsoluto(pensemos,poranaloga,enunasituacinandemscontrol
que una dictadura como sistema poltico), la parte perteneciente al poder que ha utilizado
desproporcionadamente los medios coercitivos intentar por todos los medios esconder/camuflar/tapar lo
realmenteocurrido.Esclaroquelapersonapresatambinhaejercidoviolenciayposiblementeellohaya
desencadenado una reaccin de las personas funcionarias, pero en el control de esa situacin, con cierta
frecuencia,lareaccinesrealmentedesproporcionada,ymscuandonosreferimosasituacionesaisladaspero
lamentablementerealesenlasquelaspalizassedanalcualquierhoracomorepresalia.Estasituacindescrita
cadavezocurreconmenosfrecuencia,perotristementeanperdura,aunquedesdelasinstanciasoficialesnose
reconozca,nidesdelajudicialessepuedaprobar.Demaneraquelaprcticaadministrativayjudicialnoacredita
queestoshechosnoocurran,sinoquenosepuedeprobarsuexistencia.
Anteestasituacinsehacenecesarioquelosrganosadministrativosyjurisdiccionalesrealicenunaactividad
investigadorarpidayconelrigornecesarioparaesclarecerloshechosydeterminarlaspersonasparticipantes
enlosmismos;ellocomonicomediodeponderarlaexistenciadela"fuerzaproporcional"utilizadaporlos
funcionariosqueeliminalaantijuridicidaddesuaccin.
Paraello,esimprescindiblequesedenuncieanteelJuzgadodeGuardiayalDefensordelPueblo(modelos

nmero67ay67b).UnavezquesearecibidaladenunciaenelJuzgadodeGuardia,elJuezyelmdicodeberan
personarsedeinmediatoenlacrcelparapracticarunreconocimientomdicoalreclusoyalfuncionario,para
tomardeclaracinalosinternos(ponerrelacindenombresyapellidos)queparticiparonyobservarondirecta
menteloshechos,ascomodelosfuncionarios.Sifuesenvariaslaspersonasqueintervinieronenloshechos
presos/funcionarios habra que practicar las ruedas de reconocimiento necesarias para llevar a cabo la
identificacinsiestanohubiesesidoposible.Adems,esmuyimportantesealarlanecesidaddeprotegerala
personaagredida/denunciantedelasposiblesrepresaliasinstitucionales(sanciones,traslados,provocaciones,
limitacionesregimentales)queenlaprcticasedan.
Sera muy importante que desde la administracin penitenciaria se impartiesen para funcionarios cursos
destinadosalaprendizajedehabilidadesrelacionalesdecontroldelassituacionesviolentas.

36. Existen recuentos nocturnos para los presos clasificados en primer


grado?
S,peronoparatodos.EstosrecuentossuelenhacerseenaplicacindelrgimenFIES.Quieneslopadecen
sondespertadosentrelas12delanocheylascincodelamaana,todavezquelosfuncionariosencienden
una linterna a travs de la ventana y golpean los barrotes. En otras prisiones los recuentos son ms
frecuentes,unocadatreshorasparaverificacindenormalidaddelasceldas;enestecasolaAudiencia
ProvincialdeNavarraestimunrecursodeapelacindiciendoquenoesunacuestinqueafecteala
dignidad,sinoalderechoasaludyalaintegridadfsica,enelquepartedeesosderechoseseldescanso
adecuado.Esevidentequeelencendidodelaslucesdelaceldaparapoderefectuarlainspeccin,puede
alterarelsueo,nosiendoenabsolutoirrazonablepensarenquehayapersonasquetrasserdespertadas
tengan problemas para conciliar el sueo nuevamente; adems del desasosiego que puede generar la
habitualidaddelamedidavulneraelart.25delaLOGP.(AUTOAPNavarrade17/10/00).
Algunos presos sealan que en determinados funcionarios hacen este recuento con ms cuidado. Esta
prcticapuedeserrecurridaalJuezdeVigilanciaPenitenciaria(modelonmero21.d).

37. Qu personas presas y en qu casos van destinadas a las crceles de


rgimen cerrado?
A estas crceles se destina a los presos clasificados en primer grado considerados como personas
extremadamente peligrosas o inadaptadas al rgimen ordinario y abierto. Este rgimen de vida tambin
puede aplicarse a propuesta de la Junta de Tratamiento y con la aprobacin del Centro Directivo a las
personasdetenidasoqueestnpresaspreventivamente(arts.10LOGP;89y96RP).
Todaclasificacinenprimergrado,oenaplicacindeart.10LOGP,debesermotivadayfundamentada.
CuandonoseestconformeconestasresolucioneshayqueinterponerrecursoanteelJuezdeVigilancia,o
posteriormente,siaqulsedesestima,anteelJuzgadooTribunalSentenciadorlaAudienciaProvincial.En
estosrecursoshayqueanalizarlosmotivosenquesebasalaresolucindelaadministracinpenitenciariay
comprobar que se ajustan a los supuestos de hecho que prev el Reglamento para su adopcin. A este
respecto conviene recordar que una persona slo puede ser clasificada o regresada a primer grado por
peligrosidadextrema,oporinadaptacinalrgimenordinariooabierto.
1)Lapeligrosidadylainadaptacinquemotivenlaclasificacinenprimergradotienenquefundarseen
causasobjetivasquedebernconstarenunaresolucinmotivada.Aesterespecto,sedebenponderar,segn
elReglamento,lossiguientesfactores:
a) Naturaleza de los delitos cometidos a lo largo de su historial delictivo, que denote una
personalidadagresiva,violentayantisocial.
b)Comisindeactosqueatentencontralavidaolaintegridadfsicadelaspersonas,lalibertad
sexualolapropiedad,cometidosenmodosoformasespecialmenteviolentos.
c) Pertenencia aorganizaciones delictivaso abandasarmadas, mientrasno muestren, en ambas
casos,signosinequvocosdehabersesustradoaladisciplinainternadedichasbandas.
d)Participacinactivaenmotines,plantes,agresionesfsicas,amenazasocoacciones.
e)Comisindeinfraccionesdisciplinariascalificadasdemuygravesograves,demanerareiteraday
sostenidaeneltiempo.
f)Introduccinoposesindearmasdefuegoenelcentropenitenciario,ascomolatenenciade
drogasencantidadimportante,quehagapresumirsudestinoaltrfico(art.102.5RP).
Anteestosfactoresindicativosdepeligrosidadpodemoshacerlassiguientesprecisiones:
Estos factores, aunque tienencomo finobjetivaruna situacinde peligrosidado inadaptacin,
presentanunaenormecargadesubjetividad.Lapeligrosidadesunconceptoderiesgoabstracto.Paraafirmar
lapeligrosidaddeunpenadoopreventivonobastaconcomprobarlacomisindeunosdeterminadosdelitos
nitampocoessuficientelareiteracinenlosmismos(apartadosa,b).
Esnecesario,apartirdeunestudiodelEquipoTcnico,suficientementeobjetivoyriguroso,pronosticarque,

denotomarselamedida,existirunprevisibleeinmediatoconflictocontralaconvivenciaadecuadaparala
consecucin del tratamiento (funcin del sistema penitenciario) dentro de una crcel. Ahora bien, ese
inmediato y previsible conflicto tiene que ser de especial e intensa gravedad, porque existen otros
mecanismosparasolucionarelconflicto,comoporejemploelaislamientoprovisionalprevistocomomedio
coercitivo(arts.72.2RPy45LOGP).
Sielrgimencerradoseaplicaaunapersonaporlacomisindeunosdeterminadosdelitosporlosque
evidentementeestenlacrcel,estamospenalizandodoblementealcondenado:porunlado,conlacondenade
prisiny,porotro,conunrgimendevidaque,enlarealidadyenlosefectos,esdeaislamiento.Ellosuponeuna
doblerestriccindelibertad.Porunladoladelstatuslibertatisinicial(art.17CE)establecidaenlasentencia
condenatoriay,porotro,elstatuslibertatisquesetieneenlapropiaprisin,quetambincaedentrodelmbito
delart.17CE:laacordadaporlaaplicacindelart.10LOGP.Estasituacinpodraatentarcontraelprincipio
nonbisinidemprincipiodelegalidad(noimponerdoblesancinporlosmismoshechos).Ladoblesancin
devendraporladoblerestriccindelos statuslibertatis sealadosanteriormente.Aesterespecto,elTribunal
ConstitucionalenelAuto119/1996votoparticulardelosmagistradosVIVESANTNyVIVERPISUNYERhasealado
quedentrodelaprisintambinsetieneunasituacindelibertad(statuslibertatis)quecaedentrodelderechodel
art.17CE.Porello,estalimitacindederechosfundamentales(privacindelibertad)dentrodeprisinprecisade
todalacoberturaconstitucional,dentrodelaqueseencuentraelprincipiodelegalidad(arts.9.3,25.1CE)que
posibilitaladenunciaporvulneracindeesteprincipioenlaaplicacindeestergimencerradoanteelJuezde
Vigilancia, y posteriormente ante el Juzgadoo Tribunal Sentenciador la Audiencia Provincial y el Tribunal
Constitucional.EstevotoparticularrealizadoenelAutodelTribunalConstitucionalesunprimerpasoparaadecuar
lalegalidadalarealidad(aplicacindederechosfundamentalesaunaautnticaprivacindelibertad)ypoder
romperlafalsaconsideracindeque21horasenlacelda,yloqueellosupone,noesprivardelibertad,cuandoel
presodenoestarenestergimendevidapodradisfrutardelibertaddemovimientosporelpatio,lagalera,
accederaactividades,hablarconcompaeros,accesoapermisos,etc.
Porotrolado,respectodelapartadoe),estamedidadeaislamientorealprivacindelibertad,enla
prctica, slo se puede aplicar excepcionalmente porque las infracciones aisladas o reiteradas son un
problemadisciplinarioquetanslopuederesultarunindicio,peronuncaunfundamentoparalaimposicin
deunrgimendevidadeprivacindelibertad.
2)Lainadaptacinalosregmenesordinarioyabiertotambinsoncausadelaclasificacinenprimer
gradooenartculo10LOGP.Estainadaptacintienequesergrave:quesuponequedebeserespecialmente
intensa,circunstanciaquehadeprobarseatravsdedatosobjetivosporpartedelEquipodeTratamiento;
permanente:quesuponeunacontinuidadrelevante,puesdelocontrario,elconflictopodraresolversepor
mediodelrgimendisciplinario;manifiesta:estetrminoreflejaquesetratadeunacircunstanciaprobatoria
ynodeunacaracterstica,poniendoderelieveelintersdeloslegisladoresenqueladecisinseaslidayno
estfundadaenpresuncionesnisospechas.
Porello,esesencialquelasresolucionessefundamentenconvenientemente,condatosobjetivos,puesdelos
contrario,podrnserndeclaradasnulas.EnelrecursoqueseinterpongaanteelJuezdeVigilanciacuando
seapliqueelrgimencerradoporinadaptacinhayquehacerconstarsistasejustificaporsergrave,
permanenteymanifiesta(modelonmero22.a).

38. Cul es el proceso a seguir para la aplicacin del rgimen cerrado?


Eltrasladodeunapersonadesdeunacrceldergimenordinariooabiertoaunacrceldergimencerrado,
oaunodelosdepartamentosespeciales,competealCentroDirectivo(DGIP)medianteresolucinmotivada
(requisitoesencialqueabarcadescripcindehechos,fundamentosdederecho,yvaloracinentrelosmismos
enunprocesoracionalylgicodesdeelpuntodevistagramatical,teleolgicoydelosbienesjurdicos
afectadosporlamedida),previapropuestarazonadadelaJuntadeTratamientocontenidaenelejemplarde
clasificacino,ensucaso,enelderegresindegrado.ElacuerdodelCentroDirectivosercomunicadoal
JuezdeVigilanciaenplazonosuperioralassetentaydoshorasencumplimientodelodispuestoenel
apartado2.j)delartculo76LOGP.Enelmismoplazosenotificaralpenadodicharesolucin,mediante
entrega de copia de la misma (se entiende que es la resolucin definitiva del Centro Directivo y no la
propuesta),conexpresindelrecursoquepuedeinterponeranteelJuezdeVigilancia.
ElmdicodelaprisintienequehaceruninformecuyodiseosehaelaboradoenlaInstruccin5/99enel
quesehaceconstargenricamente,ademsdelosdatos,sipadeceonoenlaactualidadenfermedadque
desaconseje la aplicacin del rgimen de primer grado. Habra que saber que enfermedades tiene, que
exploracinseherealizado,sielmdicoesespecialistaensaludmentalporlasgravesconsecuenciasque
tieneelaislamientoenlamentehumana;ysinduda,echamosdemenosuninformesemanalenlosmismos
trminosdeltiempoquelapersonaestenrgimencerrado.
LosJuecesdeVigilanciaexigenquelaadministracinpenitenciariamotivelosacuerdosdeprimergradoy
losadoptadosendiscrepanciaconlaspropuestasdelosEquiposdeobservacinyTratamiento(Criterio22
JVPreuninenero2003).

Cuandomediemotn,agresinfsicaconarmauobjetopeligroso,tomaderehenesointentoviolentode
evasin, se puede trasladar a una persona penada a departamentos especiales, aunque no se le haya
clasificadoenprimergrado.Pero,entodocaso,laclasificacindebeefectuarsedentrodeloscatorcedas
siguientes,dandocuentainmediatamentedeltrasladoalJuezdeVigilancia(art.95.3RP).Parecerazonable
estamedidaensituacionesextremasdeviolenciafsica(paraevitarrepresaliasoactosviolentosposteriores),
quedandofueradeintervencininmediatalosintentosnoviolentosdeevasin,agresinafuncionariouotro
internoconfuerzafsica,uotrossimilares.Enestoscasossepuedenadoptarmedidasdisciplinarias,sintener
quellegaralaregresindegradopreventivamente.
Nosotrosnosmostramosendesacuerdoconesteprocesodebidoaquenosalvaguardalosderechosconstitucionales
enlaadopcindeunaresolucinadministrativaqueimplicaunaprivacindelibertad.Apesardequeenlaprctica
judicialypenitenciarianosehallegadoalacoincidenciaentrelegalidadyrealidad,laconsideracindequeel
rgimendevidadeprimergrado(21horasdeaislamientoencelda),elaislamientoprovisionalolasancinde
aislamiento(22horasdeaislamientoencelda),esprivacindelibertad(restriccindel statuslibertatis)y,por
tanto,larestriccindelderechofundamentalalalibertad(aunquereducidapreviamenteporlacondena)caedentro
delartculo17delaConstitucin,nosllevaaconcluirqueparalaadopcindecualquieradelosregmenesdevida
anteriormentesealadosdebenobservarselasgarantasprocesalesyderechosfundamentalesdelartculo24dela
Constitucin(defensa,contradiccin,tutelajudicialefectiva,informacindelaacusacin,utilizacindelosmedios
depruebapertinentesparasudefensa,nodeclararcontrasmismos,anoconfesarseculpables,alapresuncinde
inocenciayasistenciadeletrado).Enlosrecursosqueseinterpongancontralaclasificacinenprimergradohay
queanalizarsisehanobservadotodosestosderechos(silahaadoptadoelJuezdeVigilancia,sihapodido
defendersebienteniendoconocimientodeloshechosquehanmotivadolaregresin,ohapodidomanifestarsus
argumentacionesdedefensa,presentarsuspruebas,sihapodidoserasistidoporletrado,ysiladecisinhasido
adoptadaenunactocontradictorio).
Repetimos que, lamentablemente, el procedimiento para la adopcin de un rgimen cerrado no es tan
garantista como debera ser. Esperemos que, poco a poco, a travs de decisiones jurisprudenciales la
ejecucindelapenaenprimergradovengagarantizadaporlaabsolutatutelajudicialylaobservanciadeun
procedimientogarantistaconabsolutorespetoatodoslosderechosdelart.24delaConstitucinquehayque
observarparalaadopcindetodaresolucinqueprivedelibertadgarantizadaenelart.17CE.

39. Cada cuanto tiempo y con qu criterios se revisan las modalidades de


cumplimiento en rgimen cerrado?
Dentrodelrgimencerradoexistendosfases,laIylaII;cadaunadeellastienedistintaspeculiaridades.La
revisindeestasmodalidadesseharcadatresmesescomomximo,senotificaralapersonapresayse
anotarenelexpedientepersonal.
Loscriteriosdereasignacindemodalidadesdelrgimencerradoson:intersenlaparticipacinycolaboracinen
actividadesprogramadas,cancelacindesancionesoausenciadelasmismasporperodosprolongadosdetiempo,
adecuadarelacinconlosdems(art.92RP).
Aesterespecto,enunrgimendevidadondenoexistenactividades,dondeseestaisladolaprcticatotalidaddel
da,conqucriteriosrealessereasignanlasmodalidadesdergimencerrado?.Elnicocriteriodereasignacin,
enlaprctica,eselcomportamientoqueseconcretaenlaexistencia/ausenciadesanciones.Sepuedeesperarque
unapersonaencerradaveintitrshorasaldatengauncomportamientomodlico?.Laexperienciadelaspersonas
queestnohanestadoaisladasnosdicequeestasituacinestandestructivayviolentaqueunodelosmediosde
reducirlaansiedad,losefectoscausadosporlasoledadylafrustracin,eslaasuncindecomportamientos
agresivoscontralapersonaquelescontrolaelfuncionario;eslarebeldadelsometidofrentealquesomete.A
mayoraislamiento,msdestruccinfsicaypsicolgica;y,amayordesestructuracin,mayoragresividad.Amayor
agresividad,mayoraplicacindelrgimensancionador.Enconsecuencia,laspersonasenrgimencerradovenmuy
limitadaslasposibilidadesdeprogresardemodalidady,portanto,degrado.Losmediosdedefensalegalsonmuy
reducidos,tantoporlasituacindelimitacinfsicaenlaqueseencuentraelpreso,comoporlainexistenciarealde
criterioslegalesavalorarparalareasignacindemodalidades.

40..Pueden ser destinados a crceles de rgimen cerrado los presos


preventivos?
TambinpuedenserenviadosaestosCentrosodepartamentosespecialeslospresospreventivosconsiderados
depeligrosidadextremaoinadaptadosalrgimendelosestablecimientosdepreventivos(art.10LOGP).La
peligrosidadextremaolainadaptacinmanifiestaseapreciarnponderandolaconcurrenciadelosfactoresa
queserefiereelartculo102.5delReglamento(art.96.3RP).
Lapermanenciadelaspersonasdetenidasopresasenestergimencerradoserporeltiemponecesario
hastaquedesaparezcanodisminuyansignificativamentelasrazonesquesirvierondefundamentoparasu
aplicacin.Entodocaso,larevisindelacuerdoaqueserefiereelartculoanteriornopuededemorarsems
detresmeses,previaemisindelospreceptivosinformes(art.98.2RP).

41. Cul es el proceso legal para la aplicacin del rgimen cerrado en el caso
de los preventivos?
Paralaaplicacindelrgimencerradodelartculo10esnecesarioinformerazonadodeljefedeserviciosy
del Equipo Tcnico. La decisin debe adoptarse en resolucin motivada por el Centro Directivo. La
notificacin a la persona presa deber realizarse en el plazo de las veinticuatro horas siguientes a su
adopcin,conentregadelacopiadelacuerdoeindicacindequepodrelevaranteelJuezdeVigilancialas
alegacionesyproposicionesdepruebaqueestimeoportunas.Asimismo,dentrodelassetentaydoshoras
siguientesalaadopcindelacuerdo,ladireccindeberremitiralJuzgadodeVigilanciacertificacinliteral
delmismo,losinformesindicadosyelescritodealegacionesypruebasque,ensucaso,hayapresentadola
personapresa.Sielacuerdoimplicaeltrasladoaotracrcel,secomunicaralJuezdeVigilanciayala
Autoridadjudicialdelaquedependalapersonapresa(art.97.2RP).

42. El escrito de Queja del preso ante la resolucin de aplicacin del rgimen
cerrado del artculo 10 LOGP suspende el acuerdo?
Noexistesolucinprevistalegalmente.Enlarealidadprcticanosesuspendeelacuerdo.Esms,encasode
queelacuerdoimpliqueeltrasladoaotracrcel,seejecutarinmediatamente.
Ante este silencio legal, debemos acudir por va de la interpretacin analgica a la regulacin del
cumplimientodelassanciones.Enestamateria,losacuerdossancionadoresnosernejecutivosentantoque
nosehayaresueltoelrecursointerpuestoporlapersonapresaanteelJuzgadodeVigilancia(art.252.1RP),
salvoenlosactosdeindisciplinagrave(art.252.2RP).
Poranalogaconelcontenidorealdelrgimendevidadelasancindeaislamientoydelart.10LOGP,el
recursodeQuejadelpresoanteelJuezdeVigilanciadeberasuspenderlaejecucin.Lasuspensindel
mismo debera ser la norma general y la ejecucin inmediata, la excepcin. En este mismo sentido se
manifiestaelTribunalConstitucionalenAutode1deseptiembrede1994,enelqueaccedeasuspenderel
acuerdodelaJuntadeRgimenenaplicacindelart.10mientrassetramitaelrecursodeamparoporqueno
accederalasuspensincautelardeeseacuerdosupondralapersistenciadeunamedidasrestrictivasde
bienes individuales que a juicio de los recurrentes vulneran principios constitucionales... Dado que el
tratamiento (este rgimen de vida) incide directamente en las posibilidades de movimiento y de
comunicacindeindividuossometidosapenasprivativasdelibertad,ydadoqueaquellaprivacinaadida
sobrebienestanesencialesesensmismairreversible,procedeacordarlasuspensindelacuerdo.
Porello,antelanotificacindeaplicacindelart.10LOGPhabraqueinterponerunaQuejaalJuzgadode
Vigilanciayexponerlosmotivosporlosqueseconsideraquenodeberahaberseaplicadoestergimende
vida(modelonmero23).EnesteescritodeQuejadebesolicitarsealJuezquesesuspendalaejecucindel
acuerdohastalaresolucindefinitiva.SielJuezdeVigilanciapenitenciariadesestimaselaQueja,hayque
recurrirenreforma(modelonmero24)ysisevuelveadesestimarstaenelmomentodelanotificacinde
laresolucinhayquesolicitarabogadoyprocuradordeturnodeoficiopararecurrirenapelacinanteel
JuzgadooTribunalSentenciadorlaAudienciaProvincial(modelonmero25).Denuevohabraquesolicitar
la suspensin del acuerdo en ese recurso de apelacin. Si a su vez se desestimase y se considerasen
vulneradosalgunosdelosderechosfundamentaleshabraquehacerunescritoalTribunalConstitucional
expresandoquesequiererecurrirenamparoporlavulneracindeunderechofundamentalyquemientras
tantosesuspendaelacuerdodelartculo10LOGP.

43. Puede una crcel aplicar el artculo 10 LOGP cuando previamente un Juez
de Vigilancia ha dejado sin efecto el mismo?
No, pero en la realidad se dan situaciones controvertidas. Puede ocurrir que la administracin penitenciaria
aprovecheuntrasladodecrcelparavolveraaplicaraunpresoelartculo10LOGPquepreviamenteunJuezde
Vigilanciahabadejadosinefecto.
Elcasoconcretosedacuandounacrcelacuerdasometeraunapersonaalrgimendeart.10LOGPyelJuezde
Vigilancialodejasinefecto.
Apartirdeestemomentoelpresoestrasladadoaotraprisin,fuerayadelacompetenciadelanteriorJuez,yla
JuntadeTratamientodeestanuevacrcellevuelveaaplicarelart.10LOGP.
Estoesmanifiestamenteilegal.Sienlanuevapropuestadeart.10LOGPrealizadaporlanuevacrcelde
destinoaparecendatosocircunstancianuevasynovaloradasporelJuzgadodeVigilanciaquedejsinefecto
elart.10,esevidentequenosencontraramosanteunanuevapropuestay,portanto,deposibleautorizacin.
Si,porelcontrario,lapropuestanoaportaningndatonuevo,noesquenosencontremosanteunanueva
propuestadeart.10,sinoantelamismaqueensudafuedesestimadaporunJuezdeVigilanciayquese
intentaqueseaaprobadaporotrodistinto,utilizandoparaelloelsencillo,yconfrecuencia,efectivosistema
decambiodecrceldelpreso(AutodelJVPdeSevillade30denoviembrede1990).

CuandoestoocurrahayqueinterponerunescritodeQuejaalJuezdeVigilanciapenitenciaria,sinolo
estima, unode reforma ante el mismoJuzgado;y,sisedesestima,uno deapelacinante el Juzgado o
TribunalSentenciadorlaAudienciaProvincial,previapeticindeabogadodeoficioysuspensindelplazo
pararecurrirmientrassedesigna.Parafundamentarestosescritoshayquehacerreferenciaaloqueenesta
preguntahemosexplicado.

44. Existe alguna diferencia entre la aplicacin del artculo 10 de la Ley


Orgnica General Penitenciaria y la sancin del aislamiento del artculo
42?
Esimportantediferenciarentrelaaplicacindelartculo10delaLOGPylasancindeaislamiento.Son
situacionesjurdicayprcticamentediferentes.Paracadaunadeellaslalegislacinpenitenciariaadopta
distintas prescripciones. El sistema de vida impuesto en el artculo 10 LOGP ha quedado desvirtuado
totalmente,llegandoenestemomentoaconvertirseenelaislamientodelartculo42.4LOGP.
Ningunadelaspautasquesehandeobservarenlaaplicacindelrgimencerrado(artculo10LOGP)yque
vienenestablecidasexpresamenteenelartculo46,secumplenenlarealidadpenitenciaria(limitacinde
actividadesencomnconlosdemsinternos,existenciadeactividadescontroladasyprogramadas,etc.)Se
hanquedado,aligualqueotrosmuchosprincipiosdeestaLeyGeneralcomomerosndicesprogramticos
vacosdecontenido.Lograveesquesehadotadoaestamedida(rgimencerrado),delcontenidodeotra
muygrave:elaislamiento.Porello,laspersonaspresasenartculo10sufrenunasituacindederecho,que
nosecorrespondeconsusituacindehecho(artculo42).Negarlaexistenciadeestadisociacinentre
norma jurdica y contenido normativo supone ser ajeno a una realidad que es inherente al sistema de
ejecucinpenal,quesibienpuederesultardesconocidaparalamayoradelapoblacin,esinexcusableenlas
personasencargadasdelaaplicacindelalegislacinpenal.Enestesentido,semanifiestaelAutodelJVP
nm.1deMadridde25demarzode1991,alestablecerquesehaproducidounaprofundadesviacindelo
queseregultantoenlaLeycomoensuReglamento...sehaderivadounrgimencerradoenunode
aislamiento;elrgimendeaislamientoslopuedeserconsecuenciadeunasancinconcretaconloslmites
de duracin establecidos en la Ley. No se puede sustituir un rgimen cerrado, que ha de estar basado
fundamentalmenteydemaneraprioritariaeneltratamiento,puestoqueaslodiceelartculo71LOGP,por
elrgimendeaislamientofueradelmarcosancionador.
ConuncontenidosimilarseexpresaelAutodeJVPdeOviedode16defebrerode1994enelquese
establecequenopuedeconfundirseelrgimencerradoconlasancindeaislamientoencelda.Cuestinque
socurrecuandoeldepartamentocelularcuentasloconceldasindividuales,conpatiosreducidosquese
encuentrandesprovistosdeloselementosmnimosynecesariosparasuuso:servicios,asientos,careciendo
detechoocubierta,porloquelospresosqueaccedenalosmismosdurantelashorasestablecidasseven
obligadosasoportarlasfrecuenteslluviasoinclemenciasdeltiemposinlugardonderesguardarse,teniendo
comoltimaalternativalavueltaasusceldas,porloquedichosespaciosnosonaptosparadesarrollaren
ellosningunaactividadrecreativaodeesparcimiento.Asimismo,todoslosinternosqueocupanelcitado
mdulocelularsevenprivadosdetodaactividadencomnydelaconvivenciaconelrestodelosinternos
queocupanelmencionadodepartamento,estandoobligadosapasarsoloseincomunicadoslas24horasdel
da,loqueexcededelasprevisionesdelaLOGP...nodiferencindosedichorgimendevidadelasancinde
aislamiento.
Estaconfusinentrelosartculos10yel42tieneotrosefectosmsinjustos.Elaislamientoprevistoenel
artculo42devienedelaaplicacindeunasancinparacorreccindisciplinaria.Noes,enconsecuencia,el
casodelartculo10.Ahorabien,lasituacinseagravatodavezque,teniendoenlaprcticaambosartculos
(10y42)losmismoscontenidos,suduracinesdiferente.
Para el aislamiento se establecen 14 das de duracin (ampliables hasta 42 como mximo) y, una vez
superadoslos14,deberexistirlaaprobacinexpresadelJuezdeVigilancia(art.253.1RP).Encambio,el
rgimendelartculo10puedeextendersevariosmesesoaos.Estasituacinsuponeuntratoinhumanoy
degradante.
Por su parte, la Sentencia del Tribunal Constitucional de 21 de enero de 1987, insiste en el carcter
extraordinariodelaislamientoenceldadelartculo42.Enestesentido,elAutode8deenerode1991,enel
que el JVP de Sevilla deduce testimonio al Juzgado de Guardia por una sancin de aislamiento
desproporcionadaeinjusta,quepodraserconstitutivadedelito.Enelmismosentido,elAutode13de
septiembrede1991delJVPdeMallorcaqueentiendequelanorealizacindeactividadessupone una
sancinencubiertayunapatentevulneracindelespritudelalegislacinpenitenciaria.

45. Qu se puede hacer en caso de que se aplique indebidamente el artculo


10 de la Ley Orgnica General Penitenciaria?
HayquehacerunescritodeQuejaalJuezdeVigilanciaPenitenciaria(modelosnmeros22.ay23).
Cuando una persona es clasificada por segunda vez en primer grado puede solicitar que la siguiente

clasificacinlarealicelaCentraldeObservacin(modelonmero22.b).

46. Qu se puede hacer para dejar en suspenso el artculo 10 o el rgimen


cerrado en cualquiera de sus dos modalidades?
HayquesolicitarloalJuzgadodeVigilanciaporrazonespsquicasyfsicas.Silodeniegahayqueinterponer
unrecursodereformay,sisteesdesestimado,unodeapelacinanteelJuzgadooTribunalsentenciadorla
AudienciaProvincial.Lamayordificultaddeestosrecursoseslatardanzaenlatramitacin.Esconveniente,
paraevitarunadilacinindebidaenlasresoluciones,quehayaalguien(abogado,educadorofamilia)quese
preocupeporlaceleridaddelatramitacinacudiendoalJuzgadodeVigilanciao,alJuzgadooTribunal
SentenciadoraAudienciaProvincial(modelonmero23).

47. Qu es lo que piensan todos los jueces de vigilancia penitenciaria


sobre el rgimen cerrado?
Enlareunindeenerode2003expresaron:"losinternosclasificadosenprimergradosonelgranolvidode
la administracin penitenciaria. Considerados de especial peligrosidad y de carcter violento con una
marcadainadaptacin,nosuelenserincluidosenningntipodeactividadformativauocupacional,loque
produceunefectonegativo,potenciandoelaislamientodelinterno,quenoencuentraformadesalirdel.
Toda vez que el tratamiento debe ser obligatorio, el acuerdo al que se llega intenta conseguir que con
programas especficos se de a este tipo de internos la posibilidad de integrarse y adaptarse a la vida
penitenciaria". Por ello, el criterio 23, mantiene: "el rgimen cerrado debe diferenciarse claramente de
aislamiento en celda, por cuanto no constituye una sancin permanente, y el art. 10 de la LOGP debe
aplicarse restrictivamente por su carcter excepcional. A los internos denominados FIES les ser de
aplicacincomomnimoyentodocasoel rgimen establecidoen el art.46 RP,conlas actividadesy
limitacionesespecficamentecontenidasendichoprecepto.Serealizarunprogramaespecficoparalos
internosdeprimergradoaefectosderealizaractividadesocupacionalesycreativasconunhorariomnimoy
unaparticipacinsuperioralosdosinternos.Igualmentesepropondrquelosfuncionariospenitenciarioque
trabajenhabitualmenteenlosmdulosdeprimergradorecibanunafuncinespecfica.

48. Qu consecuencias tiene el rgimen cerrado?


SegnlainvestigacinMirandoelabismoquerealizamoselprofesorPedoCabrerayyodesde1999a
2002,Lasconsecuenciasqueparalapersonapresasuponeelencarcelamientoenrgimendeprimergrado,
sonterribles,almenos,entresaspectos:(a)noslonoesefectivodecaraaevitarlareincidenciasinoque
parecetenerunefectocontrario,(b)dalugaraunfuertedeteriorodelasaludfsica,y(c)entraagravese
irreversiblesconsecuenciaspsicolgicas,portodolocualnospareceunsistemarepudiabletantodesdeun
puntodevistatcnicocomotico.
a) PrimerGradoyReincidencia:unarelacindirecta.
EnunestudiorecientedelaCentraldeObservacindelaDireccinGeneraldeInstitucionesPenitenciarias
sobrelareincidencia,elaboradoapartirdeunamuestrade330presosestudiadosenlaCentral,seconcluye
afirmandoquelosdatosreflejanlaexistenciadeunarelacinentrelareincidenciaylosantecedentesde
estanciaenrgimencerrado(ESTUDIOS2001:236)demaneraquesegnlosautores,aquellosquehan
estadoenrgimencerrado,tienenunporcentajedereincidenciaalcabodelostresaossiguientesasusalida
deun57%,frenteaun42%dereincidenciaqueapareceentrelosquenotienenantecedentesdehaberestado
enprimergrado.Esverdadqueresultadifcilhablardecausalidadentreambasvariables,puestoquesetrata
msbiendeunasimplecorrelacin,peroencualquiercaso,noparecequelaaplicacindelrgimenms
duro,sirvaparaevitarlavueltaalasandadasdequieneslohansufrido,msbienpareceraquelaestimula.
Dehecho,enlasconclusionesdelcitadoestudioseafirmaquelosdatosmuestranquelosantecedentesde
cumplimientomsrgidoypenoso,lamayordesadaptacinenprisin,lanoparticipacinenactividades
programadas, el consumo de sustancias txicas y algunos trastornos psicopatolgicos, son causas
determinantesdemayorreincidencia
Portodolocual,sibiensepuedellegaraentenderquelasdemandasexpresadasporlaopininpblicaenel
sentidodeendureceryampliarlaspenasylascondicionesdecumplimiento,puedenestarjustificadasdesde
sentimientoscomolaira,lavenganza,larabia,laimpotencia,elmiedoolaangustia,sinembargola

demostracinempricanosmuestra,que,aquellosquesonexcarceladosenlibertadcondicionalreinciden
menosquelosquesonexcarceladosenlibertaddefinitiva,y,ellosignificaqueelcumplimientodelapenaha
sido mejor en todos los aspectos, pues, en general, ha tenido menos infracciones disciplinarias, ha
participadoenactividadesdetratamientoyhasidoclasificadoentercergradodetratamiento,precedidopor
eldisfrutedepermisosdesalidaparaprepararsusalidaensemilibertadolibertad,enresumen,suestanciaen
prisinhasidomenospenosayrgida,porloque,sirealmentequeremosdefendernosdenuevosdelitos,el
caminonopareceserelendurecimientodelaspenasydelascondicionesdecumplimiento(ESTUDIOS
2001:274). El trabajo termina con la siguiente conclusin: Todas las medidas que influyen en unas
condiciones ms suaves de cumplimientocomo: reducciones de condena, participacin en actividades y
programasdetratamiento,clasificacinentercergradodetratamiento,permisosdesalida,etc.,resultanser
causadeunamenorreincidencia,loqueresultaesperanzador,yaque,nuestralegislacincontemplaesas
actuacionesypuedenserelinstrumentoadecuadoparareducirlareincidenciaeneldelito(ESTUDIOS
2001:275). Parece pues, que una de las consecuencias negativas del rgimen cerrado, es que eleva la
reincidenciayestimulalaactividaddelictivadequieneslohanexperimentado.Estoporssolopodraservir
paracuestionarsesumismaexistenciadesdelaraz,peroesque,ademsdelefectocrimingenoqueparece
tener,yde lo intil que resulta como inhibidor del delito, hay otras muchas consecuencias negativas y
perversas,delascualessonvctimasenprimerlugarlaspersonasquelosufren.
b)Importantesrepercusionessobrelasaludfsica:
Para abrirnos a las consecuencias desde la perspectiva de los protagonistas, finalizbamos nuestro
cuestionarioconlasiguientepregunta:Desdetuexperienciapersonal,culessonlasCONSECUENCIAS
(especialmenteporloqueserefiereatusaludfsicaypsicolgica)delrgimendevidaenprimergrado?"
Veamosculesfueronsusrespuestas.
Por ejemplo, el deterioro de la salud fsica, la prdida de agudeza visual, de olfato, de odo, son
consecuenciasquepadecentodaslaspersonasquepasanunalargatemporadaenprisin,dealgunamanera,
elrgimenenprimergrado,alserunaformaextremadeencarcelamiento,ahondayvuelvemsintensas
todasestasprdidas.
c)GravesconsecuenciasPsicolgicas:
Viviraisladodetodoydetodos,esunatremendatorturapsicolgica,queterminaporvolverteloco.La
situacindeaislamientoenprisin,ciertamente,nocumplelascondicionesestrictasdeprivacinsensorial
queseproducanenlascmarasexperimentalesdeinvestigacindelasUniversidadesestadounidensesenlos
aos80;noobstante,enelaislamientosseproduceun monotonaestimular quepuedeprovocarserios
trastornos,algunosdeellosdetipoalucinatorio.Lacuestinestangravecomocompleja.Laspersonasnos
adaptamos a "la realidad" porque continuamente contrastamos la informacin proveniente de nuestro
"interior"(laserecuerdos,imgenesdelaimaginacin,etc.)conlaestimulacinprocedentedelentorno.
Assiunapersonadejaderecibirprcticamenteinputdelexteriorycuentacasinicamenteconsupropia
produccininterna,llegarunmomentoenquealucinar(confundirlasimgenesdelaimaginacincon
percepciones)ygenerardelirios(confundirsusideasfantasiosasconlarealidadobjetiva).Deahvienela
apreciacinpopulardequesidejassloaunapersonaenunaisla,nosevolverneurticosinopsictico.
Dichodeotromodo,elsolohechodeunamonotonaestimularextremapuedeserunfactorpredisponente
graveparalaaparicindebrotespsicticosenpersonasconantecedentesdepsicopatologamayoroen
personasdeestructurapersonalmuyfrgil.Esbienconocidoquelamonotonaestimularqueseproduceen
loscorredoresdelamuerteenEE.UU(setieneencendidalaluzelctricadaynoche)esunfactorde
desorientacinydescompensacinpsicolgicamuyimportanteparalaspersonaspresas.Ynoescasualidad.
Lamonotonaestimular,ensusextremos,esunfactordesestructurantedelapersonalidad,perolomismo
ocurreconlocontrario,esdecir,conelcambiopermanente.Laestrategiadeltrasladodeprisinodecelda
yahemosvistolosdatosdesestabilizaenormementealaspersonas,puesleshaceperdertantoreferencias
fsicosituacionales como en el caso del traslado de prisin referencias personales (contacto con el
abogado,comofactordeproteccin,etc.)ymscuandoelalejamientoseproducetambindellugarde

residenciafamiliar.
Comocasitodoenlavida,esunacuestindeprudenciaydeequilibrios.Lavariedadestimularyunamayor
conexin con el entorno favorecen claramente la salud mental del individuo. De hecho, no debera ser
admisiblequeelquepuedasdisponerdeTVoderadioenunaceldadeaislamientodependadesieres
indigenteonoenprisin.Estosaparatosnoarreglanlascondicionesdebasedelaislamiento,peros
puedendisminuirlosriesgosalpermitirestablecer,aunqueseadeformasesgadayunidireccional,unacierta
conexinhabitualconelexterior.
Adems de las variables mencionadas, en torno al aislamiento aparecen otro tipo de alteraciones
psicolgicasdescritasenlaliteratura.Veamosalgunasdeellas:cambiosenlaexpresindeemociones(desde
laimpulsividadhabitualalaindiferenciaemocional),alteracionesperceptivas,alteracionesdelpensamiento
(confusinentrelacausayelefecto,valoracindeloaprioriabsurdocomoincuestionable,confusin
entreloquepuedeseronoserreal...),sensacindeincapacidadparadescribiralgo,hipersugestionabilidad
(enfuncindelaprdidadecontactoconlarealidad,defacultadescrticasdisminuidasconlosiguales...)
etc.,etc.Estetipodealteracionesnoslosehandescritoenpresosencondicionesdeaislamientoextremo,
sinotambinenpacientesinmovilizadospostquirrgicos,enmarinosdetravesasmuyprolongadas,etc.
Noobstante,situviramosquedefinirlacaractersticapsicolgicamsdestructivadelaestanciaenprimer
grado, tendramos que hablar de la Indefensin Aprendida (Seligman), que se define como la falta de
conviccinenlaeficaciadelapropiaconductaparacambiarelrumbodelosacontecimientosqueviveel
sujeto o para alcanzar los objetivos que se desean, debido a la expectativa de falta de control. Esta
indefensinpuedellevaralamuerte.
Porunlado,lapocaestimulacinquerecibennoesgratificante,sinomsbien,locontrario,esdecir,muy
repetitivaymuyaversivay,adems,conunalaceranteinundacin.Porejemplo,laviolacindelaintimidad
esconstante,puesademsdeestarcontinuamenteobservado(cmaraspermanentesatodaslashoras,en
muchoscasos,porejemplo),nopuedesdisponerdeunmnimodeespacionidetiemporealmentepropioy
organizadoporti.Loscambiostanhabitualesdeceldaoelentrar,acualquierhoradelda,parasufrir
cacheosindiscriminados,conlaobligacindedesnudarse,sonunasceremoniasdedegradacin(Garfinkel)
quegeneranunaenormeindefensin.Laindefensinvienefundamentalmentedenosaberaquatenerte,de
nopodercontrolarsiquieralaseguridaddequevasadormiresanochedetirn,sinquetedespiertenyte
invadanlacelda,denosabercmoresponderydesentirque,hagasloquehagas,vaadarigual,puesno
estnconectadasnecesariamentetusrespuestasconlasconsecuenciasquetesperasqueseanfavorablesy
parati.
EnlosdistintosexperimentosquesehanrealizadoentornoalaIndefensinaprendidaseapreciaenlos
sujetos un importante dficit motivacional (incapacidad para iniciar una conducta voluntaria y positiva
distintaalasautodestructivainhibicinconductual,pasividadtrassucesostraumticoseincontrolables),
tambinsehadescritounacusado dficitcognitivo (incapacidadpararealizarnuevosaprendizajesopara
beneficiarsedenuevasexperiencias;haysueosconrespectoalfuturo,peronohayexpectativas,etc.)y,por
ltimo,tambinseconstatalaaparicinde dficitemocional (despusdeexperienciasincontrolablesse
originansentimientosdeindefensin,impotencia,frustracinydepresin).EnelPrimerGradotodoestoes
evidente. No se suelen producir conductas positivas y creativas que busquen la solucin de problemas
despus de sucesos traumticos e incontrolables; existe una prcticamente nula capacidad de realizar
aprendizajes alternativos (para qu, si no hay expectativas...) y aparecen con una intensidad ms que
alarmantelossentimientosdeimpotencia,frustracinytristeza.
La indefensin vieneaserlaexperienciacontraria,entrminospsicolgicos,alade controlabilidad.La
prisin,comotodainstitucintotal(Goffman),pretendecontrolartodoslosaspectosdelavidadelindividuo
(tiempos,espacios,contactosexternos,comidas,actividades,etc...).Amayorcontroldelainstitucin,por
tanto, mayor indefensin del individuo. El Primer Grado, en estesentido, es la expresin culmen de la
indefensingeneradaaunsujeto.Portanto,elnivelmayordecosificacinydespersonalizacin.

ElmismoSeligmanjuntoconotrosautoresfueelqueinsistienque,ademsdeestartancondicionados
por hechosaversivosincontrolables porejemplo,laentradaparacacheoenlaceldacualquierdaya
cualquierhoratambinestamosmuyinfluenciadosporlaexplicacinquenosdamosporesoshechos,es
decir,porlaatribucinoexplicacincausalquerealizamos.Paraestosautores,cuandolasinterpretaciones
delassituacionesaversivascomoelaislamientosonglobales(elsistemavaaporm),internas(laculpa
esmaporhabermerebotado...)yestables(estonohayquienloarregle)tiendenareprimirlaconducta
operanteyconducenalaindefensin.Otrasinterpretacionesnosontannocivasparaelsujeto.Porejemplo,
siatribuimosunfracasoacausasdeterminadasquesonespecficas(tuvequecontestarleenaquelmomento
deaquellamanera),externas(losfuncionariosmeprovocaron)oinestables(afortunadamenteeldesastre
deabogadodeoficioquemehatocadonopondrinconvenientesenpasarlavenia),nossentiremoscon
mayorcapacidaddecontrol.
Otrodeloselementosquegeneraunaenormeindefensineslaindeterminacintemporaldelaislamiento.
Enocasionessabes,peroenotrasdesconoceseltiempoqueestarsaislado,conelaadidodequesesuele
sentirqueelcambionodependerealmentedeti,pormuchoquetequieranafirmarquesieresbuenchico
esto pasa.... Te sientes indefenso porque aunque se pueda hacer constar en el expediente un buen
comportamientoregular,cabelaposibilidadqueporlapresinyporlapropiavulnerabilidadpsicolgica,en
10minutospuedasquedartesincumplirtusobjetivosdeelevacindegrado,etc.
d)UnareflexintcnicayticasobrelasconsecuenciaspsicolgicasdelPrimerGrado23.
ConociendolasconsecuenciaspsicolgicasmencionadasenelPrimerGrado,tocaahorapreguntarnos si
puedeestarjustificadotcnicamenteesdecir,siestindicadoestetipodeactuacin,sabiendoqueelfin
principalyltimoalqueestdirigidotodotratamientoeslareeducacin.
1Conunamedidatanextremacomoelaislamiento(contodoloqueconlleva:humillacindeloscacheos,
soledadnoquerida,indefensin,exacerbacindelaansiedad...)noseaprendenadapositivo;seincorporael
castigo, en todo caso, como una condicin ms de su vida, no le sirve para variar la conducta. Como
concluyeThorndike,encomparacinconlosreforzadorespositivos,losestmulospunitivossonineficaces,
yaquenolograndebilitarlasrespuestas.Adems,esbienconocidoqueparaquehayaaprendizajese
necesitannivelesmoderadosdeansiedad,peronuncatanelevadoscomolosquesuelegenerarelaislamiento.
2Enelhipotticocasodequeseredujeralaconductaquellevalacalificacindeprimergrado,loqueest
claroesqueelaislamientonopromueveningnaprendizajedeconductaalternativapositiva.Pensarque
propuestas como el aislamiento producen ese aprendizaje positivo suele formar parte del pensamiento
mgicodeunaInstitucinlaPenitenciariaqueporlomenos(ydeesoyaseraresponsable),desdesus
tcnicosconoceelfuncionamientobsicodelaconductahumana.
3Enlaintervencinclnica,cuandountratamientofracasa,noselesueledarmsdelomismo.Siha
fracasadolaprivacindelibertadenrgimenordinarioysehanproducidoconductasdisonantes,habrque
buscaralternativascualitativaycuantitativamentedistintas.
4ElpropioDefensordelPuebloadmite(1997)queesnecesarioprocederalaprestacindeunaespecialy
permanente atencin psiquitrica para los internos destinados en estos departamentos y no slo ante la
aparicin episdica de brotes patolgicos. Claramente habla de presencia de psicopatologa. Hay dos
posibilidades:
a) questasehayaproducidocomoconsecuenciadelaislamiento:siesas,seleestcondenandoal
padecimientodeenfermedadmental,elpropiosistemaestsiendoprofundamentemaleficentecon
l.
b) Silapsicopatologamsbiengrave,porcierto,siprecisadelconcursodeespecialistasensalud
mental fuera previa al aislamiento, tendramos que cuestionarnos (1) si la persona presa era
competenteparaquelefueraimputableloquemotivelaislamiento;(2)siesellugarapropiado
parasertratadaunapersonaconproblemasseriosdesaludmental.
23

EstareflexinhemosdeagradecrselaanuestroamigoJavierBarbero,psiclogopsicoterapeutayexpertoentemasdebiotica.

5Unaspectoclaveparamantenerunaciertasaludmentaleslavivenciadeseguridad.Lapersonaenprimer
grado siente lo hemos visto en la encuesta mucha inseguridad en mbitos muy distintos de su vida:
inseguridadjurdica,incertidumbrerespectoalfuturo,etc.,etc.Elevadoanivelesextremosseconvierteenun
predisponenteclarodetrastornomentalsevero.
LosprofesionalesdelaAdministracin,tantolosgestorescomolostcnicos,tienenunaticaprofesional,sin
lugaradudas.Lapretendidaneutralidadaxiolgicadelosprofesionalessehademostradoqueesunafalacia,
fundamentalmenteporquenohaysaberquenoacabegenerandopoder(Habermas).Desdeah,lasciencias
delcomportamiento,alaluzdelosconocimientosactuales,nosdicenconclaridadqueel aislamiento no
tienemsalldeunusoprovisional,excepcional,acortoplazoycomomedidadeltimorecursoninguna
efectividadteraputica yque,portanto,suaplicacinestclaramente contraindicada;portantodesdela
ticaprofesionalquienindiqueoampare,inclusoconsusilencio,estamedidatanextremaestquebrantando
elprincipioticodenomaleficenciay,desdeestaperspectiva,sucomportamientopuedesercalificadocomo
gravementeinmoral.Cuandoestenjuegoelsufrimientoylaesperanzadelaspersonasnoexistenila
asepsiatcnicanilaneutralidadmoral.
Ensituacioneslmitelosestereotiposseextremanynormalmentesejustificanaladefensiva,siendoalfinal
losmsfrgileslosmsperjudicados.Binomiosdeltipopresomuypeligrosoirrecuperablefuncionario
torturadorsesuelengenerardesdelacreacinderolescomplementariosdelosquenosepermitealotro
salir.Alobcecarsedesdeelsistemaenelrolpresomuypeligrosoirrecuperableparajustificarlasmedidas
extremasdecontrolyrepresin,lapermanentenecesidaddejustificarlasmismashacequenosepermitaque
lapersonapresapuedarealmentecomportarsedeotramanera.Latrampaestenquetampocoposibilitaalos
funcionariosdelsistemaescapardelmalditorol.Eselmecanismoconocidocomolaprofecaautocumplida.
ElPrimerGradoesunatrampamortal,tantoparalospresoscomoparalosfuncionarios,aunqueobviamente
alfinallosquesonmsvulnerablesypadecenmayorindefensinvanaserlosmsperjudicados.
Loqueresultaenormementeduroescontemplarcmodesdemuchostrabajadoresqueintervienenenel
PrimerGradosehaperdidolasensibilidadantelavulneracindederechosfundamentalesdelospresos,en
funcinaunque noslo del principiodehabituacin,quees precisamenteelopuestoalprincipiode
sensibilidad.Porelprincipiodehabituacinelqueestsometidoaunruidointensodespusdeuncierto
tiempoporejemplopuedenoescucharle,nosersensiblealmismo,noserconscientedesuinadecuacinni
desumolestia,puedehabersehabituado.Elsiguientepasoesconsiderarlo habitual como normal ylo
normalcomocorrecto,comomoralmentecorrecto.Esloquesellamaenanlisisticoelrealismomoral,es
decir,lacapacidaddedarporbuenoloqueexiste,sinsometerajuiciodevalorsitransgredeonolos
mnimosmorales.Sisiempresehahechoas,porqunodarlocomobueno?

49. Qu conclusiones y propuestas pueden hacerse del rgimen cerrado?


EnelinformeMirandoelabismodejamosconstanciabrevementedeaquellasconclusionesque,anuestro
entendersepuedenextraerfcilmentedelosdatosobtenidosylasobservacionesrealizadas;almismotiempo
presentamosalgunaspropuestasdeactuacin.
1Elrgimendeprimergrado,ensuactualconfiguracinlegal,deduracinindeterminada,formalmente
tratamental,encubriendounrgimenmaterialmentesancionador,es incompatibleconladignidaddela
persona.Alaindefensinjurdicaypsicolgica,seuneunascondicionesdecumplimientoenrgimende
deprivacinsensorialvariableyaislamientomantenido sinedie quelasmsdelasvecesgeneraninfinitos
msmalesquelosquepretendidamenteseintentanaliviar.
2 Por ms conflictivos que puedan resultar determinados comportamientos, los derechos humanos de
quienesloscometensonlos mnimosinalienablesnosujetosamerecimientoalgunosinoinherentesala
condicinhumana.Desdeesaperspectivaticojurdica,noesaceptableelvigentemodelodeprimergrado
conunrigorinnecesarioqueniegaatributosvinculadosaladignidaddelapersonacomolasociabilidad
medianteelaislamientoyladeprivacinsensorial;laintimidadatravsdelaexposicincontinuadadela
propiacorporalidadylavulnerabilidaddelhbitatenquesedesarrolladuranteaoslavidacotidianaen

todas sus dimensiones; la perfectibilidad y la posibilidad de modificar creativamente el entorno (el ser
humanoeselnicoanimalquenoslotienecapacidadadaptativasinodeadaptarelentornoal)ascomo
mediantelaimposibleevocacindeexpectativasrazonablesdecambioenelentornodelaausenciams
absolutadetratamientosindividualizadosyelfuncionamientoencortocircuitocerradoqueinvariablemente
seproduce; la proscripcinde tratos inhumanos ydegradantesquehan sido suficientey patentemente
mostradosenlaspginasanteriores.
Endefinitiva,elpropiorgimenylascondicionesdecumplimientoquesehanvenidodescribiendoobjetivan
untratamientopropiamentedespersonalizadoryanimalizadorincompatibleconlaletrayelespritudelos
principiosbsicosenqueseasientanuestraculturaylospactossocialesenquesehapositivado:Declaracin
Universal de los Derechos Humanos de 1948 etc. El primer grado constituye un rgimen ticamente
inaceptable que obvia el principio de que el ser humano es un fin en s mismo dotado de inalienable
dignidad.
3Elrgimendelprimergradosuponelarenunciamsexplcitaygroseraposibledelaorientacinala
reinsercinsocialyreeducacinqueimponelaConstitucin,quequedacomounavacadeclaracinde
principiosburdamenteviolada.
4SindudahacontribuidoalaaceptacindeestaindignidadlafaltadetransparenciadelaInstitucin
Penitenciaria(agudizadaenelcasodelacrceldentrodelacrcel)yelconsiguientedesconocimiento
social,noslodelascondicionesefectivasenquesedesarrollaesaformadecumplimiento,amparadosenla
coartada, eficaz socialmente, de los delitos cometidos o de trayectorias penitenciarias conflictivas, sino
tambindelasconsecuenciasfsicasypsicolgicasquelaestanciaenestergimendeaislamientogenera
(ampliamentedesarrolladasenestetrabajodeinvestigacin).Elloha posibilitadolacronificacindeuna
situacin incompatible con la dignidad no slo de quienes directamente lo padecen sino de quienes lo
ordenany,sobretodo,delaspersonasquetienenqueasegurarsuejecucin.
5UrgeafianzarelprotagonismodelosJuecesdeVigilanciaenlascondicionesenquesedesarrollael
cumplimientodelapena,almismotiempoqueseraconvenientedotaraestegradopenitenciario,yadepor
sextremadamenterestrictivoconlalibertadyqueinevitablementeafectaalmargendeefectividaddeotros
derechosdelapersonapresa,deunmayorpesogarantistaqueaseguredemaneraespecialelderechoala
defensaylatutelajudicialefectiva.
SedetectaconpreocupacinunahipertrofiafuncionaldelasInstitucionesdependientesdelMinisteriodel
Interior (ste ha fagocitadola Direccin General de Instituciones Penitenciarias, al Plan Nacional sobre
Drogas,dirigelapolticadeInmigracineintegracinsocialetc).Ladivisinynecesarioequilibriode
poderes parece irse inclinandoenfavordel ejecutivo en un intento de domesticacin del poder judicial
medianteunusoteledirigidodelMinisterioFiscalyunaaplicacinrestrictivadecompetenciasenquienes
tienenpormandatoconstitucionallaobligacinlegaldejuzgaryhacerejecutarlojuzgado.Enestesentido
hayquellamarlaatencinsobrelacircunstanciabastanteobviadaenlaprcticadequelosJuzgadosde
Vigilanciasonbastantemsqueunamerainstitucinrevisoradelainstitucinpenitenciaria..Sindudala
inoperanciajudicialprcticaenladefensadelosderechosfundamentalesesvistaporlaspersonaspresascon
bastanterealismocuandomsdelamitadnoacudennunca nialJuezdeVigilancianialdeGuardiani
siquieraparadenunciarvejacionesmsgraves.ElJuezesvividoconfrecuencia,salvoexcepciones,como
unaprolongacindelaadministracinpenitenciariafrenteacuyapalabrapocopuedeladelpreso.Nique
decirtienequeanms,esteeseltristepapelnquejuegannopocasfiscalasdevigilanciapenitenciaria.
6Elperfildelosdestinatariosdelprimergrado,casiensutotalidadvaronesespaoles,presosmsjvenes
dentrodelajuventudgeneralizadadelasprisiones,mayoritariamentesolteros,conimportantedesarraigo
familiarynivelsocioeconmicoyculturalmsbajoquelamediadelospresos,reflejaunavezmsqueel
sistema penal recluta su clientela de modo preferente entre las franjas menos cualificadas de la clase
trabajadora ms modesta y precaria, con alto nmero de hijos, escasa escolarizacin y consiguientes
dificultades de plena inclusin social. Incluso podran sealarse un nmero determinado de familias
precarias,autnticomanantialdelquesenutreelsistemapenal.Todoelloexplicacomomsdelamitadde
losencuestadostienenunprimeringresoenprisinalos16aosdeedad(lamnimaentoncesparaingresar
enuncentropenitenciario).

Todosestosdatos,explicadosconprofusinenelestudio,reclamanlaimplantacinurgentedeunPlan
EstataldeLuchaContraLaExclusin,comofactorpreventivoprimordial.CritasEspaola,sindemasiado
xito,presenthacepocounaseriedepropuestasalGobiernoenestadireccin,aunandolapolticacriminal
conpolticasdenivelacinterritorial,promocinsocialyproteccindelosmsvulnerables.Endefinitiva,
poltica criminal de la mano de las polticas econmicas, sociales, educativas etc. La crcel se supera
fundamentalmentefuerayantesdelacrcel.
7Conindependenciadepersonalidadesmsomenosagresivas,elcontextoregimentalenquesedesarrolla
elprimergradopotencialaviolenciaentrelaspersonasquetrabajanylasencerradasenlosdepartamentosde
aislamiento.Noesunacuestinde"buenosomalos",sinodeunambienteestructuralqueextremalosroles
(funcionario/preso)hastaconvertirlosenenemigosirreconciliables.Expresindeestaviolenciainterpersonal
eseldatoaportadoporlaspersonasclasificadasenprimergrado;dicenhabersidosometidasamalostratos
usodesproporcionadoeilegaldelosmedioscoercitivosel78%delasmismas.Obviamente,estasituacin
descrita habr causado consecuencias lesivas previa o coetneamente a otras personas (presos y
funcionarios). A estos efectos parece necesario que los rganos jurisdiccionales realicen una actividad
investigadorarpidayconelrigornecesarioparaesclarecerloshechosydeterminarlaspersonasparticipantes
enlosmismos.
Afindeevitar,oentodocaso,disminuirlasindeseablesconsecuenciasquegeneralaviolenciaparalas
personas,enelintentodebsquedadeunmtododesolucindeconflictos"ganadorganador"enquetodas
laspartesobtenganunbeneficioyafindetransformarelactual"perdedorperdedor",urgelamodificacin
estructuraldelentornofsicoylanormativaregimental.Alosmismosefectos,serarecomendable quela
administracin penitenciaria llevase a cabo una poltica de personal, consistente en destinar a estos
departamentosalosfuncionariosmscualificadosenelmanejodeconflictosdesdeclavesnoviolentas.De
igualformaseraconvenientelaformacincontinuadelosfuncionariosenelaprendizajedehabilidades
relacionalesdecontroldesituacionesconflictivasyviolentas.
8Considerandoelrgimenconcretodevidadelaspersonasenprimergradodetratamiento(sic)llama
poderosamentelaatencinlaescassimainterrelacinconelequipodetratamiento.Elloresultatodavams
significativo por cuanto que muchos refieren problemas de trastornos psicolgicos y mentales en un
porcentajenadadespreciable.Lanecesidaddeunapresenciasingularmenterelevantedeprofesionalesdelas
cienciashumanasydeatencinclnicaespecializadaesunaurgenteobviedad.Estosespecialistaspodran
valorarlaidoneidaddelamedidayponerdemanifiestolasseriascontraindicacionesquepresenteeste
rgimen,talycomoestaconfiguradoinclusoparaunapersonasana.
9 La ausencia de lmite temporal para un rgimen tan restrictivo y rigorista, en determinados casos
superandolos10aosininterrumpidosdeltaltratamiento,frentealaslimitacionestemporalesencasode
sancindisciplinariaporilcitospenitenciarios(hastaseissemanascomomximo),suponeunautntico
segurodeenloquecimiento,conlaconsiguientemultiplicacindelapeligrosidadcriminalylaviolencia.
Dadoquelaexcarcelacinnosueleserniprogresivamentepreparadaniindividualizada(mediantepermisos,
progresindegrado,participacinenactividadestratamentales,etc.),sehacenecesariolafijacinlegalde
limitacionestemporalesalrgimenprimergrado.
Dadoelcarcterfuertementeaflictivoydesocializadordelaislamiento,stedeberatenersiemprecarcter
excepcionalsimo, procedindose a levantar el mismo en cuanto los informes mdicos, psicolgicos y
socialesindicasenqueescontraproducenteonoestndandolosresultadosesperadosenfuncindelfin
ltimodelapena,conindependenciadetenersancionessideellasnosedesprendeunaviolenciagraveque
puedaponerenpeligrolavidaointegridadfsicadelaspersonas.Delocontrariolasituacindehace
crnica y los comportamientos se tornan ms violentos. Si incluso desde instancias oficiales (p.e. El
DefensordelPueblo)sepreconizarestringirelrecursoalprimergradoy,entodocaso,suavizarelrigor
de las condiciones de cumplimiento la urgencia de hacer frente a esta inaplazable tarea es an ms
inequvoca.
10Llamalaatencinlasescasashorasdedicadasacualquieractividadocupacional,tratamentaloformativa
mnimamenteorganizada.Aellonoesajenalaausenciadeunprogramadeintervencinindividualizada.Las
caractersticasespecialesdeestaspersonasylosconflictosinterpersonales,enocasionesmuygraves,que

generannopuedendeporsmotivarunrgimendevidapenitenciarioqueconsistaenuncontrolabsoluto
sobrelaspersonasalsometidas.Sedebeexigirindudablementeuntratamientodiferenciadoquepresente
como objetivo esencial la superacin de tales dificultades y su pronta incorporacin, como mnimo, al
rgimenordinario.TantolaconstitucincomolaLOGPorientanlaspenashacialareinsercinyreeducacin
de los penados. En estas normas no se contemplan excepciones. Parece evidente que los esfuerzos
tratamentalesdebenvolcarsedemaneraespecialconaquellaspersonasconunpronsticoevolutivoms
dudosoymsnecesitadasportanto,deapoyo.
11.Resultanespecialmentesignificativaslaspsimascondicionesarquitctonicasenquesedesenvuelvela
vidadelprimergrado,sobretodoenlasllamadasmacrocrceles.Ideadocomounrgimendeconfinamiento
solitariototal,suscondicionesdehabitabilidadsonmuydeficienteseinsanas(faltadeiluminacin,lacelda
seinundaconlasduchas,elpatioesminsculoy,enocasiones,estcompletamenteenrejado,imposibilidad
deverelcielodirectamente,inevitablesensacindeenjaulamiento...).
12MencinespecialmereceelficheroFIESquesuponeunadirectacontravencindelaLeyOrgnica
Generalpenitenciariaalestablecerdehecho,porregulacindenfimonivelnormativo,unadiferenciacinde
rgimen no prevista ni querida por el legislador y no sometida a control judicial. Igualmente se hace
prevalecerelrgimenendetrimentodeltratamiento(contraviniendolaLOGP),sinconsideracinalgunaala
individuacincientfica,dejandosuinclusinenfuncindeelementosobjetivosimpersonales.
13 El estricto rgimen de riguroso control, con no pocos elementos vividos como arbitrarios por las
personasalsometidos(cacheosinmotivadoscondesnudointegral,recuentosadeshoras,inaccesibilidada
las pertenencias ms elementales (mudas, etc.), continuos registros de celda, trasladados de centro
penitenciario,provocacionesviolentasporpartedelaspersonasquetrabajanenprisin,usoindebidode
medioscoercitivos,palizas,alimentacinservidaarasdesuelo,etc.),creaunmicroclimapatgenoque
disparalossentimientosdeindefensinylosmecanismosreactivosviolentosaqueyasehahechomencin.
Smeseaelloquesolo1/3comunicaregularmente,yhay1/3quenocomunicaabsolutamenteconnadie.
Todomultiplicadoporeldesarraigoylalejanadeloscentrospenitenciarios.
14Elmensajedisuasoriolatentequepareceestarpordebajodelaconfiguracindelprimergrado(el
infiernoteesperaenlacrceldentrodelacrcel)acabasiendonoslocruelmentecontraproducentesino
inclusoabsolutamenteintil.Lapropiainstitucinpenitenciariaexpresaestaevidenciainclusomejorque
nosotros:elcaminonopareceserelendurecimientodelaspenasydelascondicionesdecumplimiento
(Estudios,2001).Ahoraslofaltalavoluntadpolticadeacabarconestepeculiarrgimen,tandesconocido
paralamayorpartedelapoblacincomoinhumano,devastadory,alapostre,crimingeno.

50. En qu consiste la limitacin regimental del artculo 75 RP?


Solamentesepuedeaplicar,comoseexpondracontinuacin,silosolicitaelrecluso,parasuproteccin
personal.ElpresoLapersonaa laqueseleaplicaestamedidaseveprivado,demanerailimitadaenel
tiempo,delascondicionesdevidadequevenadisfrutandoenelrgimenenelqueseencontraba.En
ocasionessuaplicacingeneraunasituacinidnticaaladelsistemadeaislamientoporsancin,ahorabien,
sinlmitetemporal,ysingarantasjurdicasensuaplicacin.Otrasveces,elart.75RPseaplicacomo
sancinencubierta,todavezqueesmsfcilsuimposicinalnoexigirelReglamentoningunagaranta
procesalparaello;otambincomolimitacinregimentalperofueradelossupuestosenlosqueseadmitesu
aplicacin.ComosealaelAutodelJVPdeLende25/02/99,laaplicacinesestasmedidasnuncapuede
suponerunavaoblicuayfraudulentapara,medianteelsometimientoalamedidadeaislamiento,operaruna
regresindegrado,alrgimencerradolaaplicacindeunalimitacinregimentaltandrstica comoel
trasladoalmdulodeaislamientoslopuedepersistireltiempoimprescindiblenomscincooseisdas,
convirtindoseenunasancinencubiertaconculcandolaexpresaprohibicincontenidaenelart.72RP,que
aunque referida a los medios coercitivos, es tambin aplicable a las limitaciones del art. 75. Estas
situacionespuedenvulnerarelprincipiodelegalidadestablecidoenelart.9.3delaConstitucin.
EnlasconclusionesdelareunindeJuecesdeVigilanciade1997sealaronqueelrgimendelart.75del
Reglamentoseconsideraexcepcionalysubsidiarioaotrosrecursoslegalescomosonlosmedioscoercitivos
enloscasosenquelossupuestosdeaplicacincoincidan,estandosujeto,dadaslasrestriccionesquesupone,
alamismaextensineintensidaddelcontroljurisdiccionalqueaquellos.
LaI11/99DGIPdefiendesuaplicacin,peroconformealosprincipiosdenecesidad,subsidiariedady

oportunidadyatravsdeunprocedimientoquegaranticelaseguridadjurdica,deformaquesuaplicacin
tengaelcarcterdeimprescindible,unavezsehayanagotadootrasalternativasposibles.
ParaelDefensordelPueblo,elartculo75delReglamentoPenitenciarioestablecomoprincipiogeneralque
losdetenidospresosypenadosnotendrnlimitacionesregimentalesquelasexigidasporelaseguramientode
supersona,porlaseguridadybuenordendelestablecimiento,ascomolasqueaconsejesutratamientoolas
queprovengandesugradodecalificacin.Elcitadoartculonogeneralafacultadenfavordeldirectordeun
establecimientopenitenciariodeacordarlimitacionesregimentalesparaelmantenimientodelbuenordende
losmismos.ParalaconsecucindeesteobjetivoLeyOrgnicaGeneralPenitenciariaensuartculo41y
siguientesprevlaexistenciadelrgimendisciplinario.Enelmismosentidoseorientalaredaccindelos
artculos231ysiguientesdelReglamentoPenitenciarioatribuyendoensuartculo232lacompetenciaen
estamateriaaunrganopluripersonal.Porconsiguiente,lasposibleslimitacionesregimentalesamparadas
enelartculo75,nicamenteestarjustificada,paraelaseguramientodelavidaeintegridadfsicadel
recluso.Siloquesepretendesalvaguardareslaseguridadyelbuenordendelestablecimiento,habrde
acudirsealasprevisionescontenidasenlosartculos10,16y64dellaLeyOrgnicaGeneralPenitenciaria.
EstaInstitucinentiendequeelmantenimientodelaseguridadyelbuenordendelosestablecimientos
penitenciarios no es una potestad si no un deber de la Administracin penitenciaria, y su valor es
instrumentalynofinalista.Laseguridadyelbuenordennosonvaloresquesejustifiquenensimismos,no
puedenserdesconectadosdelrestodelarealidadpenitenciaria.Suimportanciaradicaenqueoperancomo
substratoenelquesehandeapoyarelrestodeactividaddelaAdministracinPenitenciaria.
PorelloseharecomendadoalaAdministracinpenitenciariaque,enelejerciciodesuscompetencias,dicte
lasrdenesoportunasparaquelaactuacindelosdirectoresdeloscentrospenitenciario,enrelacinconla
aplicacindel artculo75 del Reglamentopenitenciario, se adecue a las consideraciones anteriormente
expuestas(RecomendacionesrealizadasporelDefensordelPuebloalaDireccinGeneraldeInstituciones
Penitenciariasdurante1998(BoletnOficialdelasCortesGeneralesde21dejuniode1997).
En consecuencia, este artculo 75 puede aplicarse ilegalmente en tres situaciones la aplicacin de este
artculo75RPpuedendarsegenerartressituacionesilegales:
a)Cuandoseapliqueelart.75.1:esteapartadoslofacultaalaadministracinpenitenciariaaimponerlos
lmitesregimentalesqueestableceelReglamentoenfuncindelaclasificacindelinterno.Deninguna
manerapodranimponerseotrasmedidasmsrestrictivasquelassealadasreglamentariamente(sancinde
aislamiento,aislamientoprovisional,regresindegrado...).Enestesentidoelcriterio67delareuninJVP
2003establecequenopuedeutilizarsecomosancinencubierta.
b) Cuando se aplique este artculo 75.1 por motivos que no sean la seguridad y el buen orden del
establecimiento.Enestecaso,siserecurreanteelJuezdeVigilancia,hayqueexponerqueelprincipiode
legalidadtiendeagarantizarqueelaplicadordelaleyenestecasolaadministracinpenitenciarianopueda
hacerunusoarbitrarioyextralimitadodeciertasnormaslegalesconconsecuenciasjurdicasmuygraves(la
prdida/reduccin de libertad ambulatoria por las zonas comunes y sus consecuencias) aplicando este
artculoasituacionesnoprevistasenl.
Porello,afindequenoquedevulneradoelprincipiodelegalidad,deberaexistirunacorrelacinentreel
contenidoderivadodeunainterpretacingramaticalyteleolgicadelostrminoslegalesdelart.75RPpor
un lado, y los hechos que presuntamente han dado lugar a su adopcin y mantenimiento, por otro. En
consecuencia,loshechosdeberanserdetalgravedadquepusieranenpeligrolaseguridadyelordendela
prisin; hechos que deberan quedar expresamente acreditados en la resolucin con la posibilidad de
contradiccin(defenderse)porelinternoafectadoatravsderecurso,posibilidadquenoquedareflejadaen
laresolucin.(Enelrecursohayqueanalizarlagravedaddeloshechosysienlaresolucinexisteesa
correlacin).
Amayorabundamiento,laindefensinsematerializacuandolaconsecuenciajurdica,quedehecho(enla
realidad)seaplicaenlaadopcindelart.75RPeselaislamiento.Aesterespecto,laaplicacindeeste
rgimendevidapermitealadireccindelacrcelimponerunrgimenpropiodelasancindeaislamiento
delart.43.1delaLOGPydelrgimencerradodelart.95.1RPsinnecesidaddeobjetivar,niacreditar
documentalmente hechos que deberan estar tipificados dentro del rgimen sancionador, y por lo tanto
deberaacudirseaste,afindequeseobservasentodaslasgarantasprocesalesestablecidaslegalmenteen
defensadelinterno.EncualquiercasolaI11/99expresaqueelacuerdodeldirectorylanotificacinalJuez
de Vigilancia Penitenciaria deben ser motivadas; adems establece que en ningn caso supondr una
equiparacindelrgimendevidaalrgimencerrado,deformaquedebanadoptarselasmedidasnecesarias
para que el interno pueda seguir participando de los programas de tratamiento o modelos de
individualizacincientfica.
c)Puedeocurrirqueenlaresolucinenlaquesenotificaalreclusolaadopcindelart.75nosehaga
expresamencinalaposibilidadderecursoanteelJuezdeVigilancia,oquenosedlaposibilidadde
defensaalpreso.CuandoestoocurrahayquerecurriralJuezdeVigilanciaPenitenciariayargumentarla
existencia de una disociacin entre norma jurdica y contenido de hecho en la aplicacin del rgimen

limitativodelart.75queoriginaunasituacindeindefensinproscritaenelart.24delaConstitucin.A
este respecto hay que sealar que las limitaciones regimentales (art. 75 RP) hacen referencia a las
actividades,comunicaciones...(situacindederecho)peronuncadebeimplicarelaislamiento(situacinde
hecho).Ellosuponevulneracindelprincipiodelegalidad(art.9.3CE).
Porello,entendemosquesilaconsecuenciajurdicadelalimitacinregimentaldeesteart.75eslamisma
quelasancindeaislamientoolaadopcindelrgimencerrado,deberantenerparasuadopcinlasmismas
garantasprocesalesqueaquellas(sifuesesancin:audiencia,prueba,contradiccin,defensa,posibilidadde
recurso;o,sifueseenrgimencerrado:individualizacindelaconductaenbaseadatosobjetivos,acuerdo
delajuntadetratamientoetc.)Cuandoestasgarantasnosehayanobservado,hayquerecurriralJuzgadode
VigilanciaPenitenciaria(modelonmero26).
Nosencontramosconunafigurareglamentariaquepermitealciudadanorecluso solicitarunalimitacin
regimentalparaprotegerserespectodeagresionesoataquesdeotrosinternos(antelasrepresaliasquepueden
surgircuandounodenunciaaotro,ocuandoenunprocedimientounodeclaraencontradelotro,oantela
violencialatentecuandoexistenpeleasoajustesdecuentas,oanteeltemoraserlesionadoporeltipode
delitocometido).Estasituacinlegalsuponeelconfinamientoenunacelda,laseparacinabsolutadelresto
de la poblacin reclusa y la evitacin de zonas comunes. Obviamente esta situacin supone un grave
perjuicioparaelciudadanopresoporrazonesdeestrictanecesidad.Porello,entodocaso, solamentese
puedeaplicarapenados,previasolicituddelrecluso,parasalvaguardarlavidaointegridadfsica,dando
cuenta,entodocaso,alJuezdeVigilanciaPenitenciaria.Enestoscasosdeautoproteccinlaprisintiene
que adoptar las medidas necesarias para no interrumpir las actividades de distinto tipo que resulten
compatiblescontalsituacin;igualmenteysinnecesidaddepeticindelinterno,selefacilitarnlosmedios
detipocultural,informativo,deportivoyocupacionalquefueranposibles(I11/99DGIP).

51. Puede aplicarse a una persona el rgimen de vida previsto en el art. 75


en espera de que el Centro Directivo autorice la regresin a primer grado o
a la aplicacin del artculo 10 LOGP?
Enocasiones,enalgunascrcelessesometeapresosaunrgimendelimitacinregimentaldelart.75.1o2
RPconelcontenidodelrgimendevidadelcentrocerrado(art.93RP)enesperadequeelCentroDirectivo
(DGIP)autoricelaaplicacindelart.10LOGPodelaregresinaprimergrado.Estaprcticaesilegal,
porqueelart.96.2RPexigeconclaridadlapropuestadelaJuntadeTratamiento,previoinformedelEquipo
TcnicoylaaprobacindelCentroDirectivoparapoderaplicarlasnormasprevistasparalascrcelesde
cumplimiento de rgimen cerrado a los detenidos y presos preventivos cuando se trate de internos
especialmentepeligrosos.Locontrariosupondrautilizarelart.75RPparaefectuaruncambiodemodalidad
almargendeloscauceslegalmenteprevistos(AutodelJVPdeOviedode2dejuliode1996).

52. Cmo se lleva a cabo el ingreso en las unidades Psiquitricas


penitenciarias?
Actualmentesolamentehaydoscentrospsiquitricos,enAlicanteyenSevilla.Elingresoenestascrceles
solamentepuedellevarseacabosihayunadecisinjudicialdeacuerdoconloestablecidoenlaLECr.Salvo
queestenprisinpreventiva,yelJuezhayaordenadosuingresoparaobservacinduranteeltiempoque
requieralamismaylaemisindelinformecorrespondiente,elinternamientoenunpsiquitricopenitenciario
esconsecuenciadelaimposicindeunamedidadeseguridadprivativadelibertadporlaaplicacindela
eximentecompletaoincompletadelart.20.1delCdigoPenal,odequesobrevengalaenfermedadmental
unaveziniciadalacondena(art.184RP).
Enelmomentodeingresar,elpacienteseratendidoporelfacultativodeguardia,quienalavistadelos
informesdeprocedenciaydelresultadodesureconocimiento,decidirloconvenienterespectoaldestinode
aqulaladependenciamsadecuadayaltratamientoquedebeseguirhastaqueseareconocidoporel
psiquiatra(art.186.1RP).Elequipoqueatiendaalpacientedeberpresentaruninformealaautoridad
judicial correspondiente en el que conste la propuesta de diagnstico y la evolucin observada con el
tratamiento,eljuiciodepronsticoylanecesidaddemantenimiento,ceseosustitucindelinternamiento,la
separacin,eltrasladoaotrocentroounidadpsiquitrica,elprogramaderehabilitacin,laaplicacinde
medidasespecialesdeayudaotratamiento,ascomolasquehubierandetenerseencuentaparaelmomento
de la salida (art. 186.2 RP) . Estas crceles tienen un equipo multidisciplinar (psiquiatras, psiclogos,
mdicosgenerales,enfermerosytrabajadoressocialesart.185RP).Elfuncionamientodeestosequipos
vienereguladoenlaCircular7/1996,de12dejunio.Cadaseismesessetienequeinformaralaautoridad
judicialyalMinisterioFiscalsobreelestadoyevolucindelpaciente.

53. Qu rgimen de vida tienen estas crceles psiquitricas?


Laspersonaspresasquetienenenfermedadytrastornosmentales presentanunascaractersticasconcretas
quemotivanquedesdeelpuntodevistaregimentalsellevenacabounaseriedemedidasconcretasy
diferenteselrgimengeneral.Porello,laseparacinqueserealicedelosmismosseharenatencinalas
necesidadesasistencialesdecadapaciente.Lasrestriccionesdelibertadpersonaldebenlimitarsealasque
seannecesariasenfuncindesuestadodesaludodelxitodeltratamiento(art.188.2RP).Enestoscasos,
deberanotificarseposteriormenteydeformamotivadaalJuezdeVigilanciaPenitenciaria.
Tambinseregulaelempleodemedioscoercitivosquesolamentepodrseradmitidoporindicacindel
mdicoyduranteeltiempomnimamenteimprescindible,debindoserespetarentodocasoladignidaddela
persona.Obviamentedeestamedidadebedarsecuentainmediatamentealaautoridadjudicialdequien
dependaelpaciente(art.188.3RP).Laautoridadjudicialenestoscasosdebetenerlamismacompetencia
queenlaaplicacindelosmedioscoercitivosdecarctergeneral.
Lasnormasdergimendisciplinariocontenidasenelreglamentopenitenciarionosondeaplicacinalos
pacientesinternadosenestascrceles(art.188.4).Estasituacingeneraunaenormeinseguridadjurdicaen
cuantoalasconductassancionablesyencuantoalassancionesquesepuedanimponer.Lanicaformade
controlseralanotificacinjudicial,comosideunamedidasetratarayqueconsistaenrestriccindela
libertaddelpenado.
Porltimo,lascomunicacionesnosiguenelsistemageneral.Sefijarnsegnelmarcodeprogramacin
individualderehabilitacin,indicndoseelnmerodecomunicacionesysalidas,laduracindelasmismas,
las personas con quienes los pacientes pueden comunicar y las condiciones en que se celebren las
mencionadas comunicaciones. La autorizacin de todas las salidas teraputicas corresponde al Juez de
VigilanciaPenitenciaria(criterio10reuninJVPenero2003)
Seraconvenientequesecrearanlasunidadespsiquitricasenloscentrospenitenciariosqueseconsiderasen
necesarias para la atencin especializada dentro sus respectivas reas territoriales en cumplimiento del
imperativo de velar por la salud de los internos (art. 3.4 LOGP), y en aplicacin del criterio legal de
separacinprevistoenelartculo16,d)delamismanormalegal(Criterio18,reuninJVPenero2003.
Los Jueces de Vigilancia han sealado la conveniencia de que el tratamiento psiquitrico de las
personascondenasqueloprecisendebenguiarseporcriteriosderacionalizacin,profesionalidady
optimacin de recursos, dando preferencia a la utilizacin de los servicios comunitarios sobre los
penitenciarios y limitando en la mayor medida posible el internamiento en unidades u hospitales
psiquitricos penitenciarios. Y, los penados que queden exentos de responsabilidad criminal por
aplicacindelart.20.1CPoporaplicacindeunaeximenteincompleta(penaymedidadeseguridad)
debern ser internados en hospitales o establecimientos dependientes de los servicios de salud
comunitariosynuncaestablecimientospenitenciarios(Criterio51reuninJVP2003).

Captulo 5

LIBERTAD CONDICIONAL Y BENEFICIOS


PENITENCIARIOS

1. En qu consiste la libertad condicional?


Eslaltimafasedelcumplimientodelacondena.Vieneasercomoelcuartogrado.Suponelasalidaen
libertadhastalafinalizacintotaldelacondena;libertadquesecondicionadaaquenosecometadelitonise
incumplanlasreglasdeconductaimpuestasporelJuezdeVigilanciaPenitenciaria.Duranteestetiempola
personaestbajosupervisin(presentacinmensual)delOrganismoAutnomodeTrabajoyPrestaciones
Penitenciarias.Enlaactualidad,lalibertadcondicionalesconsideradacomouninstrumentonecesariopara
laconsecucindelosfinesresocializadoresdelapenaprivativadelibertad;deberatenerlacategorade
derecho subjetivo del penado, pero penitenciariamente se considera como beneficio. A tales efectos es
consideradaporlaLeyOrgnicaGeneralPenitenciariacomolaltimafasedeltratamientoyseencuadra
dentro del sistema de individualizacin cientfica (art. 72 LOGP). En ningn momento el liberado
condicionalrompelarelacindesujecinespecialqueleunealaadministracinpenitenciaria

2. Qu requisitos son necesarios para su concesin?


Paraqueunapersonapuedadisfrutardelalibertadcondicionalesnecesarioquesedenlossiguientes
requisitos(arts.90,91y92CP1995,reformadoporLO7/2003de30dejunio):
a.Queseencuentreentercergradopenitenciario.
b.Quesehayanextinguidolastrescuartaspartesdelacondenaimpuesta.
c. Que hayan observado buena conducta y exista respecto de los sentenciados un pronstico
individualizadoyfavorabledereinsercinsocial,emitidoenelinformefinalprevistoenelart.67delaLey
OrgnicaGeneralPenitenciaria.
d. No se entender cumplida la circunstancia anterior si el penado no hubiese satisfecho la
responsabilidadcivilconformealosarts.72.5y6delaLOGP.Asimismo,enelcasodecondenadospor
delitosdeterrorismodelaseccin2delcaptuloVdelttuloXXIIdelLibroIIdeesteCdigoocometidos
enelsenodeorganizacionescriminales,seentenderquehaypronsticodereinsercinsocialcuandoel
penadomuestresignosinequvocosdehaberabandonadolosfinesylosmediosterroristas,yademshaya
colaboradoactivamenteconlasautoridades;bienparaimpedirlaproduccindeotrosdelitosporpartedela
banda armada, organizacin o grupo terrorista, bien para atenuar los efectos de su delito, bien para la
identificacin,capturayprocesamientoderesponsablesdedelitosterroristas,paraobtenerpruebasopara
impedirlaactuacinoeldesarrollodelasorganizacionesoasociacionesalasquehayapertenecidooconlas
quehayacolaborado,loquepodracreditarsemediantedeclaracinexpresaderepudiodesusactividades
delictivasydeabandonodelaviolenciayunapeticinexpresadeperdnalasvctimasdesudelito,as
comoporlosinformestcnicosqueacreditenqueelpresoestrealmentedesvinculadodelaorganizacin
terroristaydelentornoyactividadesdeasociacionesycolectivosilegalesquerodeanalamismaysu
colaboracinconlasautoridades

3. El Juez de Vigilancia puede imponer a la persona penada al decretar


libertad condicional alguna regla de conducta?
Paralaconsecucindelosobjetivosresocializadores,oantelapresenciadeunpronsticodereinsercin
dudososepuedeimponeralpenadoalgunasdelasreglasdeconductadelart.83odelasmedidasde
seguridadnoprivativas de libertaddel art. 96.3 CP CP, extremos stos, que suponen una modificacin
respectodelaanteriorregulacinquesolamenteposibilitabalaimposicindelasmedidasdeseguridadno
privativasdelibertaddelart.105CP.Conestanuevanormativaart.90.2CPseampliaelnmerodereglas
deconductaymedidasprivativasdederechosquesepuedenimponer.Lanuevaregulacinpermiteimponer
unaovariasdelassiguientesmedidas:
1.Prohibicindeacudiradeterminadoslugares.

2. Prohibicin de aproximarse a la vctima, o aquellos de sus familiares u otras persona que


determineelJuezoTribunalodecomunicarseconellos.
3.ProhibicindeausentarsedellugardonderesidasinautorizacindelJuez.
4.ComparecerpersonalmenteanteelJuez,oserviciodelaadministracinquesteseale,para
informardesusactividadesyjustificarlas.
5.Participacinenprogramasformativos,laborales,culturales,deeducacinvial,sexualuotros
similares.
6.CumplirlosdemsdeberesqueelJuezoTribunalestimeconvenientesparalarehabilitacin
socialdelpenado,previaconformidaddeste,siemprequenoatentencontrasudignidadcomopersona(art.
83CP).
1.Inhabilitacinprofesional
2.Expulsindelterritorionacional,deextranjerosnoresidenteslegalmenteenEspaa.
3.Obligacinderesidirenunlugardeterminado.
4.Laprohibicinderesidirenellugaroterritorioquesedesigne.Enestecaso,elsujetoquedar
obligadoadeclarareldomicilioqueelijayloscambiosqueseproduzcan.
5.Prohibicindeacudiradeterminadoslugaresoterritorios,espectculosdeportivosoculturales,o
devisitarestablecimientosdebebidasalcohlicasodejuego.
6.Lacustodiafamiliar.Elsometidoaestamedidaquedarsujetoalcuidadoyvigilanciadelfamiliar
que se designa y que acepte la custodia, quien la ejercer en relacin con el Juez de Vigilancia y sin
menoscabodelasactividadesescolaresolaboralesdelcustodiado.
7.Laprivacindelderechoaconducirvehculosamotoryciclomotores.
8.Laprivacindelderechoalatenenciayportedearmas.
9.Laprohibicindeaproximarsealavctima,oconaquellosdesusfamiliaresuotraspersonasque
determineelJuezoTribunal.
10.Laprohibicindecomunicarseconlavctima,oconaquellosdesusfamiliaresuotraspersonas
quedetermineelJuezoTribunal.
11. La sumisin a tratamiento externo en centros mdicos o establecimientos de carcter
sociosanitario.
12.Sometimiento a programas de tipo formativo, cultural, educativo, profesional, de educacin
sexualyotrossimilares(art.96.3CP).
Existe un solapamiento en relacin a las medidas privativas de derechos que se pueden imponer como
accesoriasenlasentenciacondenatoriaart.83,porquelasdel96.3alserabsueltoporaplicacindela
eximenteincompletadel20.1.2o3,noexisteaplicacindepenaaccesoria,todavezqueyaelJuezo
Tribunalsentenciadorhabrconcretadoenlasentencialasqueconsidereconvenientesenfuncindelas
circunstanciasconcurrentesenelinfractoryenlavctima.ParecelgicoqueelJuezdevigilancianopueda
imponer ninguna medida que ya ha sido impuesta como accesoria. La posibilidad de la expulsin del
territorionacionalprevistaenelart.96.3guardarelacindirectaconlaposibilidaddesustitucindelapena
porexpulsincuandosehayancumplidolastrescuartaspartesdelacondena.Porello,entendemosqueesta
medida no puede imponerse por esta va de libertad condicional, toda vez que si existe un pronstico
favorabledereinsercinsocial,notieneningnsentidoquelamedidaimpuestasealadeexpulsindelpas.
Laexpulsin,alastrescuartaspartes,odosterceras, sepodrllevaracabo,bienporelJuezoTribunal
sentenciadorcomosustitucinalapenadeprisinart.89CP,obienporlavaestablecidaenlalegislacin
penitenciariadelcumplimientodelalibertadcondicionalenelpasderesidencia.

4. Se necesita la autorizacin del Juez de Vigilancia penitenciaria para


efectuar desplazamientos?
Enprincipiono,salvoquealgunosJuzgadosdeVigilancia,asloconsideren.
Essuficienteconquelosserviciosdeasistenciapostpenitenciarialosconozcanparaquepuedanefectuarel
seguimiento.NosetratadequiensealaAutoridadcompetenteparaconocerdelosdesplazamientossino
quedichaautorizacinnoesnecesariaporqueesosdesplazamientosformanpartedelcontenidoyusonatural
delalibertadynohayningunacondicinoregladeconductaqueamparadaenlaLeyloslimite(AutoAP
Madrid,5,25deoctubrede2000).

5.
Qu alcance tiene el requisito de que la pena tenga que ser privativa de
libertad para que se pueda conceder la libertad condicional?
Alosefectosquenosinteresa,podramosafirmarquecualquierinternamientoenunacrcelconmotivodel
cumplimientodeunapenaprivativadelibertad,conindependenciadesuextensin,podrsercomputadoaefectos
delibertadcondicional,porqueentendemosquesilaactividadpenitenciariaestencaminadaalaconsecucindela
reeducacinydelareinsercinsocial(art.2RP1996enrelacinconart.25.2CE)todoingresoenunacrcel
suponeelsometimientoalrgimenpenitenciarioy,porende,nopareceadecuadoexcluiradeterminadaspenasde
laltimafasedetratamiento(libertadcondicional).Porello,entendemosquelalibertadcondicionalpuede
aplicarseendossupuestos:Lapenadeprisinylaresponsabilidadpersonalsubsidiariaencasodeimpagode
multa,queseconvierteendasdeprisin,equivalentealapena,porrazonesobvias..

6. Se puede adelantar en el tiempo la concesin de la libertad condicional?


S,endossituaciones:
Primera. El art. 91.1 CP establece que excepcionalmente cumplidas las circunstancias de los
prrafosa)yc)delapartado1delapartado1delartculoanterior,ysiemprequenosetratededelitosde
terrorismo de la seccin 2 del Captulo V del ttulo XXII o cometidos en el seno de organizaciones
criminales, el Juez de Vigilancia Penitenciaria, previo informe del ministerio fiscal, instituciones
penitenciarias y las dems partes, podr conceder la libertad condicional a los sentenciados a penas
privativasdelibertadquehayanextinguidolasdosterceraspartesdesucondena,siemprequemerezcan
dicho beneficio por haber desarrollado continuamente actividades laborales, culturales y ocupacionales
(modelo31).
Elnicorequisitoesquelomerezcaporeldesarrollocontinuodeactividadesquetendrqueservalorado,
enltimoextremo,porelJuezdeVigilanciaquienpodrsostenerunaopinindiscrepantedelamantenida
porelcentropenitenciarioyaqueesquientienelafuncinjurisdiccionaldehacerejecutarlojuzgado.De
estanuevaregulacindelalibertadcondicionalseexcluyealaspersonasquehayancometidosdelitosde
terrorismooenelsenodeunaorganizacincriminal.Seestablecelanecesidadobviayportantosuperflua
delosexistenciadeinformespreviosdelaadministracinpenitenciaria,delfiscalydemspartes.Parece
algoobvioporqueassevienehaciendo,yentodocaso,msquelaregulacinenelCdigopenal,setendra
quehacerelesfuerzopolticodeelaborarunanormativaqueregulaseelprocedimientodelajurisdiccinde
vigilanciapenitenciaria.Resultacuestionablequeparalaaplicacindelalibertadcondicionaltengaque
opinarlavctimasiesconsideradacomoparte.TienesentidoqueseaodaparaqueelJuezpuedaestablecer
alguna regla de conducta o medida en funcin de la situacin o relacin que tengan entre ambos para
salvaguardarsuintegridadfsica,peronunca,puedetruncarlaconcesindelalibertadcondicional,puesel
objetivoprincipaldeestafaseejecutivaeslareinsercindelpenadoystatienequepermaneceralmargen
delossentimientosodeseosdevenganzadelavctima.
Segunda.ElJuezdeVigilanciapodradelantarelperododelibertadcondicionalhastaunmximo
de90dasporcadaaoefectivodecondena(180dasenlaenmiendadeCIU),unavezextinguidalamitad
de la condena. El Juez de Vigilancia tendr que valorar la participacin en la actividades culturales,
formativasylaborales,y,adems,laparticipacinefectivayfavorableenprogramasdereparacindeldaoa
lasvctimasoprogramasdetratamientoodesintoxicacin,ensucaso.Deestebeneficioseexcluyealos
condenadospordelitosdeterrorismodelaseccinsegundadelcaptuloVdelttuloXXIIyloscometidosen
elsenoorganizacionescriminales.(art.91.2CP)(mod.31.a).
En cualquier caso, el Juez de Vigilancia podra subordinar el disfrute de la libertad condicional a la
participacindelcondenadoenprogramasdereparacinalasvctimasyentrabajosenbeneficiodela
comunidad.Laautoridadjudicialcompetentecomprobaraelcumplimientoefectivodelamedidaimpuesta.
El objetivo buscado es la motivacin a la poblacin reclusa para un buen comportamiento y para su
participacindeactividadesodestinos.Conladesaparicindelaredencindepenasporeltrabajoapartir
delapromulgacindelCdigopenalde1995,losbeneficiospenitenciariosdesaparecieronenlaprcticayse
incrementlaapataenlaspersonaspresas,ello,ademsdequedarselainstitucinsinuninstrumentode
controldelcomportamiento,lospresossinunmediodeacortarlaspenasdeprisinyelderechopenaldeun
sistemaquepermitadulcificarladurezaextremadelaaplicacindelapena.

Parasuaplicacinessuficienteconqueseacreditenlaparticipacincontinuadaenactividadeslaborales,
culturalesuocupacionales.Ademsseexigelaparticipacinenprogramasdereparacinalavctimaode
tratamientoodesintoxicacin.Demaneraquelaparticipacinenactividadesesobligatoriayadems,ola
reparacin, o al tratamiento desintoxicador; uno u otro. Respecto de la participacin en programas de
reparacinessuficienteconquesereparealavctima(econmicamenteconlaresponsabilidadcivilocon
una carta sincera de arrepentimiento), pues de exigir que se participe en un programa especfico de
reparacindeldaoalavctimaseestaraexigiendounrequisitoimposibleenloscasosenquenoexistan
programasdereparacin,odequelavctimanoquieraparticiparenlosmismos.Porello,lainterpretacin
deestanormadebeserampliaparaesterequisito.Essuficienteconhabersatisfecholaresponsabilidadcivil,
oestarpagandopartedelamismaconelsueldodeltrabajo.Quemejorreparacindedaoquecompartirel
dinero con quien ha sufrido el delito! Sin duda es una buena oportunidad para la potenciacin de las
asociacioneseinstitucionesquesededicanalamediacinpenal.
Porotraparte,quienestsometidoacualquierprogramadetratamientoodesintoxicacinseentiendeque
estreparandoeldaocausadotrabajandoactivamentesobrelascausasquemotivaronlaconductadelictiva.
Essuficienteconprogramaslibrededrogasodereduccinderiesgosconmetadona.
Lapruebaqueacreditelosrequisitosdebeserlaquejustifiqueelpagooabonodelaresponsabilidadcivil,o
lospagosqueseestnhaciendodesdequeseestentercergradotrabajandoolosinformesdelprogramade
tratamiento.
EstebeneficiotienequeaplicarseporelJuezdeVigilanciaPenitenciariaapeticindelaadministracin
Penitenciaria,peropodraconcederseapesardequenosehubiesesolicitadoporelcentropenitenciario
(Juntadetratamiento).EstaposibilidaddeconcesinporelJuezdeVigilanciaapesardelinformenegativo
delcentropenitenciariohasidodefendidaporelTribunalConstitucional.As,enlaSTCSTC163/2002de
21.11.02,permitequeelJuezpropongaelbeneficiodelindultoanteelMinisteriodeJusticiaapesardela
negativadelcentropenitenciarioaproponerloenbasealacompetenciaqueleotorgaelart.206RP.Eneste
casoelJuezdeVigilanciaexpresensuresolucinquecarecadecompetenciaparapronunciarsesobrela
cuestinporqueeraelEquipoTcnicoquiendebahacerlapropuestaystehabaapreciadoqueelinterno
noreunalosrequisitosexigidosenelart.206RP;asmismomantenaquelaadopcindeunadecisin
sobreestamateriaporelCentropenitenciarionoerafiscalizableporelJuzgadoporsucarcterpotestativoo
discrecional. Ahora bien, el Tribunal Constitucional en la sentencia mencionada ha establecido que la
competenciadelEquipoTcnicoparalaapreciacindelosrequisitosdelart.206RPolaconcurrenciade
extraordinario, no puede considerarse suficiente fundamentacin, pues ni la competencia de la
administracin.paralaadopcindeunadecisinexcluyeporsmismalaposibilidaddecontrolposteriorpor
unrganojudicial,yaqueelart.106.1CEestablecequelosTribunalescontrolanlalegalidaddela
actuacinadministrativa,ni,ciertamente,puedecalificarsederazonableladeclaracindeincompetencia
delJuezparalarevisindelejerciciorealizadoporlaAdministracinPenitenciariadesuscompetencias,en
materiadetramitacindelindultoparticular,alaluzdelalegislacinPenitenciaria.Estadeclaracinde
incompetenciaseseparadelodispuestoenelart.76.2cLOGPqueestablecequecorrespondeespecialmente
alJuezdeVigilanciaaprobarlaspropuestasqueformulenlascrcelessobrebeneficiospenitenciariosque
supongan un acortamiento de la condena y desconoce, tambin el art. 206.1 RP que no atribuye
competenciaexclusivaalcentropenitenciarioparalatramitacindelasolicituddeindultoparticular,pues
stenopuedeelevardirectamentesusolicitadparaquesetramitedeconformidadconlalegislacinvigente
sobrederechodegracia,sinoqueeldestinatariodirectodesupropuestaeselJuezdeVigilancia.Deotra
parte el recurso al carcter potestativo o discrecional del acto administrativo impugnado para negar la
posibilidad de su control jurisdiccional tampoco puede considerarse como fundamento razonable de la
decisinjudicial,puesdeunladoelart.54.1.fLPCprescribequelosactosadministrativosquesedictenen
elejerciciodelaspotestadesdiscrecionalesdebernmotivarseyelrecurrentealeganteelJuezundficit
delamotivacin.Yotroporquecondichafundamentacinseniegalaproyeccinqueenesembitotienela
propia interdiccin de la arbitrariedad de los poderes pblicos que proclama el art. 9.3.CE requerir la
motivacindelactoadministrativodiscrecionalestambin,garantadelainterdiccindelaarbitrariedaddel
poderpblicoysucontrolnoestareaajenaalafuncinjurisdiccional(art.1106.1CE).Endefinitivala
administracin., ha de estar en todo momento en condiciones de explicar que no ha ejercido de forma
arbitraria sus facultades discrecionales, de modo ms riguroso, si su actuacin afecta a derechos
fundamentales,libertadespblicasyvaloresconstitucionales,ylosrganosjudicialesdebenrevisar,cuando
selesolicite,lalegalidadyconstitucionalidaddelaactuacinadministrativarealizada.

Portodoloexpuestoydebidoquenoshallamosanteunfigurajurdicaqueexigealigualqueelindultola
propuestaadministrativaanteelJuezdeVigilancia,quedaclaroqueel rganojurisdiccional,porvade
recurso,puedeaprobareladelantamiento(mod.31.b).
Estebeneficiopuedeaplicarseatodaslaspersonasqueseencuentranenestemomentocumpliendocondena
porunasencillarazn.Siseaplicaretroactivamenteestanormarespectodelrequisitodelasatisfaccindela
responsabilidadcivilapesardeserrestrictiva,conmsfundamentotienequeaplicarseestanormaque
beneficia.Porello,apeticindelpenadoalaJuntadetratamientoyencasodedenegacinatravsdela
interposicinderecursoanteelJuzgadodeVigilanciasepuedesolicitareladelantamientodelalibertad
condicional.
Porltimoyparasalvartodaslasinterpretacionesdudosaseltrminoporaodecumplimientoefectivode
lacondenaserefieretantoalcumplimientodentrodelacrceldelamitaddelacondenasielpenadono
redime, como el resultado de la aplicacin de la redencin de penas por el trabajo para quienes estn
cumpliendocondenaporelcdigopenalde1995.EstasegundaafirmacinesmantenidaporlaSTS557/96,
delaSalaenPlenode18dejuliode1996,enreferenciaalaaplicacindelasredencionesobtenidashastala
entradaenvigordelcdigopenalde1995,enlaquesesealquelaredencindepenasnoesunbeneficio
graciable, sino que consiste en el abono al penado para el cumplimiento de la pena impuesta tales
beneficioscuandoyahansidoconsolidados,seintegranenunaregladecmputodeltiempopasadoen
prisindemodoirreversible.

7. Puede aplicarse al adelantamiento de la libertad condicional (2/3 partes de


la condena) cuando se est penado por el Cdigo de 1973?
S. Noobstante esta cuestin presenta problemas de interpretacin. Algunos jueces entienden que
cuandounapersonaestcumpliendocondenaporlasnormasdelCdigoPenalviejo(1973)noes
posiblequesebeneficiedeladelantamientodelalibertadcondicionalalas2/3partesdelacondena
queseestableceenelCdigoPenalnuevo(1995).
Laraznprincipalqueseargumentaesquenopuedenaplicarsealavezdosbeneficiospenitenciarios:el
adelantamientodeltiempoparalaconcesindelalibertadcondicional(CP1995),porunlado,ylaredencin
depenasporeltrabajo,porotro(CP1973).Nosloporqueambasfigurasjurdicasconstituyenbeneficios
penitenciarios,sinotambin,porquelasnormaspenalesdebenaplicarseensutotalidad,bienseanlasdeuno
olasdelotrocdigo,peronuncaparaunmismosupuesto,unasdeuno(CP1973)yotras,delotro(CP1995).
Pero a pesar de esta interpretacin, parte de la doctrina y algunos Jueces de Vigilancia Penitenciaria
entiendenqueesposibleestarcumpliendocondenaconlasnormasdelCdigoPenalderogadoy,portanto,
estarredimiendocondena,yasuvez,gozardelbeneficiodeladelantamientodelalibertadcondicionalalas
dosterceraspartesdelacondena.
Lasrazonesquesepuedenargumentarparaqueseapliqueeladelantamientodelalibertadcondicionala
penadosporelCdigoPenalderogadoson:
a)Enestossupuestos,nosetratadeexaminarquleyeslamsfavorableparadeterminarlaley
aplicablealoshechosprobados,pueslacondenayahasidoimpuesta,yseencuentraenfasedeejecucin.
Llegadosaestafase,enmuchoscasos,unavezexaminadalaposibilidaddeacomodacin/revisinalnuevo
CdigoPenal,semantuvoelcumplimientoporlasnormasdelCdigoPenalderogadoporqueresultabanms
beneficiosas.Demaneraque,conindependenciadelanaturalezajurdicaquequieradarsealaredencinde
penasporeltrabajo,suaprobacinporelJuezdeVigilanciaunavezcumplidoslosrequisitoslegales,genera
unanuevasituacinpenitenciariacalificadacomoirreversibleporlasentenciadelTribunalConstitucional
174/89queincidesobreelcumplimientopenalcomosisetrataradeunapenadistinta,encuantoasu
duracin,alaqueinicialmentefueimpuesta.Yestanuevasituacinpenitenciaria,unavezquehasido
plenamenteconsolidada,escompatible,segnafirmaelTribunalSupremoensentenciade18dejuliode
1996, con la aplicacin del nuevo cdigo penal, pues la prohibicin sobre redenciones de penas ha de
entendersenicamentereferidaalmomentoposterioralaentradaenvigordelnuevoCdigoPenal.
Porello,cuandounapersonahayasidocondenadaporelCdigoPenalderogado,raznporlaquehabr
disfrutadodelbeneficiodelaredencindepenasporeltrabajo,ystashayansidoaprobadasporelJuezde
Vigilancia,habrconsolidadounanuevasituacinpenitenciariaqueesperfectamentecompatibleconla
nuevaaplicacindelart.91delnuevoCdigoPenal(adelantamientodelalibertadcondicionalalas2/3
partesdelacondena).
b)Cuandolasentenciasehacefirme,comienzalafasedeejecucin.Enestafaselasnormasa
aplicarnosonlassustantivasrespectodesupuestosdehechotiposdelictivosyconsecuenciasjurdicas
penas,sinorelativasexclusivamentealaejecucindelascondenasyaimpuestasenvirtuddeunouotro
cdigo(AutodelJVPdeCastillaLennm.1de9deoctubrede1996).LaDisposicinTransitoria2delCP
1995secentraexclusivamenteendeterminarculeslaleymsfavorableteniendoencuentalaspenasque
corresponderaalhechoenjuiciadoconlasnormascompletasdeunouotroCdigo,esdecir,normasque
tiendenaladeterminacincorrespondientedeundelitoconlanuevaregulacin,peroquenoincluyenlas
normasrelativasalaejecucindepenas.

Las normas relativas a la libertad condicional pueden considerarse como normas penitenciarias aunque
aparezcanenelCdigoPenal.Esdecir,quealquedarreguladalalibertadcondicionalenelCdigoPenal,lo
nicoquehahechoestrasladarlelasnormasexistentesenelReglamentoPenitenciario,afindesalvaguardar
elprincipiodejerarquaquehabasidovulneradocontinuamenteenarasdelaprevalenciadelprincipiode
humanizacindelaspenas(AutodelJVPdeBilbaode26demayode1997).Deaququelostresprimeros
preceptosmencionados(arts.9093CP)supondranlaprogresinal4gradodetratamiento(AutodelJVP
de Bilbao de 26 de mayo de 1997), a salvo, claro est, de lo referente a la redencin de penas que
expresamenteseexcluyeaquienesselesapliqueelnuevotextopunitivo,expresinquemuestraclaramente
lavoluntaddellegislador,yquenosecontiene,encambio,respectodelalibertadcondicional(AutosJVP
Bilbaode11deoctubrede1996y26demayode1997).
c) Si el legislador entiende que a partir del ao 1995 los penados que por motivos de buen
comportamiento,participacinenactividades,siemprequecumplanlosrequisitoslegalespuedenadelantar
sulibertadcondicional,nopareceacordeconlosprincipiosqueinformanlaaplicacindelasleyespenales
eneltiemporetroactividaddelasleyesfavorables,ni,portanto,conlosmotivospolticacriminalquehan
informadoladecisindellegislador,quelaspersonascuyacondenanosehayaacomodadoalanormativadel
CdigoPenal1995,nopuedangozardedichosbeneficios.Noaccederaestainterpretacinserapervertirel
mecanismodelaretroactividaddelofavorablequeeselprincipiorectorenlamateriapenaldederecho
transitorio(AutodelaAPCiudadReal,rolloapelacin12/96,AutodelaAPSanSebastinrolloapelacin
6015/96).Nocabedudaqueeladelantamientodelalibertadcondicionalalas2/3partesdecumplimientoes
unanormamsfavorablealpenadoquelaconcesindelas3/4partesdelacondena.
AtenordelaD.T.1delCP1995(losdelitosyfaltascometidoshastaeldadelaentradaenvigordeeste
Cdigosejuzgarnconformealcuerpolegalydemsleyesespecialesquesederogan.Unavezqueentreen
vigorelpresentecdigopenal,silasdisposicionesdelmismosonmsfavorablesparaelreo,seaplicarn
stas.Porello,lanormaexigelaaplicacindelamsfavorable;ellosignificaquenosetratadecompararen
bloqueunayotranormaaefectosdeaplicacindeunouotrotextolegal,sinoque,ensededeejecucinse
apliquelanormaquemslefavorezca.Enestecasoesladeladelantamientodelalibertadcondicionalalas
2/3partes.
d)Porotrolado,noexisteyaposibilidaddeincompatibilidadentreeladelantamientodelalibertad
condicionalconeladelantamientoprevistoenlosarts.256,257yD.T2delRP1981,porqueestoshan
quedadoexpresamentederogadosporelRPde1996(modelonmero30).

8. Quin es el encargado de aplicar este beneficio de adelantamiento de


libertad condicional a las dos terceras partes de la condena o el
adelantamiento de los tres meses por ao efectivo?
ElJuezdeVigilanciaPenitenciariaaunquelacrcelsealequesolamentesepuedeconcederapropuestadel
EquipodeTratamiento(verpregunta6deestecaptulo).Hayquesolicitarloatravsdeunescritodirigidoal
Juzgado.
El art.91CP establece que excepcionalmente cumplidas las circunstancias de los prrafos a) y c) del
apartado1delartculoanterior,elJuezdeVigilanciaPenitenciariapodrconcederlalibertadcondicionala
lossentenciadosapenasprivativasdelibertadquehayanextinguidolasdosterceraspartesdesucondena,
siemprequemerezcandichobeneficioporhaberdesarrolladocontinuamenteactividadeslaborales,culturales
y ocupacionales. Por ello, el rgano competente para la concesin de este beneficio es el Juzgado de
Vigilancia,sinperjuiciodelosinformesquepidaalacrcel;elnicorequisitoesquelomerezcaporel
desarrollocontinuodeactividades.
ElReglamentoPenitenciarioselimitaaejecutarunaleyorgnica,peronopuedeimponermsrequisitosque
losqueaquelladetermine,enlamedidaenquelosaadidoslimitenoimpidanelderechodelinterno.De
seguirlatesisquemantienenalgunasJuntasdeTratamientorespectodelaobligacininexcusabledequesea
esterganoadministrativoquienpropongaeladelantamiento,elJuzgadodeVigilanciaquedaraexcluidode
unadecisinqueelCdigoPenalleatribuye.Ellosupondraunaclarainfraccindelart.91CP,76.2LOGPy
loqueesmsimportante,delosarts.24.1y117.2CE(vid.AutodelJVPnm.3deMadridde23dejuniode
1997).
Enestoscasos,elJuezdeVigilanciapuedeconcederdirectamentelalibertadcondicionalsitienetodoslos
datosenelexpedientedelJuzgado;delocontrarioordenaralacrcelquealamayorbrevedadposible
realicenyremitanelexpedientedelibertadcondicional(modelonmero31).

9. Qu normas se tendrn en cuenta para el cmputo de las tres cuartas


partes, o en su caso, de las dos terceras?
Uno de los requisitos para la concesin de la libertad condicional es que hayan transcurrido tres
cuartaspartesdelacondena,odosterceras(beneficiopenitenciario).Paraelcmputodeestetiempo,
hayquetenerencuentalassiguientesnormas(art.193RP):

a)Eltiempodecondenaquefueraobjetodeindultoserebajaralpenadodeltotaldelapenaimpuestaa
los efectos de aplicar la libertad condicional. Se proceder como si fuera una nueva pena de inferior
duracin.Esdecir,siunapersonatieneunacondenade8aos,yleconcedenunindultoparcialdecuatro,las
trescuartaspartessecomputarnsobreloscuatroaosconcesinalostresaos(3/4partes).
b)Cuandoelpenadosufradosomscondenasdeprivacindelibertad,lasumadelasmismasser
consideradaunasolacondenaaefectosdeaplicacindelibertadcondicional.Sidichopenadohubierasido
objetodeindulto,sesumarigualmenteeltiempoindultadoencadauna,yserebajardelasumatotal.Es
decir,todaslascondenasseenlazanyseconviertenenunasola,sobrelaquehabrquecomputarselastres
cuartaspartesolasdosterceras.Porejemplo,siunapersonahasidocondenadaportresdelitos;porunoes
condenadaalapenadetresaos,porotroaladecuatro,yporotroaladecinco,elcmputosobreelquese
hacelastrescuartasparteses12aos9aos(3/4partes).Adems,sienunadelastrescausasdelejemplo
anteriorleconcediesenunindultoparcial,esetiemposerestarde12aos,ysobrelapenarestanteseharel
cmputodelastrescuartaspartes.
EstarefundicintienequehacerlalaoficinadergimendelacrcelyseponeenconocimientodelJuezde
Vigilancia Penitenciaria. Debemos tener en cuenta que no se trata de la determinacin del lmite de
cumplimientodelapenadelartculo76.1CP1995tripledelapenamayor,20,25,30aos),sinode
refundicinalefectodeconcesindelalibertadcondicional.
Porotrolado,LaLO7/2003sobrelareformadelCdigopenalparaelcumplimientontegrodelaspenasha
introducidounaexcepcinaestareglageneraldeaplicarelcmputo(3/4o2/3partes)paralalibertad
condicional,lapartesparalospermisosolamitadparalaconcesindeltercergradoparapenassuperiores
a 5 aos, sobre la condena resultante de la refundicin. Se trata de introducir un criterio para que las
condenas,endeterminadossupuestos,secumplanntegramente
A este respecto, en el art. 78CP se establece que cuando la pena a cumplir como consecuencia de la
limitacindelart.76CP20,25,30o40aosoeltripledelamximafueseinferioralamitaddelasuma
totaldelascondenasimpuestas,elJuezoTribunal,atendiendoalapeligrosidadcriminaldelpenado,podr
acordarmotivadamentequelosbeneficiospenitenciariosyelcmputodetiempoparalalibertadcondicional
se refieran a la totalidad de las penas impuestas en las sentencias. La aplicacin de este precepto ser
obligatoriacuandoloslmitesestablecidossegnelart.76seande25,30y40aos;serpotestativaparael
lmitede20aos.Estaaplicacinpreceptivaesunadelasinnovacionesdelanuevareforma.ejemplo,siuna
personacomete20asesinatosyescondenadoa20aosporcadauno(total400aos).Enaplicacindel
artculo76,ellmitelegalvendrafijadoen25aos.Alserinferiora50aosqueeslamitaddeltotaldelas
condenasimpuestas(400aos),elcmputodelastrescuartaspartesolasdostercerasparalaconcesinde
lalibertadcondicionalserealizarsobre100aos.Estamedidareflejalainquietuddealgunosgrupos
parlamentarios por el cumplimiento ntegro de las penas. En nuestra opinin, nos parece desorbitado e
inconstitucional(art.25.2CE)queunapersonapuedaestar40aosenunacrcel,dondelasposibilidadesde
recuperacinsonnulas,ylasdedestruccinpersonalsonelevadsimas.
No obstante, se ha previsto la posibilidad de que el Juez de Vigilancia Penitenciaria, valorando las
circunstanciaspersonalesdelreo,laevolucineneltratamientoreeducadoryeldepronsticodereinsercin
social, pueda acordar razonadamente, odo el ministerio fiscal, instituciones penitenciarias y las dems
partes,laaplicacindelrgimengeneraldecumplimientosiemprequenosetratededelitosdeterrorismode
laseccin2delcaptuloVdelttuloXXIIocometidosenelsenodeorganizacionescriminales.Paraestos
supuestos,yafindeevitarlacadenaperpetua,perocontiemposdecondenamuyelevadosposibilitaqueel
tercergradopuedaserprocedentealos32aos(cuandoquedeporcumplirunaquintapartedellmite
mximodecondena)ylalibertadcondicionalalos35(cuandoquedeporcumplirunaoctavapartedellmite
mximodecondena.Demanera,quelaregulacinestableceelcumplimientototaldelacondenaquese
convierteenunacadenaperpetua,abiertamentecontrariaalasnormasconstitucionalestalycomovenimos
observandoalolargodelaspginasdeestetrabajo.

10. Qu ocurre cuando se licencia una condena pero se sigue ingresado en


prisin cumpliendo otras?
Cuandounapersonapresatengavariascondenasdebenserrefundidasyconvertidasenunasolaparahacer
sobreellaelcmputodelas,2/3,,,partes(fechasquefigurarnenelexpedientepersonaldelinterno
(I.19/96).EsunatareaquedeberealizarlaprisinsumandolaspenasdelCdigoderogado1973ydel
nuevo 1995, de manera que si tiene alguna redencin se abonar a la suma total de condena con
independenciadecualsealacondenaalaquesetengaderechoaredencin(I3/2000porlaquesederoga
parcialmentelaI19/96).
Setratadeenlazarsucesivamenteunasyotrashaciendocoincidireldasiguientedelaextincindeunacon

eliniciodeotra.PrimerosecumplenlascondenasdelCP1973yposteriormentelasdelcdigode1995
(Disposicintransitoriaprimera,apartadocuarto),yenamboscasos,siguiendoelcriteriodegravedaddela
misma(art.75CP).Lafechadeextincindelaltimacondenadebercoincidirconlafechaqueconsteen
el proyecto de refundicin que se remitir al Juzgado de Vigilancia Penitenciaria para su aprobacin
definitiva.
Unavezrealizadalarefundicindelascondenas,laoficinadergimenestencondicionesdeefectuarlos
clculostemporales(1/4paralospermisos,delacondenaparaeltercergradosilapenafuerasuperiora
cinco aos, 2/3 como adelantamiento de la libertad condicional o3/4 partes). Esta hoja de clculo se
entregaralpenadosilosolicita.Enestosclculoshayquetenerencuentasilosmesestienen28,30o31
das y si algn ao es bisiesto. Siempre se cuenta el da completo, tanto de entrada como de salida,
independientementedelahoraenqueseproduzca.Nosepuedeolvidarqueparaloscondenadosporel
Cdigo penal de 1973, los cmputos efectivos de condena exigen deducir las redenciones ordinarias y
extraordinarias,ascomotenerencuentalasnormasreferentesalasmismasqueimpidensuaplicacin(ver
captulo9).
Porello,esimportantesabersilaoficinadergimenhaefectuadoelproyectoderefundicinysieljuzgado
lohaaprobado.Paraellohayquesolicitarlomedianteinstanciadirigidaalsubdirectordergimen.(modelo
nmero32).
EnalgunaocasinendeterminadascrcelessevanproponiendoalTribunalsentenciadorellicenciamiento
definitivodecadauna/oalgunadelascondenassegnseavanzatemporalmenteensucumplimiento.Los
JuzgadosyTribunalessentenciadoresnotienenresponsabilidadalgunaenesteproblemaporquedictanel
auto de liquidacin de condena en beneficio y garanta del reo para que no cumpla ms tiempo del
establecido en la sentencia. La responsabilidad del error recae nica y exclusivamente en los centros
penitenciariosqueproponenellicenciamientoalTribunalsentenciadorexistiendoancondenaspendientes
decumplimientoalosquesepuederefundirlalicenciada,sinquestosconozcantalextremo.Demanera
que,enocasiones, lascondenassecumplen deunaen una, oalguna condena se haquedadofuera del
cmputoglobalporhabersidopreviamentelicenciada,conelconsiguienteperjuiciorespectodelosplazos
temporales(1/43/4,2/3partes)paralaobtencindepermisosodelalibertadcondicional.Demaneraque
estos casos no se tratan de simples infracciones procesales, sino materiales, puesto que nunca debe
procederse al licenciamiento definitivo por la simple razn de que la pena extinguida debera haberse
acumuladoalasanteriorespendientesdecumplimiento(AutoAPToledode23demarzode1999yAutos
APMlagaseccin1de21deoctubrede1999y1dejuniode1999).
Existentresposibilidadesparadarsolucinaestasituacinilegal:
a)SolicitaralTribunalsentenciadorlaanulacindellicenciamientodefinitivoaefectosdequela
condenalicenciadaseacumulealrestodecondenaspendientesdecumplimientosiempre,claroest,quela
situacindeprisinseaininterrumpida desde el momento enquequedlicenciada la condena (modelo
nmero28),porquesiquedenlibertad,aunquesolamentefueseunda,larelacinentrelaadministraciny
elpresoseextingue.ElTribunalSupremoensentenciade4denoviembrede1994hasealadoquesedebe
revocarellicenciamientodefinitivodeunacausacuyoshechosfueranprximoseneltiempoalosdela
condenaquesequiererefundiralosefectosdepracticarselaoportunarectificacinenlaacumulacinde
penas,yenlanecesidaddeatenersealainspiracinconstitucionalrehabilitadoraydereinsercinsocial
Puedeocurrirque,cuandoselicencia(acabe)unacondena,lapersonasolamentequedeensituacinde
prisinpreventivaporotracausa,yposteriormenterecaigasobreellasentenciacondenatoria.Enestecaso,el
licenciamiento,queenprincipioestlegalmentehechoancuandolasituacindeprisin(preventiva)nose
hayainterrumpido,puedenosertenidoencuenta.Aesterespecto,algnJuzgadodeVigilanciahaadmitido
yordenadoalacrcelquesolicitealJuezsentenciadorlarevocacindellicenciamientodefinitivotodavez
que,sicuandoselicencilacondena,anestabasolamentepreventivoporlacausaqueseintentarefundir,
ellopudosercausaporlamayoromenorceleridaddeljuzgadoenlatramitacindelacausa(instrucciny
enjuiciamiento).Estemotivonopuedeimpedirqueelreclusosebeneficiedelarefundicin(AutoJVPnm.
2deMadridde8dejuniode1995).
b)SolicitaralJuezdeVigilanciaPenitenciariaqueanuleelactoadministrativo(acuerdodelajunta
dergimen)porelqueinstabaallicenciamientodefinitivoalJuzgadooTribunalsentenciador.SielJuezde
Vigilanciadeclaranuloeseacto(acuerdo),eslaJuntaquiendebesolicitaralTribunalsentenciador,sobrela
basedelaresolucindelJuezdeVigilancia,queserevoqueellicenciamientodefinitivoparapoderenlazar
esacausaconlasdems(modelonmero29).Estaesunasoluciningeniosaperopocoeficaz.Serams
positivoquefueseelJuzgadodeVigilanciaPenitenciariaquienanulaseellicenciamientodefinitivodeuna
causa licenciada errneamente para que pudiera ser refundida con otra u otras causas que estn
cumplindose.AsloestablecenloscriteriosdelosJuecesdeVigilancia(Criterio6,enero2003);solicitanal
ConsejoGeneraldelPoderJudicialquepropongaalgobiernolainiciativalegislativanecesariaparaquese
atribuyaalosJuzgadosdeVigilancialacompetenciaparaaprobarlalibertaddefinitiva,yaqueactualmente
latienenlosJuzgadosoTribunalessentenciadores(art.173.LOGPy242RP).

c)SolicitaralJuzgadodeVigilanciaqueelcmputodelacuartaparteparalaobtencindelos
permisos, y el de las tres cuartas partes para el de la libertad condicional se realice como si la causa
indebidamentelicenciadanolohubiesesido(AutoJVPdeCiudadRealnoconstafecha);estasolucinno
esaceptadaporlosJuecesdeVigilanciaporqueignoralaintangibilidaddelasresolucionesjudicialesdelos
Tribunalessentenciadores.PeroeselmismocriterioquesigueelTribunalSupremocuandoestableceel
lmitedecondenadelart.76CP(tripledelamayor,20,25,3).
Aunqueexistancondenasyalicenciadas,stasdebenincluirseparafijarellmitedecumplimiento;ensus
propiaspalabras:elhechodequesehayaconcedidoalpenadoellicenciamientodefinitivoporcasitodaslas
penas cuya acumulacin se pretende no constituye obstculo insalvable para la limitacin penolgica
solicitada,encasodequerealmenteprocedieselarefundicin,puesladispersindelosprocesosdelosque
traencausalascondenasylamayoromenorceleridadensutramitacinnopuededificultaroimpedirel
beneficionormativoquesuponerebajarellmitetemporaldemximocumplimientodelaspenas
d)Enalgunaocasinexcepcionalmente(AutoAPAlicante390/97de21demarzode1997)ha
establecido que la refundicin de las condenas, toda vez que el penado no ha salido de prisin, debe
comprendertambinlasyalicenciadas,debidoalaincidenciaqueellopuedateneralosefectosdelibertad
condicional,conindependenciadelgradoenqueseencuentreelinternoylasqueserefierelaoficinade
rgimen.
Ellicenciamientoerrneodelascondenastambinsuelerealizarseconmayorfrecuenciacuandounapersona
se encuentra en libertad condicional y delinque durante la misma. La oficina de rgimen solicita el
licenciamientodefinitivodelascausasanterioresutilizandocomofundamentolaimposibilidaddequeel
presopuedavolveraobtenerlalibertadcondicionalenesascausasporque,aldelinquirdurantelamisma,se
exigequesecumplaelrestodelacondenaenprisin.Comolaposiblerefundicindecondenasesaefectos
delcmputodelibertadcondicional,laoficinadergimen(asesoradoporeljurista)solicitaalTribunal
sentenciadorellicenciamientodefinitivo.EstaesunprcticaerrneayesprovocadaporlaI19/96,cuyo
criterioescorregidoporlamayoralasdecisionesdelosJuzgadosoTribunalessentenciadoresyJuecesde
VigilanciaPenitenciaria.Estoesunerrorpordosmotivos:
a) De un anlisis pormenorizado de la legislacin penal y penitenciaria no se desprende tal
limitacindeconcesindelibertadcondicional,auncuandosehayadelinquidodurantelamisma.Porello,si
laleynololimita,noexisteapoyolegalparaelactoadministrativoquehaservidodefundamentoala
resolucinadoptadaporlacrcel.Porello,eseactodelaadministracinpenitenciariaporelqueseacuerda
solicitarellicenciamientodecondenaalTribunalsentenciadoresnulo(enestesentidoelAutodelaAP5de
Madriddeabrilde1997,AutodelJVPdeBurgosde16deoctubrede1995,AutodelJVPdeCiudadRealde
6defebrerode1997.
b)Porotrolado,cuandoserefundanlascausasanterioresconlasnuevas,yanoeslamismacondena
enlaquesecometieldelitodurantelalibertadcondicional,sinootradistintaquesurgealrefundirlas
anterioresalanuevalasumadelasmismasserconsideradacomounacondena.
ComoconclusinsirvemencionarelautodelJVPdeBilbaode28.1.99queobligaalacrcelqueenlo
sucesivolascausasrevocadasdebernrefundirseaefectosdeaplicacindelart.193.2RP,yportantono
solicitarsealTribunalsentenciadorsulicenciamientodefinitivo,enaquelloscasosenlosqueconstenueva
causacometidaduranteelperododelibertadcondicionalyqueyatuvierasentenciacondenatoriafirme.
EstamismaopinintienenlamayoradelosJuecesdeVigilanciaqueensureunindeenerode2003,
establecieronqueesposibledisfrutarunasegundaoulteriorlibertadcondicionalencausasconlibertad
condicionalrevocadaenfuncindelaevolucintratamentaldelpenado,yporello,sonrefundiblesconlas
causas en las que disfrut libertad condicional, las causas sobrevenidas, sean por hechos anteriores o
posterioresalasalidaenlibertadcondicional(Criterio5).

11.Qu Juzgado de Vigilancia Penitenciaria es competente para realizar las


refundiciones?
Silarefundicinqueinicialmentesehizodelacondenasetienequemodificarporqueaparezcanotrascausas
nuevas,lecorrespondehacerloalJuzgadodeVigilanciaPenitenciariaqueejerzalajurisdiccinsobrela
crcelenqueseencuentreelpenadocuandoserecibaeltestimoniodelanuevaonuevascausas.Ahorabien,
sielpenadoestuvieradisfrutandodelibertadcondicionalytuvieraqueentrarnuevamenteenprisinporque
apareciesennuevascausaslecorresponderalJuezqueaproblalibertadcondicional.EsteJueztendrque
resolverlasquejasquesobreestetemapresenteelpenadoconindependenciadelacrcelenqueseencuentre
(Criterio1.deactuacindelosJVP,enero2003).

12. Puede acumularse la pena de arresto de fin de semana con la de prisin a


efectos de libertad condicional?
S.Puedeocurrirqueunapersonaseencuentrecumpliendounapenadeprisin,yquetambinhaya
sidocondenadoaotrasdearrestodefindesemana.Enestecaso,lapenadearrestodefindesemana

puederefundirseconlasrestantespenasprivativasdelibertadaefectosdedeterminarlas3/4partes
delacondenaparalaconcesindelalibertadcondicional.
Losmotivosdetalposibilidadsonclaros.Segndisponeelart.35CPlapenadearrestodefindesemanaes
privativadelibertad,porloqueconformealoestablecidoenelart.90CPesrefundiblealosefectosde
solicituddeconcesindelibertadcondicional.Porotrolado,esabsurdoquesiunapersonaestclasificada
entercergrado,oyadisfrutadelalibertadcondicionalseleexigieraquevolvieselosfinesdesemanaa
cumplirlapenadearrestoenrgimencerrado.Estaprcticairacontraelprincipiodeindividualizacin
cientficadelapenayvulneraraelart.25delaConstitucin(AutoAP3deOviedode9deoctubrede
1996).

13. En qu consiste el requisito de buena conducta?


Entendemosquenosepuedeexigiralapersonapresaquetengaunaconductasuperioraladel
ciudadanonormal.Lonicorelevanteparaquepuedaconcederselalibertadcondicionalrespectode
este requisito es que no tenga partes sancionadores sin cancelar. No se puede identificar buena
conductaconlatotalausenciadesancionesporquesiellegisladorlohubieraqueridohaceras,lo
hubiesedescritoexpresamenteenlaLeyoenelReglamentoPenitenciario.
Unimportantesectordoctrinalsealaque,inclusoantelacomisindedeterminadasfaltasdisciplinarias,un
estudio individualizado del preso puede aconsejar la concesin de tal beneficio. Porque, si la libertad
condicionaltienecomobaseyfundamentoelcumplimientodelmandatoconstitucionalqueobligaaorientar
laejecucindelaspenasprivativasdelibertadhacialareeducacinyreinsercinsocial,bastarconquela
personahayatenidouncomportamientomnimamentecorrecto.Puedeocurrirquelanobuenaconducta
seaconsecuenciadeunaincapacidadparavivirenprisin,peronoparavivirenlibertad(vid.entreotros,
AutodelJVPdeSevillade17defebrerode1997).

14. En qu consiste el pronstico individualizado y favorable de reinsercin


social?
Estacircunstanciashasufridounamodificacinrespectodelaregulacinanterior.Elinformedepronstico
finaltienequeseremitidoporlaadministracinpenitenciariaconformealart,67LOGPquehasidotambin
modificado en los siguientes trminos(concluido el tratamiento o prxima la libertad del interno, se
emitir un informe de pronstico final, en el que se manifestarn los resultados conseguidos por el
tratamientoyunjuiciodeprobabilidadsobreelcomportamientofuturodelsujetoenlibertad,que,ensu
caso,setendrencuentaenelexpedienteparalaconcesindelalibertadcondicional).Adiferenciadela
normativaderogada,elJuezdeVigilanciapenitenciariapodaconcederlalibertadcondicionalaunqueel
informedepronsticofinalemitidoporelCentropenitenciariofuesenegativo,todavezqueelJuezpoda
tener ms de un informe emitido por los expertos que considerase conveniente. Con esta regulacin,
obviamentelesiguecorrespondiendoalJuezdeVigilancialavaloracindeljuiciodepronstico,perover
sumargendeactuacinmslimitadoporqueelinformequedebesertomadoencuentadebeserelemitido
porlaadministracinpenitenciaria.
Esta medidasuponeuncontrol ideadopor el legislativo paraqueelMinisterio del Interiordejemenos
posibilidaddeactuacinalpoderjudicialyleamordace,olvidandoquequientienequeejecutarlojuzgado
eselpoderjudicialynolaadministracin.Setrata,comoponedemanifiestolapropiaexposicindemotivos
delaLO7/2003,dereducirelmbitodediscrecionalidadjudicialenelcumplimientodelapena.Supone,en
nuestraopininunretrocesoenlasposibilidadesdedefensadelapersonacondenada.Estamodificacinse
establecepartiendodeunapremisadeldeberserqueeserrnea:losinformesdelaadministracinse
realizanencondicionesobjetivasycientficassuficientementeaceptables.Nadamslejosdelarealidad.No
existen en la administracin penitenciaria las condiciones para que eso ocurra, pues no hay personal
suficientepararealizartalesinformesconunmnimoderigorcientfico.Lascifrasoficialesdelainstitucin
penitenciariasonclaraseneste aspecto: personasdedicadasa retencin ycustodia suponenel79%, de
administracinel8%,direccin04,tratamientoyasistenciasocialel11%,destasltimassededucenlas
deserviciosmdicos,quedaun7%delpersonaldedicadoaltratamientoquesonencargadosderealizaresos
informes.Conestepanorama,loinformessebasanendatosdelacondenaydecomportamientoenprisin,
minusvalorando otros de mayor importancia, olvidando que para poder emitir un pronstico sobre la
conductadeunapersonahabraquerealizarestudiosindividualizadosdelasinstanciassocializadorasyde
lascircunstanciaspersonalesypsicolgicasquepudieroninfluirenlaconductadelictiva;tambindebera
tenerseencuentalaevolucineneltratamiento,enloscasosenquesteexistiera,ademsdelosapoyosde
todotipoquesepudiesenfacilitaralpenadounavezenlibertad.

Enlaprctica,alnoexistirapenastratamiento,nitcnicossuficientesparalaobservacineintervencin
tratamentalestamosconvencidosquelospronsticosdudosos,quelosoncasitodospuesestamosanteun
terrenodefuturiblescomportamientoshumanos,sernnegativos.Lostcnicosquelosemitanpreferirnno
errarensupronsticodepositivoanegativo(vueltaadelinquir)ylaadministracinpenitenciaria(ministerio
delinterior)emitirloscriteriosdedecisinlomsrestrictivosposibles.Demaneraquesernexcluidosdela
concesindelibertadcondicional,enprincipio,quienesnotenganelprivilegiodehaberpodidoaccedera
algunaactividaddetratamiento,odeencontrarseenunaprisinenqueelnmerodeinternosproporcionaly
adecuadoaldelostcnicos,situacinquelamentablementeapenasexisteenalgunaprisinespaola.
Elpronsticoquepuedeemitirseesfavorable,dudosoodesfavorable.nuestraopinindeberaserpositivo
cuandounapersonaestclasificadaentercergradoyestsaliendoatrabajar.Demaneraque,cuandouna
personaestenrgimenabiertoantesdellegaralastrescuartaspartesdelacondena,larelacintercer
grado/libertad condicional ha de ser automtica. Una persona que sale a la calle, no se fuga, trabaja a
satisfaccin,esevidentequeofreceunpronsticofavorabledereinsercinsocial(EnestesentidoverelAuto
deAPSevillade17deseptiembrede1996).Peroapesardeello,enocasioneslacrcelseemiteuninforme
desfavorablepor"faltadegarantasenlaactividadlaboralquedesarrolla",sinqueseaclarencualespuedan
seresasfaltasniesasgarantas(autoAPMadrid5233/99de23defebrerode1999).
Enaquelloscasosenlosquelaconcesindelalibertadcondicionalessimultneaalaprogresinatercer
grado, una interpretacin pro reo exigira sencillamente que no se den elementos que nieguen la
posibilidaddequelapersonapresanormalicelavidaenelfuturo.Enotrocaso,estaramosquebrandola
presuncindeinocenciadefuturo.
Portanto,nosepuedepresumirunahipotticacomisinfuturadedelitossinoesatravsdedatosobjetivos
yconentidadsuficientecomoparapoderformularunpronstico;elloessiemprearriesgado.Nosepuede
invertirlacargadelaprueba.CorrespondealEquipodeTratamientodelacrcelalegarindividualizadamente
las razones para el pronstico negativo, posibilitando el control judicial, a travs de recurso, de dichos
motivossifueraninfundados.
Por ltimo, tampoco se puede olvidar la indeclinable responsabilidad de Instituciones Penitenciarias
(Organismo Autnomo de Trabajo y Prestaciones Penitenciarias), de facilitar los medios para que,
efectivamente,lapersonapuedallevarvidahonradaenlibertad,todavezqueenltimoextremoelpronstico
noes unhechodecerteza dequeunadeterminada conducta vaa darsemuyprobablemente.Ellovaa
dependerdelosapoyosqueselepresten.Noeslomismoqueaunapersonaselefacilitenapoyosmateriales,
sociales,laborales,teraputicos,queaotroquenoseleapoyedeningunamanera;posiblementeelpronstico
elprimerosermspositivoqueeldelsegundo.
Lomismopodramosdecirrespectodelaredpblicadeserviciossociales.Enotrocaso,estaramosenelcrculo
viciosodelasprofecasautocumplidas.Portanto,eleventualpronsticodelEquiposlotienelegitimidadenla
medidaqueexpresealtiempoculeseranlosmediosquesepensabanarbitrarparafacilitarlareinsercinal
liberado.
Porltimo,sealarqueesimportantequeenlaredaccindeesteartculosehayatenidoencuentaqueelJuezde
Vigilanciapuedaadmitirinformesdelosexpertosqueconsidereconvenientes.Unainterpretacinextensivadeeste
preceptonosllevaraalaposibilidaddeaceptacindeinformesemitidosporprofesionalesajenosalaprisinyque
conozcanuofrezcanseguimiento,apoyoatodoslosnivelesalaspersonaspresas.
Adems,seexige,dentrodeesterequisitoqueelpenadohayasatisfecholaresponsabilidadcivilylacolaboracin
activa contra la organizacin terrorista. Sirve para analizar estos requisitos y por no ser reiterativo, lo
expuestoenlapregunta12delcaptulo3alestudiarlosrequisitosdeltercergrado.

15. Qu procedimiento se sigue a la tramitacin de la libertad condicional?


Cuandoconcurranlosrequisitosexigidoslegalmente,conlasuficienteantelacinparaquelaconcesindela
libertadcondicionalnosufraretrasos(art.194RP),laJuntadeRgimendeberiniciarlatramitacindel
expediente.Estainiciacinsesuelehacer3o4mesesantesdequesecumplanlas2/3olaspartes.Enel
expedientedebernconstarlossiguientesdocumentos(art.195RP):
a)Testimoniodesentenciaosentenciasrecadasydelacorrespondienteliquidacindecondena.
b)Certificacinacreditativadelosbeneficiospenitenciarios.
c)Informepronsticodeintegracinsocial,emitidoporelEquipoTcnicodeacuerdoconloestablecido
enelartculo67LOGP.
d)Resumendesusituacinpenalypenitenciaria,conindicacindelasfechasdeprisincontinuadayde
lasdecumplimientodelasdosterceraspartesytrescuartaspartesdelacondena,ascomodelafechade
libertaddefinitiva.Igualmenteseindicarn,lospermisosdesalidadisfrutadosysusincidencias.
e)Programaindividualdelibertadcondicionalyplandeseguimiento.

f) Acta decompromisodeacogida por parte desufamilia,personaallegadao instituciones sociales


extrapenitenciarias.
g)Manifestacindelinteresadosobrelalocalidadenquepiensafijarsuresidenciaysobresiaceptala
tutelaycontroldeunmiembrodelosserviciossocialesdelCentro,queinformarsobrelasposibilidadesde
controldelinterno.
h)Manifestacindelinteresadosobreeltrabajoomediodevidadequedispondralsalirenlibertado,en
el supuestode que nodisponga, informe de los servicios sociales sobre la posibilidad de trabajo en el
exterior.
i)CertificacinliteraldelactadelaJuntadeTratamientodelestablecimientoenlaqueserecojael
acuerdodeiniciacindelexpedienteaqueserefiereelartculoanterior,donde,ensucaso,sepropondral
JuezdeVigilancialaaplicacindealgunasdelasreglasdeconductaprevistasenelCdigoPenal(art.195
RP).
Unavezconcluidoelexpediente,deberremitirsealJuzgadodeVigilanciaantesdequesecumplanlastres
cuartaspartesdelacondena.Eldirectordelacrceldebeexplicar,encasocontrario,elretrasodesuenvo
(art.198.2RP).Normalmenteestosplazossecumplencuandoelpenadoseencuentreeltercergrado,de
maneraquesiestaprogresintarda,eliniciodelexpedientedelibertadcondicionaltambinseretrasa.El
JuezremitirelexpedientealMinisterioFiscalyposteriormentedecidirsobreelmismo.Sieneltiempoque
medieentelaelevacinylafechadecumplimientoelpenadoobservasemalaconducta,semodificasesu
pronsticoosedescubrieraalgnerroroinexactitudenlosinformesaportadosalexpediente,elDirector
darcuentainmediataalJuzgadodeVigilanciaafindequeadoptelaresolucinqueproceda(art.199RP).
EstaresolucindeberadoptarformadeAutoysersusceptiblederecursodereforma.Eldeapelacinse
interpondr ante el Juzgado o Tribunal sentenciador (ver captulo 14). Si se aprueba el penado ser
excarceladoeldapropuesto.Sisedeniegacontinuarenprisinhastalalibertaddefinitiva.Noobstante,la
Junta de Tratamiento puede someter a revisin esta situacin y proponer nuevamente al Juzgado de
Vigilancialalibertadcondicionalcuandoloconsidereconveniente.

16. Qu ocurre si el Juez deniega la libertad condicional y el preso est en


tercer grado?
SielJuezdeniegalalibertadcondicionalelpenadocontinuarclasificadoentercergrado.Enalgunas
ocasiones,laprisinregresadegradoalhabersidodenegadalalibertadcondicionalporelJuezde
Vigilancia.Estaprcticaescontrariaaderechoy,portanto,nula(AutodelJVPdeGranadade9de
juniode1995).

17. Puede una persona extranjera disfrutar de la libertad condicional en


Espaa?
S. No hayningn impedimentolegal para que las personas extranjeras puedan cumplir esta fase de
ejecucinpenalenEspaa,aunquelasJuntasdeTratamiento,conmuchafrecuencia,nicamenteemiten
informespositivosparalalibertadcondicionalencasodequesecondicioneeldisfrutededichoperodoal
cumplimientodelmismoensupasdeorigen,argumentomspropiodeunaconcepcindeordenpblico
quedelapolticapenitenciaria(AutoAPMadrid5233/99de23defebrerode1999).Existenpersonas
extranjerasquesusvnculosestnenEspaa.Poresoelargumentoanteriormenteexpuestonosealcanzaa
entenderyaquenopuedetenermsposibilidadesdevivirhonradamenteenunpasque,ansiendode
origenlepuederesultarlejanoyhostil,ydondenoconstanitrabajoniarraigo;encambioenEspaa
trabajayviveenfamilia.
Mientrasseencuentrecumpliendolacondenaseencontrarnensituacinlegaly,portanto,nopuedenser
expulsadas.Cuandolacondenaselicencieylalibertadcondicionalfinalice,lapersonaquedarsujetaalasnormas
delderechodeextranjera.
Tambinexisteotraalternativa.SielpenadoesextranjeronoresidentelegalmenteenEspaa,serecabardelJuez
deVigilanciaautorizacinparaqueaqulpuedacumplirelperiododelibertadcondicionalenelpasdesu
nacionalidad,aunquepuededisfrutarlaenpasdistintoaldelanacionalidadoresidenciasiacreditasevinculacin
conelpaselegidoypudieseentrarlegalmenteenelmismo(conclusindelosJuecesdeVigilanciaPenitenciaria
enelcursosobregarantasdelosderechosfundamentales4deoctubrede2000).

18. Si una persona extranjera disfruta de la libertad condicional, puede ser


expulsada administrativamente?
No, salvo que la pena impuesta sea igual o superior a seis aos y el Juez en la sentencia haya
establecidoqueunavezconseguidoeltercergradoylalibertadcondicionallapenadeprisinsea
sustituidaporlaexpulsin(LO11/2003).Unacosaeslaexpulsincomoconsecuenciadelasustitucin
depenasdelart.89CP,yotraeslalibertadcondicional.Solamentepodrseexpulsadounavezque

cumplalatotalidaddelacondenaynosehayapodidoregularizarsusituacinadministrativa.
Losqueplanteanqueesposiblelaexpulsinduranteeltiempodecondicionallohacenargumentandoquese
hacedepeorcondicinalextranjeromeramenteindocumentadoquealquehasidocondenadoporsentencia
firme por la comisin de un delito; crendose, adems, una figura atpica ajena al derecho espaol de
extranjera.Sinembargo,esteargumentonotieneningunavalidez.ComosealaelAutodelJVPnm.3de
Madridde6deoctubrede1996elliberadocondicionalsiguecumpliendocondena.Nohaycreacindeuna
nuevacategoradeextranjeros,sinopersonasejerciendounderechoalalibertadcondicionalquelaley
nacionalotorgaatodoslospenados.Delocontrario,sevaciaradecontenidolainstitucindelalibertad
condicionalparaunbuennmerodepenados,ysedejarasincontenidounaresolucinjudicialAutode
aprobacindelalibertadcondicionalconinfraccindelart.117CE.

19. Qu requisitos se exigen a las personas extranjeras para poder obtener


un permiso de trabajo en el periodo de libertad condicional?
a)Reunirlosrequisitoslegalesnecesariosparasuconcesin.
b)Fotocopiadelpasaporte.
c)Precontratodetrabajo.
d) Si se trata de servicio domstico, DNI, del empleador y acreditacin de solvencia econmica del
mismo.Paraotrostrabajos,T.C.yT.C.2delaempresa.
e)AutodelJuezdeVigilanciaaprobandolalibertadcondicional.
f)CertificadodelOrganismoAutnomodePrestacionesPenitenciariasenelqueconstecundoseprev
laobtencindelalibertaddefinitiva.

20. La persona presa puede interponer un recurso de queja porque el


expediente de libertad condicional no se inicie?
S.Cuandounapersonapresahayacumplidolastrescuartaspartesdelacondena,estclasificadaen
tercer grado de tratamiento, y no le haya sido iniciado el correspondiente expediente de libertad
condicionalpuedeinterponerunrecursodequejaanteelJuezdeVigilanciaPenitenciaria.
Enestoscasos,elJuezdeVigilanciadebersolicitaraladireccindelaprisinquejustifiquelosmotivos
delretraso.Laautoridadjudicialencumplimientodelarticulo66.2g)LOGPacordarloprocedente.

21. Puede el Juez aprobar directamente la libertad condicional sin el


expediente administrativo?
CuandoenelexpedientepersonaldelpresoqueobreenelJuzgadodeVigilanciafigurenlosdatos
necesarios y suficientes para comprobar la concurrencia de los requisitos legales, el Juez puede
autorizardirectamentelalibertadcondicional,sinnecesidaddelexpedienteadministrativo.Eneste
sentidotambinsemanifiestanlamayoradelosJuecesdeVigilanciaPenitenciaria(criterionmero
57,RJVP)(modelonmero33)(AutodeJVPdeLasPalmasde27deabrilde1995).
EstasituacinesunamedidaexcepcionalquesolamenteaplicanalgunosJuecesdeVigilancia.

22. Qu ocurre si una persona presa, estando prximo el cumplimiento de las


tres cuartas partes de su condena, est an clasificado en segundo grado?
SegnelCP1995yel198RP1996,cuandounapersonahayacumplidolas3/4partesdelacondenay
observebuenaconductasehaceprecisoquelacrcelinicieelexpedientedelibertadcondicional.ste
tienequeiniciarsecomenzandoporlaprogresinatercergradoyremisinalJuzgadodeVigilanciaen
casonegativopuessehadedaroperatividadalodispuestoquesibiensesuelecalificardebeneficio
penitenciario,llegaalacategoradederechosubjetivo,parapoderdeterminarsiprocedeonosu
concesin(AutoJVPZaragozade20dejuniode1996).
Enestecaso,habrdesolicitaratravsdeunescritoalJuzgadodeVigilancia(aunquelopuedehacerel
mismoJuezdeoficio)querequieraalaJuntadeTratamientoparaqueconlamayorbrevedad,sepronuncie
sobrelaprocedenciadeproponeralaDireccinGeneralelpaseatercergradoeinicieelexpedientede
libertadcondicional.Estaresolucindebersernotificadaformalmentealapersonapresa(criterionmero
56,JVP)(modelonmero35).

23. Qu se puede hacer cuando una persona padece una enfermedad grave e
incurable, o tiene setenta aos?
Cuandounapersonapadeceunaenfermedadgraveeincurable,otienesetentaaosolosalcanceduranteel
cumplimiento de la condena, si se dan los dems requisitos establecidos con carcter general para la

concesin de la libertad condicional, excepto el de tener cumplidas las tres cuartas partes, podrn ser
propuestosparalibertadcondicional(art.92CPy196RP).Ahorabien,alreformaincorporalanecesaria
valoracindelascircunstanciaspersonalesyladificultadparadelinquirylaescasapeligrosidaddelsujeto
(Art. 92.2 CP). Este valoracin podra incorporarse en el requisito general de pronstico favorable de
reinsercinsocial;deloquesededuceclaramentequeparaestassituacionesesterequisitopuedequedar
inoperante.
Ellegisladorhamostradosensibilidadenlaregulacinparaelcasodequelaenfermedadfuesepatentepor
acreditarloeldictamendelMdicoforenseydelosserviciosmdicosdelcentropenitenciario.Enesta
situacioneselJuezdeVigilanciapenitenciariapuedeaprobarlalibertadcondicional,acordandopreviamente
y,entendemos,enelmismoauto,laprogresinatercergrado,solicitandoelinformedepronsticofinalal
Centropenitenciarioparaloscontrolesqueestableceelart.75LOGPdeseguimientoporlosorganismos
socialespenitenciarios.SeraconvenientequeellegisladorhubieraestablecidolaposibilidaddequeelJuez
pudieratenerencuentalosinformesemitidosporexpertosajenosalaadministracinpenitenciara,igualque
enlanormativaderogada.Noobstante,pensamosquesepuedenaportardeigualforma,ysertenidosen
cuentaporelJuezparasuvaloracin.Nosparecesuperfluolanecesidaddeemisindeuninformede
pronsticopositivodereinsercinsocial;asloentiendentambinlosJuecesdeVigilanciaPenitenciaria
quienesensureuninde2003instanalgobiernoparaquemodifiquenelart.92delCdigopenalalos
efectosdequenoseexijapronsticofavorablesdereinsercinsocialenestoscasos(criterio46).
Cuando los enfermos incurables sean preventivos, es el Juzgado de Instruccin quien ha de decretar la
libertadprovisional,siempreconelinformedelosEquiposmdicosdelascrcelesodeotrosprofesionales.
Para estos enfermos todava en libertad provisional y con el fin de evitar su ingreso en prisin tras la
sentenciacondenatoria,habraquesolicitaralTribunalsentenciadorlasuspensindelaejecucindela
condenasobrelabasederazoneshumanitariascuandoelestadofsicoevidenciaseunaenfermedadgrave
(art.80.4CP).Encasodequesedenegaselasuspensin,cabenotrasposibilidades.Sepodrasolicitarun
indultoporrazoneshumanitariasypediralTribunalquesuspendieselacondenadurantelatramitacindel
indulto.O,situviesequeingresar,deberaserclasificadodirectamenteentercergradoconindependenciade
lasvariablesqueintervienenenlaclasificacin(art.104.4RP).
Porotraparte,enunainterpretacinanalgicayextensivapodraaplicarseelart.60CP:Cuandodespusde
pronunciadasentenciafirme,seaprecieenelpenadounasituacinduraderadetranstornomentalgravequele
impidaconocerelsentidodelapena,sesuspenderlaejecucindelacondena....Estepreceptoposibilita
aplicacionesanalgicasporrazoneshumanitarias.

24. Quin y cmo se puede solicitar la libertad condicional por enfermedad


incurable?
Lo puede hacer la Junta de Tratamiento a instancia de los servicios mdicos. Tambin puede
solicitarlolapersonapresadirectamentealJuezdeVigilancia,oelabogado(modelonmero34).
Parasolicitarlalibertadcondicionalporenfermedadesmuyimportantehacerreferenciaadoscuestiones:
a)Enprimerlugar,hayqueexplicarlasituacinfsicaenlaqueseencuentraelenfermoatravsde
informesmdicosdelapropiaprisin,uotrosquesetengandehospitalespblicos.Sinosetienen,hayque
solicitaralmdicodelacrcelquelosrealice,oqueseaelmdicoforensedelJuzgadodeVigilancia,uotros
facultativosprivadosquepuedenserllamadosalacrceldeformaparticularporelpreso.
b)Ensegundolugar,esimportanteenloscasosenquesesolicitelalibertadcondicional,que
laspersonasquesevayanahacercargodelapersonaenfermahablenconeldirector(subdirectorde
tratamiento) o con el Juez de Vigilancia Penitenciaria a fin de exponerles la situacin y presentar
garantassuficientesqueacreditenqueesapersonavaestaratendida(seaenundomicilio,hospitalo
institucinprivada).Sielpresoenfermonotieneaningunapersonaenlacalle,tienequedirigirse,o
bienaltrabajadorsocialdelacrcelparaquelegestionealgnrecursosanitariopblico,oaalguna
asociacindeapoyoapresos.

25. Es necesario estar clasificado en tercer grado para que te concedan la


libertad condicional por enfermedad?
S.Silapersonaestclasificadaensegundogradotienequeserprogresadaatercero.Latramitacinsuele
ser lenta en la mayora de las prisiones, salvo situaciones excepcionales, en el que con un exceso de

diligencia,queporotroladoeselquesiempresedeberaponerenestassituaciones,laclasificacinentercer
gradoylaconcesindelalibertadcondicionalescasisimultnea.Enestesentidolanuevareformapenalha
establecidoparaloscasosenqueelpeligroparalavidadelinterno,acausadesuenfermedadodesu
avanzadaedad,fuerapatenteporestarasacreditadoporeldictamendelMdicoforenseydelosservicios
mdicosdelacrcel,elJuezdeVigilanciapodr,previaensucasolaprogresindegrado,autorizarla
libertadcondicionalsinmstrmitequerequeriralCentropenitenciarioelinformedepronsticofinalal
objetodepoderhacerlavaloracincorrespondienteaesterequisito(art.92.2CP).
Vaadependerdeloquetardelacrcelenrealizarelexpedientedelibertadcondicional.Noobstante,como
yahemosindicado,nohayobstculolegalparaqueelJuezdeVigilanciaPenitenciaria,encasosgraves,si
tieneconocimientodelaenfermedad(informesmdicos),ydelaspersonasquesevanahacercargodela
acogida(actaoescritoenelquesedeclaraelcompromisodeacogeralenfermo),ascomodelaexistencia
de los dems requisitos legales (tercer grado, buena conducta), pueda directamente conceder lalibertad
condicionalsinesperaralexpediente.
Enestoscasos,durantelatramitacin,convendrasolicitaralJuezdeVigilanciapermisosextraordinarios
previstosenelartculo155.4RP.
Laconcesindeltercergradoparalaposterioraplicacindelalibertadcondicionalnopuedeinterpretarse
sloenelsentidodequenicamenteesaplicableenlossupuestosenqueseaprevisibleunfallecimiento
inminenteafindequelosltimosdas,oinclusohoras,laspaseelenfermoenunambientemscercano,
sinoque,sinnecesidaddellegaraestasituacinextrema,setratadesuavizarlascondicionesdevidade
quienyapadeceunaenfermedadirreversibleyseencuentraenestadomuygrave,todoello,comodiceel
precepto,porrazoneshumanitariasyderespetoaladignidadpersonal(AutodelaAP5deMadridde22de
octubrede1997).
SielJuezdeVigilanciaseretrasaseconsiderablementeenlaresolucinsinmotivojustificado,habraque
interponerunaqueja/denunciaanteelserviciodeInspeccindelConsejoGeneraldelPoderJudicial.Lo
mismohabraquehacercuandoelretrasofuesedebidoalaactuacindelosfuncionariosdeprisiones;la
denunciahabraquehacerlaantelaDireccinGeneraldeInstitucionesPenitenciariasyanteelDefensordel
Pueblo.

26. Qu fundamentos se pueden aportar para la solicitud de la libertad


condicional para enfermos incurables?
Losargumentosquesepuedenutilizarenlapeticinhacenreferenciaprincipalmenteaquenoes
necesarioqueelenfermoestapuntodemorirparaserexcarcelado.Elargumentocontrarioeselque
sesueleutilizarporlasprisionesyalgunosJuecesdeVigilanciaparadenegarlalibertadcondicional.
Peroexistenotrosquecontrarrestanestajustificacin:
a) En estas situaciones los principios de humanidad y dignidad de las personas tienen que
predominarsobrecualquierotraconsideracinlegal.RecordemosquelaConstitucingarantizaladignidad
delaspersonasylosderechosinviolablesquelesoninherentes(art.10.1CE).Entrestosseencuentranel
derechoalavidayalaintegridadfsicaymoral;sonderechosfundamentalesmsfcilmentevulnerablesen
lacrcel,quefueradeella.Esms,laprohibicinennuestroordenamientojurdicoconstitucionaldelas
penasinhumanaspuedeversequebradasielsufrimientoinherentealaenfermedadsuponeunaadidoo
cargaadicionalalquesuponelapena,todavezqueelcumplimientodestallevaalpresoasimasdedolor
(AutoAP5de16deenerode1998).
b)Juntoalderechoalavida,ladignidadhumanareclamaelderechoaunamuertedigna.Ello
exigeunaciertacalidaddevidaantesdelamuerte.LaOrganizacinMundialdelaSalud,enGinebra(1987),
sugiriquedebeadelantarselaliberacindelosenfermosincurablesparamorirendignidadylibertad.
c)Elprincipiodepersonalidaddelapena,reconocido,almenos,implcitamenteenelart.25CE,
resultaensuintegridadsiempredemuydifcilcumplimientoencuantoquetambintercerosinocentesse
venafectadosporlaprisindelcondenado;peroesaafectacinessingularmenteduracuando,comoenel
casodelamadredelinterno,laprivacindesupresenciaactualsepresentacomoprlogodesudefinitiva
ausencia?(AutodelaAP5deMadridde16dediciembrede1997).
d)Lapenayanocumplelafinalidadderesocializacindelpenado.ElTribunalConstitucionalen
susentencia325/1994de12dediciembre,consideraquealahoradeconcederlalibertadcondicionalen
virtuddecuatrocircunstancias,aunadelascualesseledaprevalenciaabsolutarespectodelasrestantes,por
tratarsedeenfermomuygraveconpadecimientoincurable,enlaextensinqueseconsidereadecuada.En
estemismosentidolaMemoriaanualdelaFiscalaGeneraldelEstadode1991,sealquelaspenas
privativasdelibertadyanopuedencumplirsufinprimordialdeprocurarlareinsercinsocialdelpenado.
Elperiodoterminaldelavida,esunconceptoindeterminadoencuantoasuduracinquepuedesermso
menoslargo.
Desdeunaperspectivaestrictamentejurdica,segnSANCHEZCOVISA,unavezquesedlasituacinde
gravedadeirreversibilidaddelpadecimiento,habrqueatender,ademsaotrosreferentes:entrelasque
destacannoslolasreferentesalasestimacionesdeltiempodesupervivencia,sinotambin,cualquieraque

seaste,lascondicionesdesuexistencia,encuantoaunamayoromenorautonomafsicaypsquicaque
acreditenunasituacindenotoriadeficienciaeinsoportableinferioridadrespectodelrestodereclusosdetal
maneraquecarezcadesentido,concarcterdefinitivo,laprogramacindeuntratamientorehabilitadoro
resocializador, respondiendo su permanencia en prisin a consideraciones exclusivamente aflictivas y
retributivas.
Porello,pareceabsurdoorientarlaejecucindelapenaalareinsercinylarehabilitacin,esdecir,ala
convivenciaresponsableenlibertad,siesalibertadhadedurarlaspocashorasodasquemediaranentrela
excarcelacinylamuerte(AutoAP5deMadridde16dediciembrede1997).
e)Nosepuedeinterpretarenfermograveeincurableconestadopreagnico.Enfermedadgrave
conpadecimientosincurablesesaquelladolenciaquecomprometeseriamentealasalud,seaonopotencial
causa de muerte aunque por lo comn lo sea, y cuyo tratamiento con arreglo al estado actual de los
conocimientoscientficosnoseacapazdeasegurarlacuradefinitivanitampoco,porelnmerodavariables
deintervencinunaaceptablecertidumbreenelpronsticodesuevolucinqueinclusopermitaafirmar
seriamentelacronificacindeladolencia(Auto682/2000deAPMadridseccin5).
Enprincipio,elartculo196.2RPestpensadoesencialmenteparalosenfermosterminales.Sinembargo,el
conceptodeenfermoterminalnodebeserinterpretadotanrestrictivamentequepuedallegaraconfundirse
conenfermoagnicoocercanoalamuerte.Nilaletra,nielespritu,nilafinalidad,nilasistemticadelos
artculos196.2RPy92CPautorizanesainterpretacin.Esterequisitonosepuedeequipararaqueesta
puntodemorirensituacinagonizante(AutoJVPdeBilbaode24deenerode1997y26demayode1997).
Sepuedeequiparar,comosealaelAutodeAP5deMadridde16dediciembrede1997avivirenlibertad
esaltimaetapadelavidaquepuedeinclusotenerlargaduracin;unvivirqueestambinconvivirel
hombrecomosersocialdesdelosfilsofosgriegos,endefinitivasentirlavidacomoconvivenciayno
comodependenciaabsolutadeotros.Pero,adems,laconcesindeestebeneficioenlazadirectamentecon
bienesyderechosconstitucionalmenteconsagrados,loquepermitenodilatarloshastalasfasesterminalesde
laenfermedad,as,elderechoalavidayalaintegridadfsica(art.15CE).
Comoessabido,elSIDAactualmentenopuedeconsiderarsetodavacomounaenfermedadcrnicaconla
queseviveydelaquenosemuere.Perohoyporhoyhadeentendersequelainmunodepresinsevera
facilita invasiones de agentes patgenos que provocan infecciones o enfermedades oportunistas que en
principiosondemsfcilcontagioenlugaresdeobligadaconvivenciacolectiva,ymssielestadosanitario
mediodelosinternosmuyfrecuentementedelosmsdbilessocialmente,marginados,toxicmanoses
inferioraldelaspersonaslibres.
Enconsecuencialalibertadcondicionalesparaenfermosgravesnoparacadveresque,contrapronstico,
analientan((Auto682/2000deAPMadridseccin5)
f)Asimilacindelaconcesinparaseptuagenariosyenfermosgraves.ComoafirmaelAutodel
TribunalSupremode19deagostode1988,elcitadopreceptocontemplalossupuestosenquelosreclusos
bienacausadesuedadavanzada,bienacausadeunpadecimientogravedepronsticofatal,seencuentra
yaenperiodoterminaldesuvida.DemaneraqueelTribunalSupremointerpretaambassituacionescomo
similares.Esevidentequeunapersonaseptuagenarianoseencuentraenpeligroinminentedemuerte,porlo
que no hay que exigirle esa condicin al enfermo muy grave con padecimientos incurables, pues su
fundamentacineslamisma:quelaprivacindelibertadnoaumentesusefectosaflictivosenelperiodoms
omenoslargoperoincontestablementeterminaldesuvida.
Enestesentidolasentenciade12deseptiembrede1992laSalaSegundadelTribunalSupremodeclar:
pero,entodocaso,laposturaqueadoptelMagistradoJuezdeVigilanciaPenitenciariaaparececonforme
coneltenorliteraldelprecepto(elSIDAyadesarrolladoconpronsticodefallecimientoacortoplazo
cumple,sinduda,losdosrequisitosexigidos,puessetratadeunaenfermedadquees,altiempo,muygravee
incurable)ytambinpareceacordeconlafinalidadhumanitariadetalformaquepermitiraadelantarla
excarcelacinaalgnmomentoanterioraldelamuerteinminente,puesquizsdebieraentendersequenoes
elpropsitodeesteartculodelReglamentoelquepuedansacarsedelaprisinalosenfermossloparaque
mueranfueradelacrcel,pareciendo,porelcontrario,lomsadecuadoalespritudeestadisposicinelque
pudieranpermanecerenlibertadalgunatemporadaanterioralmomentodelfallecimiento;ansabiendo
quelaleynobuscalalibertaddelosagonizantes,puesaelloslesestvedadoporesenciaelhacervidaen
libertad. Sobrevivir agnicamente no es vivir, no es vivir en convivencia, no permite una suficiente
capacidaddeautodeterminacinenmuchoscasoscomoparahablardelibertad(AutodelaAP5de26de
febrerode1998).
g) Porotrolado,elrequisitodelaexistenciadeunpronsticoindividualizadoyfavorablede
vidahonradaenlibertaddebeanalizarseconprudenciayelasticidad (AutodeJVPdeCastillaLen
nm.1de26dejuniode1996)ynopuedeeludirsecomosinoexistiera.Ahorabien,losJuecesdeVigilancia
Penitenciariaensureuninde2003instanalgobiernoparaquemodifiquenelart.92delCdigopenalalos
efectosdequenoseexijapronsticofavorablesdereinsercinsocialenestoscasos(criterio46).Eneste
sentidosemanifiestaelAutodelaSeccin5delaAPMadridde16deenerode1998,cuandoexpresa:
pues en una tierra comola nuestra ms proclive a buscar culpables que soluciones, el miedo al error
siempreposibleenesepronsticopodratenerefectosparalizantesquejamsnadiearriesgaraelvaticinio
salvoenlossupuestosdeenfermedadesenfasestanavanzadasytanterriblementeincapacitantesenque

pudieraafirmarselaimposibilidadfsicadedelinquir.
Yelloseratantocomoreducirelbeneficiodelalibertadcondicionalalderechoasobreviviryaagonizarya
morir, como si la libertad, por condicional que sea sta, fuera un concepto compatible con tan pobres
extremosynoseextendieraalacapacidaddeconvivencia,dedar,ademsderecibir,ydeintegrarseloms
plenamenteposibleenlasociedadalaquesiempreseafirmaqueelpresonohadejadodepertenecer.En
este caso, se concedi la libertad condicional porque el preso padeca enfermedades gravsimas y
sufrimientos incurables, su capacidad criminal atenuada, pronstico de vida no muy largo y ambiente
familiardeacogidaresponsable.Elriesgodeacordarlalibertadcondicionalesasumibleysobretodoes
preferiblealriesgo,sinoyalesin,deestarsometiendoaunpresoaunapenaqueporsuscircunstanciases
inhumanoquecumpla.Puesslolafuncinretributivadelapenapuedeexplicarlapresenciaenprisinhasta
lapreagonaylaretribucinsumadaalaenfermedadseracruel,ycarecedesentidoorientaralareinsercin
aquienslohubieradesalirdeprisinparaagonizarymorir(AutosdelaAP5deMadridde16deenerode
1998yde16dediciembrede1997).
Elriesgodecomisindedelito,comomsarribaindicbamos,existe.Setratadehacerunavaloracin
respectodelasituacinfsicaenqueseencuentra,yentodocaso,defijarunoscriteriosdeintervencinpara
evitarenlamedidadeloposiblelacomisindenuevosdelitosque,ademsdecausarlesionesenotra
personainocente,elpresoseveracondenadoaingresarnuevamenteenprisin.
Conelobjetodelimitaralmnimolasposibilidadesdecomisindedelito,yafindequeelpenadorespetela
leypenalpronsticofavorabledereinsercinsocial,esconvenientesolicitardeljuzgadodevigilanciaode
laaudienciaprovincialsisellegaenvaderecursodeapelacin,algunasreglasdeconductadelart.105del
Cdigo penal: tratamiento ambulatorio de deshabituacin de droga (si fuese drogodependiente), la
prohibicindeacudiralugaresenqueseapblicoynotorioquesecomerciacondroga,ylacustodiafamilar.
Aestosefectoshabraqueaportarinformedeuncentrodetratamientodedrogodependencias(puedeserde
metadona) en el que conste que el penado tiene plaza de ingreso y que se comprometen a realizar un
seguimiento;aportardocumentoenelqueconstelosmediosdevidaquetendrelpresounavezquesalgaen
libertad(pensiones,subsidios,ayudafamiliar);ycompromisodefamiliarescercanosoasociacionesdapoyo
deuncompromisodeacompaarleenelproceso..
Enlaprctica,algunaslibertadescondicionalesseconcedensolamenteparaquelapersonapresamueraenel
hospitaloduranteeltrasladoaestelugar.Deestaformaelfallecimientonosecontabilizaenlasestadsticas
penitenciariascomomuerteenlacrcel.

27. Qu datos constan en el informe del mdico de la prisin por el que se


solicita la libertad condicional anticipada?
LosdatosserecogenenunmodelotipoelaboradoporlaI5/99DGIP.datosdelenfermo,enfermedad,fecha
de diagnstico, si se encuentra hospitalizado, pronstico actual estimado (terminal, desfavorable a corto
plazo1ao,desfavorableamedioplazo1a5aos,desfavorablealagoplazo5a10aos,establea
largoplazo.Calidaddevidaactual,variablessegnndicedeKarnofsky(normal,sinevidenciasdela
enfermedad;capazdemantenerunaactividadnormal,presentasignosmenoresdeenfermedad;actividad
normalconesfuerzoconalgunossignososntomasdeenfermedad;puedecuidardesmismoperoincapaz
dedesarrollarunaactividadnormalotrabajar;requiereasistenciaocasionalmente,seresuelveporssolola
mayora de sus necesidades; requiere asistencia importante y atencin mdica frecuente, discapacitado;
requierecuidadosespeciales;severamentediscapacitado,estindicadasuhospitalizacin,sumuertenoes
inminente;muyenfermo,hospitalizacinnecesaria,requieretratamientodesoporte;moribundo,pronstico
rpidamentefatal.
EstaInstruccinsemodificporla1/2000DGIPenlaqueseestablecieroncomocriteriosparaconsiderar
queunapersonapadeceunaenfermedadmuygraveelcumplimientodealgunodelossiguientesrequisitos:
- Riesgodemuerteestimadosuperioral10%enelplazodeunaoapesardeltratamiento.
- Riesgodemuerteestimadosuperioral50%enelplazode5aosapesardeltratamiento.
- IndicedeKarnofskymenoroigualal50%.
- InfeccinporVIHenestadioA3,B3oC.
- Transtornopsicticocrnicoconactividadsintomticaapesardehaberseguidotratamientodurante
msdeseismeses,ocondeteriorointelectual.Enestecaso,esobligadoquesefundamenteenun
informepsiquitricoprevioenelqueserecojanlascondicionesparticularesparalaacogidayen
concreto si es necesario el ingreso del interesado en un centro especial, psiquitrico
extrapenitenciariouotro,loquedebersercomunicadoaljuezcompetente.

Paralavaloracindelpronsticovital,sesolicitarelasesoramientodelespecialistadereferenciaquese
estimeoportuno(I1/2000DGIP).Estavaloracinserealizarcadavezqueseproduzcaundeteriorodesu
situacinclnicayensudefectocadaseismeses,emitiendounnuevoinformequeactualiceelpronstico
vitalyelgradodedeteriorofuncional.LomismoocurrirconlospresospreventivosqueelJuzgadode
Guardiadecidamantenerlaprisinpreventiva.

28. Qu condiciones personales, emocionales y materiales se exigen en el


acompaamiento a las personas en los ltimos periodos de vida?
Elltimoperododelavidadeunserhumanoeselmsdifcildeafrontarfsicaypsquicamente.Ello
exigeunascondicionesemocionales,materialesypersonalesquesonincompatiblesconlasituacinde
reclusin.
Elacompaamientodeenfermosgravesconpadecimientosincurablesnopuederealizarsedelaformaque
posteriormentesevaadescribirdebidoalascondicionessociolgicasdeviolenciaenquesesustentael
internamiento penitenciario. Ello supone una vulneracin del derecho a un tratamiento individualizado
garantizado en las normas penitenciarias que tambin puede ser utilizado como argumentacin para la
peticindelalibertadcondicionalanticipada.Enconclusin,nosolamentesedebeconcederporelriesgo
fsicodemuerteenqueseencuentraelpreso,sinotambinporlanoasistenciapsicolgicanecesariay
vulneracindelderechoauntratamientoindividualizado.
Lasorientacionesbsicasparaestetipodeacompaamientospuedenserlassiguientes:
a)Setratadeacompaarfomentandoelsentidodecontrolydisminuyendoelsentimientodeindefensin.
Eselnicoprotagonistadesuhistoria.
b)Aceptaryrespetaralaspersonastalycomoson,consusopcionesdevidaconcretas.Atentosano
proyectarnuestromundodevaloresenpersonastanvulnerablesporsusituacin.
c)Asegurarquelaconfidencialidadsemantiene.
d)Informarleenrelacinconlasopcionesdisponibles.Mientrasnosedemuestrelocontrarioenunsujeto
autnomo,capazdetomardecisionesacercadeloqueocurreensuvida.
e)Afrontarsuspreocupacionesomiedosenelmbitodelofsicofuncional(dolorfsico,prdidade
autonomafuncional,desfiguracin),enelmbitorelacional(serunacarga,separacindelosseresqueridos,
elrechazo,abandonoyaislamiento),oenelexistencial(lodesconocido,serjuzgado,lasoledadnoquerida,
dejarseser,perderelcontrol).Laformadellevaracaboesteacompaamientoserealizaanticipandola
normalidad de sus miedos y preocupaciones, identificndolos, ayundndole a distinguir si son reales o
imaginarios, relacionales o irracionales, facilitando estrategias previas de afrontamiento en situaciones
anlogas.
f)Mantenersiempreunaesperanzarealista,enclavedeensancharlaesperanza.Siemprehayalgoquese
puedehacer.
g)Garantadesoporte:necesitasaberquequieneslecuidannoleabandonarnnunca.
h)Manejarlaspreguntasdifcilesydolorosas,siempreenlneadeproceso,dicindoletodoloquequiere
saberysloloquequieresaber,desdeelapasionanteartedeexplorardemanerapersonalizada,sistemticay
respetuosaculessonsuspreocupacionesynodandonuncaporsupuesto.
i)Trabajaranticipadamenteeldueloparaprevenirduelospatolgicos.

29 Cmo se realiza el control del liberado condicional?


ElcontrollorealizanlosserviciossocialespenitenciariosatravsdediversasactuacionesrecogidasenlaI7/98de
4 de diciembre,sobre manualdeprocedimiento delaslneas de actuacin deltrabajo social.Semantienen
entrevistasconelliberadocondicional;secumplimentanlasfichasdecontrolcorrespondientes;secontrolala
ejecucindelasreglasdeconductasimpuestas;seexigequeseinformealJuezdeVigilanciassobrelasincidencias
queseproduzcan;sedeberealizarunseguimientoespecficoacondenadospordeterminadosdelitos,necesaria
coordinacinconlasoficinasdergimendelcentropenitenciariodereferenciaysetienenqueconfeccionar,
mensualmente,lasestadsticassobreliberadoscondicionales.

30. Qu se puede hacer si el Juez de Vigilancia no concede la libertad


condicional?
EnestoscasossedebeinterponerrecursodereformaanteelmismoJuzgadodeVigilancia.Sisedesestimahayque
interponerunodeapelacinanteelJuzgadooTribunalSentenciador(sepresentaenelJuzgadodeVigilancia),pero
paraello,hayquepedirabogadoyprocuradordeturnodeoficio,ycuandoelagentejudicialnotifiqueenlacrcel
laresolucindelJuezdeVigilanciahayquedecirquesesolicitalasuspensindelplazopararecurriryquese

nombreabogadodeturnodeoficio;posteriormenteesamismaafirmacinhayquehacerlaporescritoymandarlaal
JuzgadodeVigilancia.
Losdosrecursossepuedeninterponerenunosolo;peroesconvenientehacerloporseparadoporqueenel
recursodeapelacinpuedesolicitarselaprcticadepruebasqueacreditenlaexistenciaderequisitoslegales
paralaconcesindelalibertadcondicional(modelonmero27),oaportarnuevosinformesmdicos.

31. Cunto durar la libertad condicional?


Elperiododelibertadcondicionaldurartodoeltiempoquefaltealapersonaparacumplirlacondena,
siempre que durante ese periodo no se delinca o se incumplan las reglas de conducta que hayan sido
impuestas.SiestoocurrieraelJuezdeVigilanciarevocarlalibertadcondicionalconcedidayelpenado
reingresarenprisinenelgradooperododecorresponda.Secomputareltiempopasadoellibertad
condicional(art.93.1CP)
EnloscasosdeterrorismoelJuezdeVigilanciapodrsolicitarlosinformesquepermitanacreditarque
subsistenlascondicionesquepermitieronobtenerlalibertadcondicional.Sienesteperododelibertad
condicionalelcondenadodelinquiera,inobservaralasreglasdeconductaoincumplieralascondicionesque
lepermitieronaccederalalibertadcondicional,elJuezdeVigilanciarevocarlalibertadconcedida,yel
penadoreingresarenprisinenelperodoogradoquecorrespondaconlaprdidadeltiempopasadoen
libertadcondicional(art.93.2.3)
Elrequisitodelacomisindedelitosestableceunadobleexigencia.Porunlado,queloshechosdelictivosse
hayancometidoduranteeseperiodo(AutoAPMadrid,5,de28defebrerode2003),yquelacondena
dictadaporlosmismossehagafirmeduranteeltiempodelibertadcondicional.Demaneraque,sielperiodo
de libertad condicional finaliza, y la condena se licencia, aunque posteriormente recaiga sentencia
condenatoria,lalibertadcondicionalnopuedeserrevocadaporquelacondenayaestcumplida(Autodel
JVPdeCastillayLennm.1de18denoviembrede1994).Convienerecordarqueelcumplimientodela
condenaesunadelascausasdeextincindelaresponsabilidadpenal(art.130.2CP1995).Elloimplica,
comoconsecuencia,queenlamayoradeloscasoslarevocacinesineficazporqueellodependerdela
mayoromenorceleridadenlatramitacindelacausaobjetodelacomisindeldelito
Porotro,unainterpretacingramaticaldeltrminodelinquiere,exigequelacondenaseapordelitoyno
porfalta.Amayorabundamiento,seraaconsejableporrazonesdepolticacriminalunainterpretacinms
extensaenelsentidoqueseimpongalarevocacinsolamenteenlacomisindedelitosdolososynoenlos
imprudentes.Enestemismosentido,comosealaTAMARITSUMALLA,larevocacinsepodrhacerdepender
de la naturaleza del delito y de las expectativas de rehabilitacin de la persona un ejemplo de
disfuncionalidad de la revocacin sera el condenado a una pena larga con buenas expectativas
resocializadorasqueencontrndoseenlibertadcondicionalcometeundelitoimprudente.
Unsegundomotivoderevocacindelalibertadcondicionaleslainobservanciadealgunadelasreglasde
conductaencasodequehayansidoimpuestas(art.105CP).Estanuevaredaccinvieneamodificarla
expresinmalaconducta(CP1973)quehasidomuycriticadaporladoctrinaporlaambigedadyfaltade
objetividad.Sibienenelproyectode1992desaparecilareferenciaalamalaconducta,enelanteproyecto
de1994,volviareaparecer.GraciasalinformedelConsejodelPoderJudicialalAnteproyectode1994que
localificdeunretrocesopococompatibleconlosartculos59LOGPy237RP,quefijancomoobjetivodel
tratamientoelrespetoaleypenal,esetrminodesapareci.
Laapreciacindeestacausaderevocacinnoexigeunacondenafirme,sinouninformedelosservicios
socialesencargadosdeejecutarlaregladeconductacomunicandoelincumplimientodelasmismasalJuez
deVigilanciaafindequeesteadoptelaresolucinquecorresponda(art.201.2RP).Enestossupuestosse
exigequeexistaregladeconductaenelautodelibertadcondicionalporquedelocontrario,aunquelos
serviciossocialesinformensobreunseguimientonegativo,sinoexistetalregladeconducta,noprocedela
revocacin(AutoJVPdeZaragozade8/11/99).
Puedeocurrir,queunapersonaestenundeterminadoCentroderehabilitacindedrogodependientes,ysilo
abandonase,lalibertadcondicionalpuedaserrevocada.Seraconvenientequeenelcasodequeelpenado
ingresase en otro centro distinto no se revocara la libertad condicional, sino que se permitiera el
cumplimientoenesenuevoCentroderehabilitacin.Noolvidemosquenotodoslosdrogodependientes
presentanperfilesqueencajenenalgunoscentrosderehabilitacin.Paraellohubiesesidoaconsejablequeel
legisladorhubiereprevistounaremisinalaregulacingeneraldelasmedidasdeseguridad.Enconcreto
podrahaberprevistolaposibilidaddeextinguir,suspender,osustituirunasmedidasporotras,oalmenos,
por analoga ala regulacin de la suspensin condicional de la pena con aplicacin de una medida de
seguridadduranteelplazodesuspensin(art.84.2CP),laposibilidaddesustituirlamedidaimpuestapor
otra.
Noobstante,sialgunapersonaseencuentraconunasituacinsimilarhayquesolicitaralJuezde
Vigilanciaquenorevoquelalibertadcondicionalyquepermitasustituirlaporotra,porremisin

analgicaalanormativapenaldelasmedidasdeseguridadanteriormentemencionada.

32. Qu ocurre si la libertad condicional se revoca?


Silalibertadcondicionalserevoca,alreingresoenprisinleserdeaplicacinelrgimenordinario
hastaquelaJuntadeTratamientoprocedaasunuevaclasificacin.Delaredaccindelartculo201.3
delReglamentonosedesprendequeelpenadonopuedavolveraobtenerlalibertadcondicionalenesa
condena,sinoporelcontrario,elcarcterprogresivodejalaspuertasabiertasaunanuevaconcesin
delalibertadcondicional.

33. Qu ocurre si una vez aprobado el expediente de libertad condicional,


pero sin haber salido todava, tiene que cumplir una nueva condena?
Estasituacinpuededarsecuandounavezaprobadoelexpedientedelibertadcondicional,lapersona
presaannohasidoexcarceladayserecibeenlacrceleltestimoniodeunasentenciacondenatoria
queannoerafirmecuandoseelevelexpedientedelibertadcondicionalalJuezdeVigilanciaporla
causaqueestabacumpliendo.Enestoscasosdeberactuarsedemodomsfavorablealapersona
presa.
Seprocederporlacrcelalarefundicindelanuevacondenaconlaanterioroanteriores,deformaquese
apliqueelarticulo193.2RP.SevolveraremitiralJuezdeVigilanciaunanuevapropuestaampliatoriadela
anteriorparaqueseacumulelacondenaocondenasquequedanporcumplir.Deestamaneralafechade
licenciamientoseverampliada.Siapesardelasumadelanuevacondena,eltotalcumplidoexcededelas
trescuartasparteso,ensucaso,delasdosterceras,seprocederaelevarurgentementeyvafax,propuesta
deacumulacindecondenasysimultneapropuestadeampliacindelalibertadcondicionalyaconcedidaa
unanuevacausa.
Encasocontrario,silasumadelascondenasnosuperalastrescuartaspartesolasdosterceras,lanueva
liquidacindecondenasepondrenconocimientodelJuezdeVigilanciaparaquedejeensuspensode
libertad condicional concedida. Deber iniciar el cumplimiento de la nueva condena en el grado que
corresponda,que ordinariamentesereltercero sinohahabidoincidenciaseneldisfrutedelalibertad
condicional;serefundiralasanterioresycuandoseaproximeelcumplimientodelastrescuartasparteso
delasdosterceras,seelevaralJuezdeVigilanciaelnuevoexpediente(vid.AutodelJVPdeCastillaLen
nm.1de22deoctubrede1991).Unavezaprobadoste,lapersonapresaserexcarceladaalcumplirlastres
cuartas/dosterceraspartesdelatotalidaddelascondenasimpuestas.
Enloscasosenquelalibertadcondicionalsedisfrutaporaplicacindelart.92CP(enfermedadgrave)se
acumularlanuevacausaentodocasoconindependenciadelasfechasdecumplimiento(AutoJVPdel
PuertodeSta.Marade3deoctubrede1997).

34. Qu ocurre cuando una condena por un delito cometido con anterioridad a
la concesin de la libertad condicional se hace firme y el penado ya
estuviera disfrutando sta?
EnprincipiodeberingresarenlacrcelparacumplirconelmandamientodeprisindictadoporelJuzgado
oTribunalsentenciador.EsteingresopodrahacerseenloscalabozosdelosJuzgadoscuandoestosdependan
deInstitucionesPenitenciarias,yaqueaestosefectospuedenserconsideradoscomoCentrosPenitenciarios
aldependerdeInstitucionesPenitenciarias.Deestamanera,sifueseposiblelaampliacindelalibertad
condicionalenlostrminosqueposteriormenteseexpresarn,seactuarcongranrapidez.Delocontrariolo
msconvenienteseraingresarenunaCISyqueseapliqueelart.86.4talycomoestablecelaI13/2001los
reingresosmotivadosporcausasjudicialesanterioresalaobtencindelalibertadcondicional
Enestoscasoslasolucinessimilaraladelacuestinplanteadaanteriormente.Elnuevoingresodeber
ponerseenconocimientodelJuezdeVigilancia.LacrcelsolicitardelJuzgadooTribunalsentenciadorala
mayorbrevedadlaliquidacindecondena.Siunavezsumadoseltiempoefectivodecumplimientoyla
nuevacondenasesobrepasalastrescuartaspartesoensucasolasdostercerasdeltotal,elJuezdictarun
Autoampliandolalibertadcondicional.Encasocontrario,sesuspendehastaquesealcancenlastrescuartas
partesoensucasolasdosterceras.

35. Si una persona en libertad condicional tiene que volver a entrar en prisin
para cumplir condenas antiguas se le puede regresar a segundo grado?
No,deningunamanera.Enlaprctica,enestoscasosenlosquelapersonatienequevolveraingresaren
prisinporunacondenaantigua,laJuntadeTratamientonosueleprocederalaregresindegrado.
Noobstante,lanuevaregulacindelartculo201.3estableceque,encasodequeserevoquelalibertad
condicional,lapersonareingresarenprisinyleserdeaplicacinelrgimenordinario,hastaunanueva
clasificacin;hayquetenerencuentaqueenestoscasosnoexisterevocacindelibertadcondicional,sino

suspensindelamismaalosefectosdeposibleampliacin.Porello,sielpenadotuviesequeentraren
prisinseharentercergrado(AutodeCiudadRealde11deabrilde1995).

36. Qu ocurre si el liberado condicional ingresa en la crcel como preso


preventivo?
La prisin comunica el ingreso al Juzgado de Vigilancia, y ste acuerda la suspensin de la libertad
condicionalhastaqueseresuelvaloprocedentesobrelaprisinpreventiva.
Una vez decretada la libertad provisional si no se hubiese revocado la libertad condicional por
incumplimientodelaregladeconductaimpuesta(ensucaso),lapersonapresadeberquedardenuevoen
libertad.Siduranteelcumplimientodelalibertadcondicionalsedictaselasentenciayfuesecondenatoria,
procederlarevocacindeaquellayelconsiguienteingresoenlacrcelparacumplirloquequedede
libertadcondicionalylanuevacondena(AutoJVPPuertodeSta.Marade20demayode1997).

37. Qu son los beneficios penitenciarios?


Sonlasmedidasquepermitenlareduccindeladuracindelacondenaimpuestaensentenciafirmeo
deladeltiempoefectivodeinternamiento.Suobjetivoesconseguirlareeducacinylareinsercindel
penado(art.203RP).

38. Qu factores se tienen en cuenta para la concesin?


Legalmentelabuenaconducta,eltrabajo,laparticipacinenactividadesdereeducacinyreinsercin
social;ascomolaevolucinpositivaenelprocesodereinsercin.Enlaprctica,yconfrecuencia,se
utilizarncomoelementosdeconseguirlasumisinaladisciplinapenitenciaria.

39. Qu clases de beneficios penitenciarios existen?


Slosontres(arts.205,206RP,91CP).Eladelantamientodelalibertadcondicionalalasdosterceraspartes
delacondena,eladelantamientode90dasporaoefectivamentecumplidoapartirdelamitaddela
condena y la concesin de un indulto particular en la cuanta que aconsejen las circunstancias, previa
propuestadelEquipoTcnico,cuandoenlaspersonaspresasconcurrandemodocontinuadoduranteun
tiempomnimodedosaosyenungradoquesepuedacalificardeextraordinario,todasycadaunadelas
siguientescircunstancias:
a)Buenaconducta.
b)Desempeodeunaactividadlaboralnormal,bienenelestablecimientooenelexterior,quesepueda
considerartilparasupreparacinparalavidaenlibertad.
c)Participacinenlasactividadesdereeducacinyreinsercinsocial.
Enelsupuestodeadelantamientotienequeexistirunacuerdodeiniciacindeloportunoexpedientede
libertadcondicionalanticipada(art.195RP),unavezconcluidoelexpedienteenelquesedebenincluirlas
valoracionespertinentessobreactividadesycomportamientosseelevaalJuzgadodeVigilanciapenitenciaria
proponiendolaconcesindelelibertadcondicional.Siesaprobado,unavezllegadoalas2/3partesel
penadoquedarenlibertad.
Latramitacindeesteindultoserealizarsegnelprocesoestablecidoenlalegislacinvigente.

40.- Qu documentos y objetos se tiene que entregar a una persona


cuando queda excarcelada?
Cuandolapersonaquedeexcarceladalacrcelemitiruncertificadoenelqueconsteeltiempoqueestuvoen
prisin,odelasituacindelibertadcondicional,ysilosolicitaelpenadouninformesobresusituacin
sanitariaypropuestateraputica.Endichoinformenoconstarningunareferenciaqueindiquequehasido
expedidoporunCentropenitenciario.Sicareciesedemedioseconmicos,laadministracinpenitenciariale
darlosnecesariosparallegarasuresidenciayhacerfrentealosprimerosgastos(art.30RP).Adems,sele
debeentregarelsaldodelacuentadepeculio,losvaloresyefectosdepositadosasunombre,laasistencia
socialnecesaria,laprestacinpordesempleoylarehabilitacinplenaalejerciciodesusderechoscomo
ciudadano

41. En qu consiste el sistema de evaluacin e incentivacin?


LaInstruccin8/99de20dejulio estableceunsistemaparapotenciarlamotivacindelospenadosysu
participacinenlasactividadesdetratamiento.

ParaelloseconfeccionaunCatlogoUnificadodeActividades,preparadoporlaJuntadeTratamientoy
aprobadoporelConsejodeDireccinbasadoenelsistemadecertificacinencrditos(1crditoequivalea
40horasdeactividad)quesepuedencambiarporcomunicacionesocomoevaluacinpositivaalahorade
obtenerpermisosodemsbeneficiospenitenciarios.

42Qu ayudas existen para las personas excarceladas?

.
Los liberados de prisin pueden beneficiarse del subsidio por desempleo siempre que se cumplan los
siguientesrequisitos:
Inscribirsecomodemandantedeempleoenelplazodeunmesdesdelafechadesuexcarcelacin.
No haber rechazado oferta de empleo adecuado ni haberse negado a participar, salvo causa
justificada,enaccionesdepromocinoreconversinprofesional,enelplazodeunmes.
Carecerderentasdecualquiernaturaleza,superioresal75%delSalarioMnimointerprofesional,
excluidaslaspagasextraordinarias.
Notenerderechoalaprestacincontributiva.
Quelaprivacindelibertadhayasidosuperioraseismeses.Esindiferenteaestosefectosquehaya
estadopresopreventivoocondenado.Estosseismesestienenqueserininterrumpidos.
Laprestacinpordesempleotendrunaduracindeseismeses,prorrogablesporotrosdosperodosdeigual
duracin,hastaunmximodedieciochomeses.Lasolicitudseformalizarenelplazodequincedas,una
veztranscurridoelmesdeespera.Setienequeaportarlasiguientedocumentacin:
D) FotocopiadelDNIopasaporte.
E) Fotocopiadelacartilladelaseguridadsocialsisedisponedeella.
F) Justificantederentas.
G) Justificantedelperodotranscurridoenprisinydelafechadesuexcarcelacin.Sisehaperdido
hayquevolveralcentropenitenciarioparasolicitarunonuevo.

43.Existen otras ayudas econmicas a la excarcelacin?


S.LaInstruccin4/2003, establecelassiguientesayudasquesedebernotorgaralaspersonasreclusas,
liberadoscondicionalesyalasfamiliasdeunosyotrosparapropiciarsureinsercinsocial,siemprequeno
tengancoberturaporpartedelosserviciossocialesnormalizados:
Ayudas asistenciales: Por cuanta mxima de 300 euros (ampliables excepcionalmente) a liberados
condicionales,reclusosyfamiliaresdeunosydeotros,cuandolosserviciossocialesnormalizadosno
hayapodidohacersecargodeesaprestacin.Deloquesededucequeprimeramentehayqueacudiralos
serviciossocialesdelbarrioopuebloderesidenciaysinohayayudaeconmica,solicitarloenlos
servicios sociales penitenciarios dependientes del Organismo Autnomo trabajos y prestaciones
penitenciariasoaltrabajadorsocialdelacrcel.steelevarpropuestaalDirectorparaqueautoricela
ayudaconelvistobuenodelCoordinadordetrabajosocialojefedeServicioSocialExternosegn
proceda.
Ayudasaliberadoscondicionalesodefinitivosenelmomentodelaexcarcelacin:Alosliberados
espaolesselesentregarunmximode30euros/nochesipernoctanantesderegresarasudomicilioy
3000pts/dacomodinerodebolsillo,ascomoautobsdelneacuandonoexistaserviciodeRENFEy
billetedeavinensucasoporrazonesgeogrficas;pagodetaxi,porrazoneshorariasogeogrficaspara
enlazarconeltransportepblico.Elrequisitoescarecerdeingresosnecesariosparallegarasulugarde
residencia;noesaplicablealosextranjerosalosqueseaplicalaexpulsin.
Ayudasdegastosfunerariosdereclusosyliberadoscondicionalesfallecidossiemprequelosfamiliares
acreditenquecarecendemedioseconmicospropiosofamiliares,conunlmitemximode1.800euros.
EltrabajadorsocialelevarlapropuestaalDirectorparaqueautoricelaayuda,conelvistobuenodel
Coordinadordetrabajosocialodeljefedelserviciosocialexterno.
Ayudaparalagestindedocumentacinatodoslosinternosquecarezcandelmismoydemedios
econmicos.
Ayudasparatransporteconelfindepropiciarlainsercinsociolaboraloprogramasdetratamiento
sociosanitario ambulatorio. Tambin para los clasificados en tercer grado para la realizacin de
gestionespuntuales,encaminadasasuinsercinsociolaboral.

Captulo 6

LOS PERMISOS DE SALIDA

1. En qu consisten los permisos de salida?

Lospermisosconsistenenlaexcarcelacintemporaldelapersonapresacuandoconcurranlosrequisitos
expresadosatalefectoenlaLeyOrgnicaGeneralPenitenciariayenelReglamentoPenitenciario.

2. Qu tipos de permisos existen?


a)Ordinarios:sonlosqueseconcedenperidicamenteparaprepararlavidaenlibertad.Suconcesin
tienecarcterpotestativo.SeexigeinformedelaJuntadetratamiento.Estcondicionadoaunosrequisitosy
tienenlmitesencuantoasuduracin.
b)Extraordinarios: son los que se conceden por motivos humanitarios ante circunstancias graves y
excepcionales.Suconcesintienecarcterimperativo(seconcedern),suduracinnotienelmiteyse
someternalasmedidasdeseguridadquelaAdministracinPenitenciariayelJuezdeVigilanciaestimen
pertinentes.

3. Cul es la finalidad del permiso ordinario?


SegnlaLeyPenitenciariaelpermisotienecomofinalidadesenciallapreparacinparalavidaenlibertad
(art.47.2LOGPyart.154RP).Esteobjetivoobligaaentenderelpermisocomouninstrumentoesencialpara
hacerefectivolaconcrecinlegaldelmandatoconstitucionalquesealalareeducacinylareinsercin
socialdelpenadocomounadelasfinalidadesdelapenaprivativadelibertad(art.25CE)o,comoha
sealadolaSTC19/1988,lacorreccinyreadaptacindelpenado,yseintegraenelsistemaprogresivo
formandopartedeltratamiento...(STC112/1996,de24dejunio;F.J.4).Debeserestefinreeducativo,el
horizonteinterpretativoquelaadministracinpenitenciariaylaautoridadjudicialdebetenerencuentaenel
momentodelavaloracindelascircunstanciasconcurrentesencadapenadoaefectosdelaconcesino
denegacindelpermiso.Delocontrario,sevulneraelart.15delaConstitucinespaolaqueprohbelas
penasinhumanasodegradantes,pues"todapenaqueseejecutacontraelhombre,comosiestefueraunvirus
uotroagentepatgeno,osinelhombre,comosifueraprescindible,esunapenaejecutadaenclavede
inhumanidad"(Auto795/2000deAPMadridSeccin5de14dejuniode2000.Estasinterpretacionesson
conformesalosestablecidoenlaRecomendacinR(87)3delComitdeMinistrosdelosEstadosmiembros
delConsejodeEuropade12defebrerode1987alcontenerlaregla43.2entrelasestablecidasparael
tratamientodelosreclusos,laprevisindeunsistemadepermisosparaposibilitarelcontactoconelexterior,
compatibleconelobjetivodeltratamiento.Enelmismosentidosemanifiestaelart.70.2delasNormar
PenitenciariasEuropeasaprobadasporelComitdeMinistrosdelConsejodeEuropade12defebrerode
1987aldisponerquelosprogramasdetratamientodebernincluirunadisposicinrelativaalospermisos
penitenciariosalosqueserecurrirtodoloposibleporrazonesmdicas,educativas,profesionales,familiares
yotrosmotivos.
Adems,lospermisospuedenserviraotrosfinestalescomo:laatenuacindelosefectosdesestructuradores
queoriginalacrcelenlapersonapresa,elmantenimientoyfortalecimientodelosvnculosfamiliares,la
bsquedadefuturostrabajosparapoderaccederauntercergrado,eliniciodenuevasrelacionespersonales,
elcontactoconpersonasoasociacionesdedicadasalareinsercindepersonaspresas(conotrostrminos,
perodeidnticocontenido,semanifiestalaSentenciadelTribunalConstitucional112/1996)y,lacoaccin
latenteparainvitaralospresosalasumisindisciplinaria.
Peroapesardeello,elTribunalConstitucionalsealaqueapesardesuconexinconelart.25.2CEnoes
suficienteparaconferirleslacategoradederechosubjetivo,nimenosandederechofundamental(SSTC
75/1998y88/1998)pueselart.25.2CEcontieneunmandatodirigido,enprimertrminoallegisladorpenal
ypenitenciario,que,aunquepuedeservirdeparmetrodelaconstitucionalidaddelasleyes,noesfuenteen
smismodederechossubjetivosafavordeloscondenadosapenasprivativasdelibertad,nimenosande
derechosfundamentalessusceptiblesdeamparoconstitucional(STC2/1987,19/1988,150/1991,209/1993,
72/1994).Sindudaestaposicinesmuycuestionable,qupuedehabermsfundamentalparaunapersona
privadadelibertadquesureinsercinsocial?...solamentehayquepreguntaralaspersonaspresasyconocer
lasdificultadestanenormesqueexistenparasuintegracinsocialcomoparanoconsiderarelart.25como
underechofundamental.Ahorabien,laSTC115/2003de16dejuniomantieneelpermisodesalidacomo

medidaindividualizadadetratamientopenitenciario,dirigidaalareinsercinsocialdelpenadoyconuna
baseconstitucionalenelart.25CE,ycuyaconcesinodenegacintienequesermotivada.
Demaneraque,elpermisonoessloelinstrumentoidneodepreparacinparalalibertad,sinoquees,
adems,unreconocimientoexpresodequenosloformalmente,sinotambinenlarealidad,lapersona
presaformapartedelasociedad.Estambinunaformadedepositarlaconfianzaenlapersonapresaque
dejadeserloporunosdas;yes,asimismo,unaapelacinaqueasumaenciertamaneralosmnimosde
responsabilidadpersonalysocialalosqueserefierelaleypenitenciaria.Enestesentido,"elpermisopuede
contribuirasumayoreficaciaporque,alcontarconelpreso,alincorporarloalaejecucindelapena,
permitequestevalorelalibertadnocomoaoranzasinocomovivencia,puedatomarcontactoconun
mundoexterior ms aceleradamente cambiante que el de la prisin y refuerce los lazos familiares y la
prcticadetomadedecisionespropiadelejerciciodelaresponsabilidad"(Auto795/2000deAPMadrid
Seccin5de14dejuniode2000.

4. Cuntos das se pueden disfrutar de un permiso ordinario?


Seconcedernporseisdas,hastauntotaldetreintayseisalaoparalosclasificadosensegundogrado.Los
clasificadosentercergradopuedendisfrutardecuarentayochodasalao,ademsdepermisosdefinde
semana (art. 45.7 LOGP). En caso de concesin del rgimen de tercer grado previsto en el art. 82
restringidoporvaderecursoelJuezdeVigilanciapodrconcedertodoslospermisosprevistosenelart.87
cuandoseacreditequerenetodoslosrequisitosparadisfrutardelrgimenabierto(Criterio37reuninJVP
2003).Serndistribuidosensemestres(dieciochodasenelprimersemestreparalosclasificadosensegundo
gradoyveinticuatrodasalsemestreparalosclasificadosentercergrado)(art.154RP).
Estospermisospodrn,enprincipio,distribuirsesegnlasnecesidadesopreferenciasdelapersonapresa,
teniendoencuentaque,encasodeestarclasificadoentercergrado,estetipodepermisospuedeunirsealas
salidasdefindesemana,sinquestossecomputendentrodelosdascorrespondientesacadaunodelos
semestres. A estos mismos efectos, tampoco se computarn ni las salidas programadas ni los permisos
extraordinarios(art.154.3RP).

5. Qu requisitos se exigen para la concesin de los permisos ordinarios?


Paralaconcesindelospermisosordinariosseexigequeconcurranenelpenado(clasificadoensegundoo
tercergrado)unaseriederequisitos(art.47.2LOGP):
a)Tenerextinguidalacuartapartedelatotalidaddelacondena,salvoparalosclasificadosdirectamente
entercergrado(criterio38ReuninJVP2003).Paraelclculodelacuartapartehayquededucirincluirlos
dasderedencinordinariayextraordinaria(quienescumplancondenaporelCdigoPenalderogado).Las
cuestionessobrelosclculosdeesteplazotemporalsonlasmismasquelasqueseestablecenparalos
clculosdelasparteso2/3paralaconcesindelalibertadcondicional.Pornorepetirlascuestionesque
sesuscitanmeremitoalcaptulo5.
b)Noobservarmalaconducta.Estasituacinexigenotenersancionessincancelar.Paracancelarlas
sancionesesnecesarioeltranscursodeseismesesparalasfaltasmuygraves,tresmesesparalasgravesyun
mesparalasleves,acontardesdeelcumplimientodelasancin.Tambinesnecesarioquelapersonapresa
nohayaincurridoenunanuevafaltadisciplinariamuygraveograve(art.260.1RP).Noobstante,estos
plazosdecancelacinpodrnseracortadoshastalamitaddesuduracinsi,conposterioridadalasanciny
antesdecompletarse,lapersonaobtuviesealgunarecompensadelasprevistasenelartculo263(art.261
RP).
Ahora bien, "no observar mala conducta" es una concepto jurdico indeterminado, sujeto a
interpretacin.Enestesentido,lainterpretacingramaticalqueeslamsrespetuosaconelprincipio
delegalidadnospuedeaportarunasolucindiferentealamantenidahastaestemomentosnotener
sancionessincancelar.
"Laconductaesunaformaglobaldecomportamientoquehadeenjuiciarseenconjunto,ponderando
yancompensandolopositivoylonegativo,desuertequeesposiblecalificarunaconductade"no
mala"conquienhacometidoalgunainfraccindisciplinaria,debiendo hacerse,casoporcaso,un
juiciodevalorglobal.Adems,latareainterpretativadeesteconcepto(no)malaconducta,hade
establecerse en cada caso concreto para que la indeterminacin genrica de la ley se torne en la
resolucinespecficaeindividualizada"(Auto1034/99APMadridseccin5 de8deseptiembrede
1999,de30dejuniode2000,de4dejuliode2000,30deoctubrede2000,21demayode2001).Aestos
efectos hay que valorar no slo la sancin sin cancelar, sino el tiempo que resta para la libertad
definitiva,eldisfrutedeotrospermisosanteriores,destinos,tareas,apoyosexternos,etc.

Porotrolado,siunpresotieneunpartedisciplinario,peroestrecurridoalJuzgadodeVigilanciayportanto
noesfirme,noselepuededenegarelpermisoenvirtuddelderechoalapresuncindeinocencia(Auto
594/00APMadridseccin5de11demayode2000).
Alosextranjerosselesconcederigualmentelospermisossindiscriminacinrespectodelosnacionales,
salvoaaquellosquesenieguenaserdocumentados(criterio41reuninJVP,2003.

6. Se puede conceder un permiso cuando se tiene una sancin recurrida al


Juez de Vigilancia Penitenciaria?
S.CuandounapersonahasidosancionadaydichasancinseharecurridoalJuzgado,comostanoesfirme
an,elpermisopuedeconcederse,sinperjuiciodequesilasancinseconfirmaporelJuzgadodeVigilancia
puedatenerseencuentaenposteriorespermisos(AutodelJVPnm.3deMadridde12deenerode1995).
Noobstante,endeterminadoscentrospenitenciariosseestablececomocriteriolaimposibilidaddeconceder
el permiso hasta que se resuelva el expediente disciplinario. Esta prctica, en nuestra opinin, es muy
criticableporquevulneraelart.24.2delaConstitucinpresuncindeinocencia,ydeocurrirenalguna
crcelhayque,ademsdeinterponerunaQuejaanteelpropioJuzgado(AutodelJVPdeCceresde22de
mayode1995),unacuestinprcticaimportanteatenerencuentaseravalorarlaconvenienciadenorecurrir
lasancinanteelJuezdeVigilancia.
Salvoenloscasosdeindisciplinagrave(actoscomprendidosencualquieradelosprimerossupuestosdel
artculo108delReglamentoPenitenciario,R.D.1201/1981),lainterposicindelrecursodealzadacontralas
resolucionessancionadorassuspendeelcumplimientodelasancin.Estooriginaquesetardemstiempoen
cancelarlassancionesyaqueelcumplimientodelamismaseretrasahastaqueelJuezdeVigilanciaresuelva
elrecurso(enestesentidovid.Autode6deseptiembrede1994JVPdeCastillaLende6deseptiembrede
1994).Porello,cuandosetengalacreenciadequeelrecursonovaaprosperar,ycuandoestprximala
fechadeconcesindeunnuevopermiso,puedesermsefectivonorecurrirlasancin(hayquevalorarcada
caso porque esta situacin puede ser utilizada por la crcel para evitar que se recurran las sanciones
disciplinarias).

7. En qu supuestos el informe del Equipo Tcnico puede ser negativo


para la concesin del permiso?
ElinformepreceptivodelEquipoTcnicopodrsernegativorespectodelaconcesindepermisos,cuando
porlapeculiartrayectoriadelictiva,lapersonalidadanmaladelinternooporlaexistenciadevariables
cualitativasdesfavorables,resulteprobableelquebrantamientodecondena,lacomisindenuevosdelitoso
unarepercusinnegativadelasalidasobreelinternodesdelaperspectivadesupreparacinparalavidaen
libertadodesuprogramaindividualizadodetratamiento(art.156.1RP).
Estos requisitos no tienen elementos objetivos para su apreciacin, y adems en algunas crceles
(macrocrceles)elconocimientodelaspersonaspresasesmuyescaso,pornodecirnulo.Porotrolado,con
ciertafrecuencia,losEquiposTcnicosdelascrcelesutilizanconceptosindeterminadosparajustificarla
denegacin de los permisos. Esta situacin origina una gran inseguridad jurdica. De hecho, si no se
acreditansuficientementedatosobjetivosquepermitanconsiderarlasalidacomoespecialmentepeligrosa,si
ademsnocometidelitoalgunodurantelalibertadprovisionalyexisteapoyoexterior,ademsdeparticipar
enactividades,elpermisodebeconcederse(AutodelJVPn.2deGaliciade26.11.2002).
Amododeejemplo,entrelascausasquesirvendejustificacinalasresolucionesdenegatoriasdepermisos
enlosCentrosPenitenciarios,cabecitarlasquesiguenenunatrascripcindenotificacinDENEGATORIA
sobrepermisodesalida:

CentroPenitenciariode...................
Notificacinsobrepermisoordinariodesalida.
INTERNO..............................MDULO............
De conformidad con el artculo 47.2 de la Ley Orgnica General Penitenciaria y artculo 254.2 del
Reglamento Penitenciario, este Equipo de Tratamiento, en sesin del da......... ha acordado por
UNANIMIDAD/MAYORAinformarFAVORABLE/DESFAVORABLEsusolicituddepermiso.
LaJuntadeRgimenyAdministracinensusesindelda.........alavistadelinformeemitidoporel
Equipo de Tratamiento, acuerda por UNANIMIDAD/MAYORA DENEGAR el permiso solicitado en
atencinalossiguientes:
MOTIVOSDEDENEGACIN
Noestarclasificadoensegundootercergrado.
Notenercumplidaunacuartapartedelacondena.

Tenersancionessincancelar,recurridasoestarincursoenexpedientedisciplinario.
Tenerresponsabilidadespreventivas.
Prohibicinlegal:artculo254.6,ReglamentoPenitenciario(nohabertranscurridodosotresaosdesde
reingresoenprisinporquebrantamientodecondena).
Tenerjuicios/causaspendientes.
Trayectoriapenitenciariairregular.
Largoperododetiempohastasulibertad.
Faltadegarantasdehacerbuenusodelpermiso.
Malusodelpermisoanterioroincumplimientodecondicionesimpuestas.
Positivoenanaltica,manipulacinonegativaasurealizacin.
Serconsideradoperjudicialparasutratamiento.
Ausenciadearraigoennuestropas.
Ausenciadevinculacinfamiliary/oacogidainstitucional.
Consolidacindefactorespositivos.
Escasaparticipaciny/ointersenlasactividades.
Variablesderiesgo.
Serreincidente.
Otros.
ContraesteacuerdocabeinterponerrecursoanteelJuzgadodeVigilanciaPenitenciaria,conformeal
artculo76.2g)delaLeyOrgnicaGeneralPenitenciaria.
En........a.....de........de....

Eneltextoliteraltrascritollamanlaatencinvariascosas:
a)No se individualizan las razones. Simplemente se pone una X a la izquierda de la(s) causa(s)
denegatoria(s). La denegacin de un permiso por causas distintas a las expresamente contenidas en la
normativapenitenciariaosinexplicacindelasrazonesqueabocanataldecisinsupondraejercitarpor
partedelaadministracinpenitenciariaunafacultadnoreconocidaporlaLeyconolvidodelprincipiode
legalidadespecficamenteestablecidoenelart.2LOGP(AutodeJVPdeLaCoruade22dediciembrede
1992)(AutodeAPCdizde19deenerode1993)
b)Criteriosestrictamenteobjetivosylegalescoexistenconjustificacionesquedejanungrancampode
actuacin a la arbitrariedad de la administracin penitenciaria, vulnerando el principio de legalidad
reconocidoconstitucionalmente.
Noseinformadelplazoparainterponerrecurso(tresdas).Afortunadamentenosellegaalaprcticadeotras
crceles,dondeseaadelacoletillaclaramentecoactivaeilegal:advirtindolequecasoderecurrir,nose
estudiarnuevasolicitudhastalaresolucinfirmedelrecurso.

8. Las denegaciones de permisos deben estar motivadas?


S.Normalmentesesuelenfundamentarlasconcesionesdelospermisos,peronolasdenegaciones.Adems,
comohemosvistoanteriormente,losmotivosdedenegacindelpermisosesuelenexpresarenuninforme
delEquipodeObservacinyTratamientoqueseextiendeenunmodelotipocontodaslasvariablesde
riesgo(vid.cuestinanterior).Estaprcticaescontrariaaloestablecidoenlosartculos17,24.1y25.2CE.
CuandoladenegacindeunpermisonoquedejustificadacondatosconcretoshayquerecurriralJuezde
Vigilancia,alaAudienciaProvincial,yensucasoalTribunalConstitucional(vulneracindeunderechoala
tutelajudicialefectivayaladefensa),utilizandolossiguientesargumentos:
a)ElTribunalConstitucionalensentencia112/1996,24dejunio;F.J.5,sealandoque...elart47
LOGPsloexigecomorequisitosparapoderaccederapermisosordinariosdesalidalosqueelrecurrente
rene(clasificacinensegundogrado,tenerlacuartapartedelacondenacumplidaynoobservarmala
conducta),porloqueresultaimposiblededucirquotrosrequisitossonlosquenocumpleelpenado...
Amayorabundamiento,ydebidoa...queladenegacindeunpermisodesalidaguardarelacinconla
libertad,comovalorsuperiordelordenamiento,paraquelasresolucionesjudicialesqueconfirmandicha
denegacinpuedanentenderseconformesconelderechoalatutelajudicialefectivanoessuficienteque
quepadeducirdelasmismasloscriteriosjurdicosfundamentadoresdeladecisinconformealstndar
exigibleparaentenderrespetadodichoderecho(STC14/1991),sinoqueserprecisoqueestnfundadasen
criteriosqueresultenconformesconlosprincipioslegalesyconstitucionalesalosqueestorientadael
permiso...(STC81/1997,de22deabril,FJ4ySTC20471999,de8denoviembre).
b)Lasresolucionesdedenegacindelospermisosdebenestarmotivadas,puesdelocontrario,sino
existeinformealgunoenelqueseargumentenlasrazonesporlasquelacrceldenegsusolicitud,elJuez
ignorasilasmismassononofundadas.Porello,sienelpresorecurrenteconcurrenlosrequisitosdecarcter
objetivoexigidosenelReglamentoysinoseaprecianenelpresoningunacircunstancianegativa,elpermiso
debeconcederse(Auto629/1997,AP5deMadrid).

c)Cuandoladenegacindelpermisonosefundamenta,seoriginalavulneracindelatutelajudicial
efectiva.EnestesentidoelTribunalConstitucionalhamanifestadoquealnocumplirrazonadamenteestas
especficas exigencias de motivacin, hemos de concluir que el recurrente no obtuvo la tutela judicial
efectivadesuinterslegtimo,alverrevocadoelpermisopenitenciariojudicialmenteconcedidoenprimera
instanciaporunaposteriorresolucinjudicialinsuficientementefundada(STC75/1998de31demarzo).
ElTribunalConstitucionalenlassentencias112/1996,193/1997hasealadoquehayquevalorarsilas
mismasnoincurrenenirrazonabilidadmanifiesta,arbitrariedadoinsuficienciademotivacin.Ahorabien,
estestandargeneraldecontrolsufreunamodulacinenelmbitodelospermisosdesalida,porcuantola
situacindeprisinsobrelaqueactansuponeunaradicalexclusindelvalorsuperiorlibertad,porloque
enestamateriaesexigibleunamotivacinconcordanteconlossupuestosenlosquelaconstitucinpermite
laafectacindedichovalorsuperior.Sibienladenegacindeunpermisodesalidanopuedelesionarel
derecho fundamental a la libertad personal, como se expuso anteriormente, ello no obsta para que tal
decisinafectedealgunamaneraalalibertadyaquelospermisosrepresentanparaelcondenadoaunapena
privativadelibertadeldisfrutedeunaciertasituacindelibertaddelaquedeordinario,yconfundamento
enlapropiacondenaqueaslolegitima,carece.Pararespetarelcontenidodelderechoalatutelajudicial
efectivaesprecisoquelaresolucinquedenieguelaconcesindelpermisodesalidasefundeencriterios
conformes con los principios legales y constitucionales a los que esta orientada la institucin (STC
75/1998).

9. Qu datos
ordinarios?

se

tienen

en

cuenta

para

la

concesin

de

permisos

LosEquiposdeTratamiento,ademsdeotrasvariablesqueposteriormentedescribo,tienenencuentaloque
denominanTABLADEVARIABLESDERIESGOparavalorarsilapersonavaahacerbuenomalusodel
permiso,tomandoenconsideracin,entreotras,lassiguientescircunstancias:extranjera,drogodependencia,
profesionalidaddelictiva,reincidenciaeneldelito,quebrantamientosdecondena,haberestadoenartculo10
LOGP,ausenciadepermisos,deficienciaconvivencial,lejanadelafechadelicenciamientodefinitivoy
presionesinternasaquesehallensometidoslospresos.

10. Cul es el proceso para la concesin de un permiso ordinario?


Lapersonapresatienequedirigirsepormediodeunainstanciaaldirectorsolicitandoelpermiso.Detodasformas
eslaJuntadetratamientoquiendecidecuantasvecesycuandoseestudialaposibilidaddeconcesindeunpermiso
desalida.LosJuecesdevigilanciahaestablecidoqueesdeseablequeenlosCentrosPenitenciariosnoexista
discriminacin en la frecuencia de estudio de permisos entre aquellos internos a quienes se les conceda
habitualmenteporlacrcelyaquellosquelodisfrutanporconcesindelJuezdeVigilanciapenitenciaria(Criterio
36,reuninJVP,2003). Laposibleconcesindepermisosdesalidadebeiracompaadadeundetallado
estudioindividualporpartedelequipotcnicoenelquesetengaencuentatodalainformacindisponible
sobrecadacaso:a)anlisisdocumentaldelhistorialpenalypenitenciarioencaminadoalaidentificaciny
valoracin de factores o variables significativas de cara al uso responsable del permiso (tipo de delito,
significacinsocialdelmismo,fechadecomisin,caractersticasdelacarreradelictiva,posibleperodoen
libertadprovisional,presentacinvoluntariaopresentacin,condenasetc...).b)Entrevistasconelinternoa
findeobtenerunconocimientoprximodesusituacinactitudinal,ascomosobrelasrazonesparala
solicitudyposiblesefectosdeldisfrute.c)Estudiosocialdelmediofamiliarydelentornoenelqueest
previsto el disfrute del permiso. Este estudio, con aplicacin de las tablas de variables de riesgo y de
concurrenciadecircunstanciaspeculiaresserealizardeformacompletaentodoslospermisosinicialeso
cuandodesdeelltimosehayaproducidoalgunaincidenciasignificativaparasudisfrute.Enlossiguientes
permisossetendrnencuentalasvaloracioneshechasenelltimoestudio
TraselinformedelEquipoTcnico,quedebeserpreceptivo,aunquenovinculante,laJuntadeTratamiento
resolverelpermisoconcedindoloodenegndolo.Sielpermisoesdemsdedosdas,sesometerla
concesinalaaprobacinposteriordelJuezdeVigilanciaPenitenciaria,acompaandoloscorrespondientes
informesopropuestasdelosEquiposdeObservacinyTratamiento(criterionmero17JVP).
Elcontenidodelacuerdoporelqueseconcedaelpermisoordinariodebecontenerunaaseriededatos(I
22/96): nombre y apellidos del interno, NIS, fecha de nacimiento acuerdo de la Junta de Tratamiento,
situacinpenal(condena,causa,delito,parte,y4/4partes,todassinredencino,ensucaso,con
redencin,responsabilidadespendientes),situacinpenitenciaria(gradodeclasificacin,fechadeprisin
interrumpida y fecha de ingreso en el centro actual, sanciones y recompensas), nmero de das que se
conceden (se tendr en cuenta si existe prohibicin expresa de estancia o residencia en determinados
lugares),direccinenlaquesevaadisfrutardelpermiso,valoracindelaparticipacinenlasactividades,si
seadjuntaelinformesocial,porcentajederiesgodequebrantamiento,motivacindelpermiso,medidasde
seguridadycondiciones,firmasdelsubdirectordetratamiento,secretarioyvistobuenodelDirector.

Seadjuntaademsinformeopropuestadelequipotcnico.Losestudiostienenquehacerse,segnlaI22/96,
cuandohayantranscurridosmsdetresmesesdesdeelltimoacuerdodenegatorioconelfindeoptimizar
losrecursoshumanosytcnicos.
Para los clasificados en tercer grado no es necesario la aprobacin judicial (art. 76.2.1 LOGP) ya que
solamentedependendelaaprobacindelaJuntadeRgimen,previoinformedelosEquiposyposterior
autorizacindelAreadeTratamientodelaDireccinGeneraldeInstitucionesPenitenciarias.Enestoscasos
lospermisosdefindesemanapodrnunirsealosordinariossiempreycuandonosuperenconjuntamentelos
7dasdeduracin(I22/96).
Enlaconcesindelpermisosesuelenponerunaseriedemedidasdeseguridadodeapoyo:presentacin
diariaantelapolicay/oantelosserviciossocialespenitenciarios,necesidaddequerecogidoydevueltopor
unafamiliarorepresentantedeasociacinqueloavale,contactotelefnicoconlacrcelenfechasyhoras
concretas;obligacindeacudiracentrosderehabilitacinoasistenciales,sometimientoaanalticassobre
consumodeestupefacientes.

11. Puede denegarse el estudio de un permiso aduciendo que tiene uno


recurrido en el Juzgado de Vigilancia Penitenciaria?
Aunqueenlaprcticasehaceenalgunasprisiones,noesposible,porquenilaLeynielReglamentolo
establecen(AutodelJVPGranadade27demarzode1995).
Esta prctica, contraria a derecho, lleva aparejada como consecuencia real la prdida del derecho, en
abstractoaserestudiadosalmenos,olaposibilidaddeserrecurridosencasodequeseandenegatoriosde
lospermisosalosqueenprincipiotienederechoalreunirlosrequisitosobjetivoslegalesprevistosenlaley
(AutodelJVPdeSevillade7defebrerode1997;enelmismosentidoAutoJVPZaragozade20defebrero
de1996,AutoJVPValladolid20.10.99).

12. Se puede suspender un permiso concedido por el Juez?


S.CuandounavezaprobadoelpermisoporelJuezseproduzcanhechosquemodifiquenlascircunstancias
que propiciaron su concesin, la direccin podr suspender motivadamente el permiso con carcter
provisional, ponindolo en conocimiento de la Autoridad administrativa o judicial competente para que
resuelvaloqueproceda(art.157.1RP).
LoquenosepuedehacerenningncasoesanularelpermisoconcedidoporelJuezdeVigilancia(Autodel
JVPnm.1deBarcelonade25dejuniode1992).
Solamentepuedesuspenderseunpermisocuandohayansobrevenidocircunstanciasenlapersonapresaque
motivenelincumplimientodelosrequisitosobjetivosparalaconcesindelpermiso,comoporejemplo,una
sancinfirmequesupongalainexistenciadelrequisitodebuenaconducta,oquehayallegadoalacrcelotra
condenaquesumadaalaqueseestcumpliendonoselleguealacuartapartedelacondena.
Enelsupuestoquesesuspendaporquehayanconcurridoosobrevenidocircunstanciassubjetivasqueno
impliquenlainexistenciadelosrequisitosobjetivos(1/4parteybuenaconducta)sevulneraelprincipiode
seguridadjurdicayeldetutelajudicialefectiva.Adems,puedeserutilizadocomomediodesumisino
coaccinencubiertaparaobligarahacer/nohaceralgodeterminadobajolaamenazadelasuspensinde
unpermisoyaconcedido.Porello,laaplicacindeesteartculodeberaserrestringidayconunefectivo
control judicial. En ocasiones se deniega esta suspensin en base a los principios de oportunidad y
proporcionalidad(AutoJVPZaragozade5.8.99).
EnestoscasoshayquehacerunescritoalJuzgadodeVigilanciaoalaAudienciaProvincial,sielpermisolo
concediesteTribunalenvaderecurso,paraqueordenealacrcellaejecucininmediatadelpermiso
(modelonmero40).

13. Se puede recurrir la denegacin de un permiso ordinario?


S,formalizandounRecursodeQuejaanteelJuezdeVigilanciaPenitenciaria(art.76.2.g).ste,trassolicitar
informacin sobre los motivos de la denegacin a la prisin, resolver en forma de Auto estimando o
desestimandoelrecurso(modelonmero36).
ContraestaresolucinsepuedeinterponerRecursodeReformaenelplazodetresdasanteelmismoJuez
deVigilanciayposteriormente,unodeApelacinantelaAudienciaProvincial(modelosnmeros37y39).
Paraello,hayquesolicitarabogadoyprocuradordeoficioypedirquesuspendanelplazoparainterponerel
recursohastaquelosdesignen.ParainterponerelrecursodeamparoanteelTribunalConstitucional,sila
Audienciadeniegaelpermiso,hayquehacerunescritoalTribunalConstitucional,diciendoquesequiere
recurrirenamparoporvulneracindeunderechofundamentalyquedesignenabogadoyprocuradorde
turnodeoficioparalainterposicindelademandadeamparo.Elrecursodeapelacindebeseradmitido
aunqueseenvedeformamanuscritayenfotocopia,enbasealderechoarecursodelrecluso(AutoAP
Gironade27.11.2000).

14. A partir de qu momento se puede recurrir un permiso?


Enprincipio,despusdequesenotifiqueladenegacin.Noobstante,sipasadostresmesesdesdelasolicitud
deunpermiso,ladireccindelacrcelnohubiesecontestado,elpermisoseentenderdenegadoy,portanto,
sin esperar dicha resolucin, puede interponerse recurso ante el Juzgado de Vigilancia (Real Decreto
1879/1994,de16deseptiembre).
Normalmentelosrecursossuelentardaralgunosmesesensuresolucin.Esteretrasovienemotivadoporlos
trmitesburocrticos.CuandounpresorecurreladenegacindeunpermisoelJuzgadosolicitalosmotivosa
laprisin.Elenvodeestosinformessueleretrasarsemucho.Paraevitarestasdilacionesalgunosjuzgados
hanordenadoalacrcelquejuntoalescritodelrecursoseaportenalJuzgadodeVigilancialosmotivosde
denegacin.Otrosjuzgadosestablecenquecuandounapersonasoliciteunpermisoysedeniegue,lacrcel
deberemitirdirectamentealJuzgadolapeticinylosinformesdesfavorablessinesperaraqueelpreso
recurraafindeevitartrmitessuperfluosquesuponganunadilacininnecesaria(AutodelJVPdeGranada
de28deoctubrede1994).

15. Se pueden presentar al Juez de Vigilancia otras alegaciones distintas a


aquellas en que la prisin ha fundamentado su decisin?
S.MuchosJueceslastienenencuenta.Esmuyimportante,encasoderecurso,hablarconelJuez.Paraello,
losfamiliares,personasqueseofrecencomoavaloabogadospuedenaportarlasiguienteinformacin:
Cumplimientodelosrequisitosestablecidosenlaley.
Noconsumodedrogas.Aunqueelconsumodedrogasnodebeconsiderarsesiempreynecesariamente
comounfactorderiesgoqueimpidaeldisfrutedebeneficiospenitenciarios,sintenerencuentalasdems
circunstanciaspersonalesdelinterno(Criterio49,reuninJVPenero2003).
Inexistenciadeindiciosobjetivablesdequebrantamientodecondena.
Presentacinvoluntariaalcumplimientodelacondenaindiciodenoquebrantamiento.
Relacionesyvnculosfamiliares.Esteesunodelosproblemasdelaspersonasextranjerasalahoradela
concesindepermisos.Lasolucinescontactarconalgunapersonaoasociacinqueavaleelpermisoyque
legaranticeunacoberturamaterialmnima(casaycomida)yciertoseguimiento.EnestesentidoAuto
758/1996AP5Madrid.Noobstante,existensituacionesenlasquesibiennoexistearraigofamiliarel
permisosehaconcedidoporqueestedatonoinduce,valorandolasotrascircunstanciasconcurrentesaqueel
aprovechamientodelpermisovayaaserperjudicialalfaltarlelosfrenosquenaturalmentetendraalsaber
queexisteunapersonaquerespondeporl(AutoJVPdeOcaade19deseptiembrede1989).Sila
denegacinesporserextranjero,elmotivode"denegacinserlafaltadearraigo"porloqueesfundamental
la existencia de una aval de una asociacin de apoyo, o la existencia de vinculaciones de amistad
(sentimental)conunapersona(hombreomujer)espaola(Auto47/99deAPMadridseccin5de19de
enerode1999).
Necesidad de retomar el contacto con su ncleo familiar o iniciar contactos de bsqueda de una
actividadlaboral.
Destinos,tareasycursosrealizados.
Ausenciadesanciones.
Notasmeritorias.
Vecesquehadisfrutadounpermiso.
Compromisopersonalderesponsabilizacinduranteelpermiso.Enestesentidoelauto1359/98AP
Madridseccin5concedeunpermisoaunapersonaconunaliquidacindecondenade50aosenbaseala
siguienteargumentacin:"Esteinternohapasadolopeor,suconductahaidodepeoramejor,mantienelazos
familiares,laesperanzadesureinsercinnoesvana.Sesabeloquesepuedeesperardeladenegacindel
permiso:desesperacin,rabia,decepcin,talvezdisimuloohipocresaytambinloquepuedeesperarsede
suconcesin:riesgodemalusoesverdad,peropaliadoporlascircunstanciaspersonalesdemaduracin,
miedo al castigo y por las circunstancias familiares y sentimentales de apoyo; y junto a ese riesgo, la
posibilidaddedemostrarqueltambinescompatibleconlalibertad,quepuedeacostumbrarseadecidirpor
siynoaquetodoselodendecidido,queensusentidodelaresponsabilidadestlallavedeunfuturoque
anpuedeserlargoyalegre.Yacortoplazo,ademostrarquemereceotropermisoovariosmsyensu
momentounaprogresindegrado".
Cumplimientodelacondenaocondenas(fechaaproximadaoestimativa).
Pedirlaintervencindealgntcnico(trabajadorsocial,psiclogo)delJuzgadodeVigilancia,donde
loshaya(JuzgadodeVigilanciaPenitenciarianm.1deMadrid).
Es muy importante que toda esa informacin quede acreditada mediante documentos o comparecencias
personalesanteelJuzgado.

16. Qu argumentos pueden utilizarse en los recursos ante el Juzgado de


vigilancia por la denegacin de un permiso?
CuandosedeniegueunpermisohayquerecurriralJuzgadodeVigilancia.Hayqueexponerlasituacin
personalypenitenciariaenlaquelapersonaseencuentrayutilizaralgunosdelosargumentosqueexpongo
dependiendodelosmotivosdeladenegacin.
a)Cuandoelpermisonoseconcedaporlargacondena;lejanaparalalibertad.
En la prctica se considera la larga condena como motivo suficiente para denegar los permisos. El
fundamentoqueseutilizaesconsiderarquealestarlejanoelcumplimientodelastrescuartaspartesdela
condenalmitetemporalmnimoquepermiteaccederalalibertadcondicionalnoesnecesarioprepararla
vidaenlibertadporquestaestanlejos.Seconfundenlosfinesalosqueestllamadoacumplirel
permisoconlalibertadcondicional.
EstemotivodedenegacindepermisoshaquedadoanuladoporelTribunalConstitucional(STC112/1996)
quesehamanifestadoenlossiguientestrminos:laresolucinhaceabstraccindelhechodequeelpenado
hayasuperadomsdelacuartapartedesutotalduracin,yconcluye,queslotienesentidoprepararlavida
enlibertadcuandolaposibilidaddeobtenerlaatravsdelalibertadcondicionalsehallecercanaenel
tiempo. Se conectan de esta manera los permisos de salida a la obtencin de la libertad condicional,
obviandolasfuncionesqueensmismoelpermisoestllamadoacumplir.Seolvidaporltimo,queatravs
delaclasificacinyprogresinengradolospenadospuedanaccederaregmenesdesemilibertadacuya
preparacinsontambinfuncionaleslospermisos.Estainterpretacinrestrictivadelosderechosnoest
ancladaeneltenordelaleyquelimitalasposibilidadesresocializadorasquelamismaabre,sinoquese
apartadelafinalidadpropiaqueinspiralainstitucinqueanalizamos,yque,portanto,hadesertenidacomo
irrazonable;enestemismosentidoelAutodeAp.1dePontevedrade26.11.2002).
Encuantoallargotiempoquerestaparalalibertaddebenhacersedosconsideraciones.Laprimeraesque
elloesunaconsecuenciafataleinexorableencasodelargascondenassiemprequelapersonacondenada,
trascumplirlacuartapartedelamismayobservarbuenaconducta,solicitaunpermiso.Pordefinicin,la
partedecondenaquerestaporcumplirtrescuartaspartesolamitadsiobtienelalibertadcondicionales
tresveces,oalmenosdos,mslargaquelayacumplida.Pudolaleyfijarlascondicionesparaaccederalos
permisosenotrafraccinmsaltadelapenapero,sinolohizo,esabsurdoinvocarloobviocomounarazn
dedenegacindeaquellos(Auto586/1997AP5Madrid).
Porotrolado,lalejanaenelcumplimientodelacondenanoesunfactorpositivoparaconcederelpermiso
pero tampoco es un factor negativo para denegarlo, salvo que se entienda que estn excluidos de esos
beneficiosloscondenadosapenaslargasprivativasdelibertad.Ello,noslonoesas,sinoqueparaestas
personascondenadas,generalmenteconmuchosaosdeprisin,lapreparacinparalalibertadhadeser
paulatina,yporello,debeiniciarsedesdelejosdelcumplimientofinaldelacondenalaconcesindelos
permisosenordenalapreparacinparalalibertad(Autos410/1997,447/1997y670/1997,AP5Madrid).En
todocaso,esclaroquetodapenaqueseejecutacontraelhombre,comosifueraunvirusounagente
patgeno, o sin el hombre como si fuera una cosa prescindible, es una pena ejecutada en clave de
inhumanidad;laspenasprivativasdelibertaddebenejecutarsecontantoconlospresos(Auto795/00AP
Madridseccin5de14dejuniode2000).
Parapaliarlosriesgosdefugapropiosdelascondenaslargasdebeusarselapersuasindelainutilidaddetal
fugaydelasgravesconsecuenciaspenalesypenitenciariasdeesasconductasyrecurrirsealapoyofamiliar
(Auto508/00APMadridseccin5de11deabrilde2000).
b)Denegacinpornecesidaddequeelinternosientaelefectointimidatoriodelapena.
Estemotivoseargumentasobrelabasedequelaconcesindelpermisosuprimeomenguasingularmenteel
efectodelapena.Perolaprdidadelibertadsevaloramsnegativamentecuandosehagozadodelibertad
siquieraduranteunosdas.Nopuedeafirmarsecientficamentequelapenaseamenosterribleporunabreve
interrupcindelasituacindeprisin,nitampocoquelapenatieneporobjetivoprincipallaintimidacindel
delincuente sino otros como la reeducacin y sobre todo, la prevencin especial y la capacidad de
reinsercin,aspectosquedebenpredominarsobrelaintimidacinenlafasedeejecucindelacondena(vid.
Auto755/1997deAP5Madrid).
c)Denegacindepermisosporadiccinadrogas.
Enestetema,lassituacionesquepuedendarsesonvarias:
Resulta paradjico que la crcel sea incapaz de evitar el consumo de drogas en prisin y slo lo
reconozca de forma indirecta de afirmar la cualidad de drogodependientes con muchos aos de prisin
ininterrumpida(enlaquesesuponequelaadiccinnohasidocortadanisiquieraporlavadehechode
hacerimposibleelconsumo)yalmismotiempoaleguedichadrogodependenciacomocausaparadenegar
permisos(uotrasventajas,beneficiosoprogresospenitenciarios).
Esciertoquesonpersonasdistintaslasencargadasdeevitarqueladrogaentreenlasprisionesylasquehan
deresolversobrelaconcesindepermisosuotrosbeneficios,peroellosolamentesalvalacongruencia

individualdelfuncionarioperonorestaincoherenciaalaactuacinadministrativa.Ylacuestinesquesila
drogodependenciasemantieneenprisinylapenaestapuntodecumplirsenoseadviertequesegana
enquesecumplasinunsolopermisosalvoenelpuntodeasegurarmomentneayparcialmentequedurante
los(no)permisos,nosedelinquiryaquenisiquieramerecelapenaasegurarentalescondicionesqueel
internonoconsumirdroga,puescontinuaconsumindolaenprisin.Peroestaventajadelacertezadeno
delinquirporquenohaypermisosnoseoponeaunacertezacontrarialadedelinquirsiloshaysinoque
sta es una mera posibilidad que puede reducirse razonablemente mediante la limitacin temporal del
permisoylaimposicinalinternodelaobligacindepresentarseadiarioantelaautoridadpolicialdellugar
enelquelodisfrute(Auto247/99de26defebrerode1999)
Existensituacionesenlasqueseafirmadeformagenricaqueladrogodependencianoestsuperada
porpartedelpreso.Puesbien,estaafirmacinnoessuficienteparaladenegacindelpermiso.Esnecesario
que la adiccin est acreditada por algn medio, bien sea por analticas positivas, o por sanciones por
tenenciaoconsumodedrogasenprisinquepermitierandeducirlaadiccin(Auto247/99APMadrid5).
Sinoseacreditaobjetivamenteelconsumo,losJuzgadosdeVigilanciaylosTribunalesnopuedenafirmar
queseafalsalaafirmacindelaJuntadeTratamientosobrelaadiccinadrogasdeundeterminadopreso,
perotampocoquelaadiccinseacierta,mssienlosinformesaportadosporlacrcelnoexisteconstancia
fehacientedetalextremo.Enestesentido,elAuto586/1997delaAP5Madridafirmaque...porunladoel
informeaportadonoafirmaladrogodependencia,yporotro,conformealReglamentoPenitenciario(tantoel
derogadocomoelvigente)latenenciayelconsumodedrogasenprisinsonfaltasdisciplinariasyniconsta
sancinalgunaensuexpediente,niseafirmaqueencualquierocasinhayaarrojadounresultadopositivoen
analticaosehayanegadoasurealizacin,niesfcilpensarqueunatoxicomanapersistentecondicionante
nosehubierapuestodemanifiestoenalgunaocasinenlosaosqueelinternohacumplidoenprivacinde
libertadininterrumpidamente.
Tambinexistensituacionesenlasquelaacreditacindeladrogadiccinsehacedeformaincompleta
porquenoseexpresalasustancia.EnalgunaprisinhaocurridoqueenelinformeaportadoalJuezde
Vigilanciaconsta:positivoalcontroldeorinapracticado.Lacuestincontrovertidaes:esepositivoaqu
sustanciaserefiere:acannabis,opiceos,benzodiacepinasococana...ningunadeestassustanciastieneel
mismogradodeadiccin,nisimilarpeligrosidadcomofactorcrimingeno.Enunacasosimilar,laseccin5
delaAPdeMadrid(Auto768/1997)resolvienelsiguientesentido:...eldatodelasustanciasibiennolo
conoceeljuzgadoresseguroqueloconocelaadministracinyhadepensarsequeactuconcorreccinenla
ideadequeelconsumodealgunadrogarevelabaunmalusodelpermiso.Ahorabien,sibien,porunlado,en
esteordendecosas,laJurisdiccindeVigilanciaPenitenciariaesesencialmenterevisora,esacualidadno
puedeelevarsealextremoqueatentealprincipiodejusticiapersonalizadapropiodetodajurisdicciny
especialmentereforzadoentodoloqueataealtratamientopenitenciarioyalarevisindelmismoporlos
rganosjurisdiccionalescompetentes,porloqueavecesnobastaconjuzgarsiunaresolucinfueacertada
entoncesyesprecisorazonarsobresilosiguesiendoahora.Enestepuntolasconsecuenciasdehaberdado
positivo han sido suficientemente duras: prdida de oportunidad de progresar a tercer grado lo que
supondralalibertadcondicionaldesdehacehoymsdeunaoeinexistenciadepermisosdesde....de...al
menos hasta noviembre de igual ao y casi con toda probabilidad hasta ahora. Y ese dato de que las
consecuenciasdeunerrorounainfraccinpuedenresultardesproporcionadasnodebiocultarsealJuezde
Vigilanciaalmenosenelmomentoderesolverseelrecursodereforma,mscuandoesedarpositivotras
variosaosnomenosdecincoenprisin,biensedebeaunaaccinaislada,obienponedemanifiestoun
fracasoeneseterrenotantodelapenacomodesuformadecumplimiento,quenopuedepretendercorregirse
conlamerasupresindelospermisos...
Puedeocurrirquelasanalticashayandadopositivasaalgunasustanciaestupefacienteconcretayapesarde
elloelpermisosepuedaconceder.Nocabedudaqueelriesgodelacomisindedelitosesmayorenestoscasos.No
obstante,existenplanteamientosdoctrinalesyjurisprudencialesenlosquesellegaaadmitirlaconcesinde
permisoscuandolatoxicomananohayadesaparecido,inclusoapesardealgnintentodetratamientoespecfico.
Cuandolaspersonasqueseencuentranenestasituacindedrogodependencianosuperadacumplanlacondenase
abrentresposibilidades:a)Unaeventualdeshabituacinfutura;b)lapersistenciaenlatoxicomanaunidaala
delincuencia;c)laconvivenciaconlatoxicomanasindelinquir.Ysilaprimeraesladeseable,tanposiblescomo
ellasonlasotrasdos.Ahorabien,lafaltadedesintoxicacinnoesdeporsunmotivobastanteparanoiniciarla
preparacinparalavidaenlibertad.Porterriblequeresulte,siunapersonadespusdevariosaosingresadoenun
sistemacomolaprisinpersisteensutoxicomana,latendenciayanopuedesertantoaladeshabituacincuantoa
lacapacidaddevivirsindelinquir(seguimientodeprogramasdereduccinderiesgosvid.tratamientocon
metadona). Es ms, la posibilidad de reinsercin y hasta de deshabituacin pasa por una apuesta por el
estrechamientodeloslazosfamiliaresyelrefuerzodelsentidodelaresponsabilidad.Yeseriesgo,trasvariosaos
enprisin,hadeasumirseahoraenlacertezadequesermsgravecuantomstardeenproducirse,yquese
producirinexorablementeconelcumplimientodelapena(Auto1196/1997AP5deMadrid,seestimaelrecurso,
seconcedeelpermisoconlasmedidasdeseguridadypolicaadecuadas).

Ensituacionesenlosquesedapositivoalreingresoenprisindecannabisnoesmotivosuficientepara
denegarelpermisotodavezquesibienelpreceptoreglamentariomencionaquelapropuestadepermisoser
negativa si se estima probable que el permiso repercutir negativamente desde el punto de vista de la
preparacin
alalibertad,losefectosderivadosdelconsumoeventualdelosproductosderivadosdelcamonosonms
nocivosquelosdelasdrogaslegales,niporsupoderdedependencianiporeldetrimentodelasalud,nipor
lalimitacindelalibertadpersonal,yaunqueesdeseablelaabstencinalconsumodedichosproductos,las
medidascoercitivas,comoloeslaprivacindepermisosdesalida,nosonlasmsadecuadasparaconseguir
ladeshabituacinylaindependenciapsquica,quetienesusedemsapropiadaentratamientosteraputicos
yenlapropiavoluntaddelafectado,paralocuallosperodosbrevesdelibertaddelospermisosdesalida
puedenservirdeocasinparamedirsuvoluntadyresponsabilidad(JVPdeZaragozade21deoctubrede
1991,consimilarfundamentacinAuto,AP,Madrid,de3denoviembrede2000).Enidnticostrminoscon
herona(JVPdeCastilaLende10defebrerode1993).
Enestoscasosselepuedecondicionaraanalticaalregresoyaqueentreencontactoconalgncentrode
rehabilitacin,aspectosteimportanteparalaconcesindeltercergradoyposibilidaddedisfrutedela
libertadcondicionalcondicionadaalsometimientoaunprogramadedeshabituacin.
Ahorabien,siunapersonadapositivoenunaanalticaalreingresodelpermisonoselepuedesancionar
administrativamente,dadoquealpresonoselepuedeexigirunaconductadistintadeladelciudadanoen
libertad,yellosuponequenopuedesersancionadoadministrativamenteporelhechodeconsumirdrogaya
queestaconductanoespunibleensmismaennuestralegislacinpositiva(AutodelJVPdeCastillaLen
de10defebrerode1993).
Enotrasocasiones,elpresoconproblemasdeadiccinadrogasseencuentrarealizandoalgnprogamade
rehabilitacindentrodeprisin.Enestoscasos,enintersdeltratamiento,ydebidoaqueunosdasen
libertadpodranponerenpeligroloslogrosconseguidos,elpermisonoseconcede.Ennuestraopininesta
actuacin es improcedente porque, si bien, puede ser negativo si consume, puede ser un estmulo para
perseverar en l, y una prueba de la capacidad de enfrentamiento a la droga en libertad que es donde
definitivamentehadesercapazdesuperarsuadiccin(Autos677/97y138/99AP5Madrid).
d) Cuandoseaducefaltaporconsolidarfactorespositivos.Paraladenegacindeunpermisopor
estasrazonesesnecesarioqueseacreditenosloqufactoreshayqueconsolidar,sinotambinlosmedios
parallevaracaboesaconsolidacin.Demaneraquesinoseindividualizanlosfactoresorasgosatrabajar
teraputicamenteo,silaadministracinpenitenciarianoponelosmedios,ladenegacindelpermisoes
injustificadayatentacontralaseguridadjurdicadelart.1delaCE.
Cuandounapersonaapesardesusantecedentespenalesopenitenciariosllevaaossinpartessancionadores,
ytrabajandooparticipandoenactividadesdelacrcel,noesposiblealegarestaraznparadenegarel
permiso.Enestesentido,elAuto447/1997AP5deMadridseexpresaenlossiguientestrminos:...el
condenadollevaenprisindesde1987,quebrantcondenaen1989,reingresenprisinenagostodeese
ao.Observunaconductairregularhasta1991inclusocometiendodelitodelesionesalparecerenprisin.
Desdeentoncessuconductaesexcelente.Esedesdeentoncessignificacincoaosantesdedenegarseel
permiso.Enestepunto,hablarcomoprimermotivoparadenegarelpermisodelafaltadeconsolidacinde
factores positivos tras cinco aos de excelente conducta y con una evolucin que se concreta en un
comportamiento se cita textualmente participativo, centrado y con buena conducta es extremar el
conceptodeloqueseentiendeporconsolidacin.Porelloelpermisodebeconcederse.
e) Cuandonoseharegresadodeunpermiso.Cuandounapersonaquebrantaunpermisoynose
incorporaalacrcelsufreunaseriedeconsecuenciasportalacto.Entreellas,selesometeamedidas
disciplinarias,deduccindetestimonioporeldelitodequebrantamientodecondena,ascomounagran
dificultad,pornodecirimposibilidadenlarealidadprcticadeprogresarengrado.Perolasconsecuencias
deladecisindenovolveralacrceltrasunpermisonopuedenprolongarseindefinidamente(AutoAP,
Madrid,5de12deseptiembrede2000).Demaneraqueladenegacindeunpermisoporestemotivono
puedeseguirenvigordespusdeunplazoprudencialdevariosaos.
Apartirdeestemomentolacuestinsecentraenlaasuncindelriesgodeunnuevoquebrantamientoy
posibilidaddelacomisindedelito.Enprincipio,esteriesgodeberaserpaliadoporeltratamientopenitenciario
alquelegalmentedeberahabersidosometidalapersonapresa,perosivariosaosdeprisinininterrumpidano
hanlimitadorazonablementeeseriesgo,habraqueponerenentredichoeltratamientopenitenciario,elcual
contemplalaposibilidaddefallosporejemploquebrantarunpermisodesalidaperoopta,aundentrodeese
riesgoqueconllevalapreparacinparalalibertad,porquedichapreparacinexistaynoseproduzcadegolpesino
paulatinamente,comomalmenoralapurainexistenciadepreparacin.Sieltratamientoasumelcitamenteun
riesgo,tambinlosjueces,dentrodelmbitodelorazonable,aceptandolaposibilidaddeunerror,temiendo
inclusoenlomsprofundodesuconcienciaporlaseventualesconsecuenciasdelmismo,debeasumirlo(Auto
769/1996AP5Madrid).

Se puede argumentar que ya quebrant en otras ocasiones e incluso que delinqui durante la libertad
condicional,loqueoriginlarevocacindesta.Assejustificaladenegacinsealandoquelapersonaes
inintimidableporlapena,ellollevaraadecirquelapenaesintilfueraestrictamentedesufuncin
retributiva,puesnosloserineficazenordenalareinsercin,sinoinclusoenelplanodelaprevencin
especial,elloalgoelTribunalnopuedecompartir.Hadepensarsequelosactostienenconsecuenciasysi
ahora cuenta con apoyo familiar, con lugar donde vivir y las condiciones legales, no hay razones para
denegarlo(Autos1002/1997y1359/98deAP5deMadrid).Inclusoquebrantarunalibertadcondicional
tampocoesmotivoparadenegarlospermisosdesalidasisedanlorequisitosdelart.47LOGPy154RP
(AutoAPLugode15/11/99.
f)Posiblemalusodepermiso.Lasospechadeunmalusodeunpermisoseapoyaenundatonofiable,
porque entramos en el terreno de la futurizacin, de las adivinanzas, de lo que podra ocurrir. No es
predecibleomuydifcilmentepredecibleuncomportamientonegativoparalapreparacindevidaenlibertad
deunapersona.Enqupuedeconsistirunmalusodeunpermiso?Esteextremodeberaconcretarse,porque
esdifcilimaginarsituacionesenlibertadquefueranmsperjudicialesydesestructuradorasquelavidaenla
crcel. Adems debern acreditarse los datos o elementos objetivos sobre los que la Junta de Rgimen
sustentatalprediccindemalusodeunpermiso.
Aesterespecto,elAuto777/1996AP5Madrid,sealaquelasospechadeunmalusodelpermisoseapoya
enundatonofiable;nofiableporqueningnelementoindicaqueelinternocontineconsumiendodrogas.
Sindudaqueelloesposible,perosidurantesuestanciaenprisin(llevadesde1993sininterrupcin)noha
cometidoningunafaltarelacionadaconlasdrogas,lapresuncinmsarmnicaeslafavorablealinterno:que
nohacontinuadoconsumiendo,porloquenocabeinferirqueduranteelpermisoseaprobablelacomisin
deunnuevodelito.
Parecerazonablequelosriesgosdebanconsiderarsesobretodocuandopuedanafectaraterceraspersonas.
Peronopodemosdejardeolvidar,comosealaelAuto1138/2000deAP5Madrid,que"avecesunriesgo
diminutodelesindeesosvaloresseagigantaporeltemoryhaceolvidarotropeligrodeunmalmscercano
yprobablecualeseldenegardehecholareinsercindequienbuscaylaquiereypideunaoportunidadcuya
denegacinpuedesercausadedesmoralizacinyderrumbamientopsquico.Porello,silosriesgosdelmal
usodelpermisosoncontroladosoreduciblesalmximo,elpermisodebeconcederseencondicionestales
queloconviertanenunvaliosoinstrumentodereinsercin,enunactodeimpulsodelaautoestimayel
sentidodelaresponsabilidadyenunpasoinicialdemarchahacialalibertad";enelmismosentidoelAuto
762/00APseccin5de8dejuniode2000.
g) Gravedaddeldelitocometido.Nocabeindicarcomomotivoparaladenegacindeunpermisola
gravedaddeldelitocometido,porquesuponemanejaruncriteriodedesigualdadnorecogidoporellegislador
(Auto770/1996deAP5Madrid).Tampocosonatendibleslatipologadelictiva,lareincidenciaylaalarma
social.Laprimeraporqueprecisamenteenrazndelagravedaddeloshechosseimponeladuracin,mso
menoslargadelacondena.Lareincidenciahayqueacreditarla.Ylaalarmasocial,porquesihatranscurrido
unacuartapartedelacondenaposiblementehayadisminuido,ysloexistirparaaquellosqueignorenque
sloesunaexcarcelacintemporal,yentodocasounriesgoasumidoencuantoqueelcumplimientodetoda
penatienecomobaseeltratamientoindividualizado,almargendeotrasconsideraciones(Autos449/1997y
203/99deAP5Madrid). Sihubiesequeestaralcriteriodelagravedaddeldelitosepodraentrarenel
juegopeligrosodel"nonbisinidem"aadiendoalacondenaimpuestaunsegundocriteriodepenalidad,que
noestdeacuerdoconlafinalidadquedebencumplirlaLeyyelReglamentoenatencinalosfinesde
reinsercinsocial(Auto167/00APMadridseccin5de8defebrerode2000).
h) Reprochesocialdelosdelitoscometidos.Nocabeargumentarestemotivoparaladenegacindel
permiso. El reproche social del delito ya se encuentra embebido en el juicio de valor negativo que el
legislador,ensufuncinderepresentanteformaldelacomunidadsocial,hacealelevarunaconductaala
categoradedelitoasignndolecomoconsecuenciajurdicaunapenaprivativadelibertad(AutodeAPde
Cdizde19deenerode1993).
i)Riesgodecomisindedelito.Todaconcesindepermisopenitenciarioparaunapersonapresasupone
unriesgo, biendequebrantamiento,biende comisinde delitoduranteelmismo. Pero este riesgoes
prevenidoporlaley,queinclusoprevlasconsecuenciasdeesemalusodelpermiso(medidasdisciplinarias,
delitodequebrantamiento,valoracinnegativaparafuturospermisosetc.),porloqueelJuez,sisecumplen
razonadamentelascondicionesparaconcederlonipuedeponerencuestinlanorma,nisentirseparalizado
porunmiedoalerrorquenaturalmentesentir,yquelehacerepresentarsecomonoexcluiblelaposibilidad
futuradelesindebienesjurdicosdeterceraspersonasinocentes.
Encasodequeeseriesgoserepresentecomoremoto,laalternativaanoasumirloesconvertirenmera
declaracin terica los principios de progresividad, tratamiento individualizado y reinsercin social que
proclamalaLeyGeneralPenitenciariainspiradaenlosprincipiosconstitucionales.Hayqueponderaruna
seriedeelementos,talescomo:largoperododeprisincumplida,inexistenciadedatossobremalaconducta

enprisin,lasactividadesrealizadas,yloinexorabledeunafuturalibertadparalaqueesnecesariauna
acomodacinprogresiva(Auto586/1997AP5Madrid).Encualquiercaso,elmargendeerrorquetodo
enjuiciamiento de conductas futuras conlleva es asumible, basndose como nica pauta subjetiva la
confianzaenlarespuestadelpreso(AutoJVPnm.3deMadridde14defebrerode1994).
Enloscasosenlosquelalibertaddefinitivaestprxima,elriesgomereceuntratamientodistinto.En
primerlugar,sevedisminuidoporqueelpresovaaalcanzarsulibertadenpocosmeses.Ensegundolugar,
frentealriesgodelmalusodelalibertadduranteunosdas(permiso)seoponeelriesgomuchomayorde
hacermalusodelalibertadsinrestricciones(libertaddefinitiva)quepuedellegarenpocotiemposinoexiste
unamnimapreparacinparaesalibertad,unaespeciedeentrenamientoenlapropiaresponsabilidad(Auto
1120/1997,deAP5deMadrid).
Esevidentequeenlaconcesindelpermisohayunriesgoquedebeserrazonablementeasumido,puesdelo
contrario la pena se convertira en un instrumento de seguridad absoluta, basada exclusivamente en la
retribucin.Estaconcepcindelapenaestdesterradadenuestroordenamientojurdico(art25.2C.E.)
Ahorabien,cuandosonmuchoslosaossufridosenprisinlafuncinretributivadelapena,inclusodela
prevencingeneralensentidopersuasorio,oyasehancumplidoenbuenamedida,oseasumequeyanose
cumplirn.Eselmomentodeponermsnfasisenelobjetivodelareinsercincuyoxitodependerdela
capacidaddeautocontroldequiennopuedehabituarsedefinitivamenteaquetodocontroldebaserimpuesto
desdefuera.Peseasusriesgos,elxitoengeneraldelospermisospenitenciariosnaceenbuenamedidadela
invitacinalapropiaresponsabilidadqueelpermisosupone.EnestesentidosemanifiestaelAuto1159/1997
AP5Madrid.
J)Cuandosedeniegaporserextranjeroylafaltadegarantaqueofreceeldomiciliofacilitadopor
aqul.Enestoscasos,existenTribunalesqueaceptanlaconcesindelpermiso(AutodeAPdeVitoriade14
deenerode1992)todavezqueestadenegacinvulneraclaramenteelart.14delaConstitucinenrelacin
conel13deesemismocuerpolegal.Enocasiones,silapersonanofueseextranjera,sehubieraconsiderado
laprogresindegradoylalibertadcondicional.Lafuncinretributivadelapenayelfindelaprevencin
especialdebenconsiderarseenbuenamedidacumplidos.Debeponerseelacentoenelsiempreobjetivodela
reinsercin social que, al equivaler a vivir razonablemente en libertad, pasa inexorablemente por la
preparacindeesavidaenlibertad,preparacinenlaquelospermisospenitenciariossonpiezaclave.Enfin,
elriesgodefugaportemoralaexpulsinsecompensaporquesihacemalusodelpermisolaexpulsin
puedeproducirseinclusoinmediatamentedadasusituacinpenitenciaria(AutoAP5deMadridde1de
diciembrede1997).Enconsecuencia paralaspersonasextrajeraslospermisospuedenserconcedidosde
igualformaqueparalosespaolessiemprequerenanlosrequisitosdelaleyyacreditenrelacinconalguna
personaespaolaoentidaddeapoyo,todavezquelaspenasdebenteneridnticoefectoentreespaolesy
extranjeros(Autos297/00,472/00,333/00,447/00APMadridseccin5de2demarzode2000,5deabril
de2000,10demarzode2000,20dediciembrede2000,27defebrerode2001y6deabrilde2000).
k) Muyprisionalizado. Enloscasosenlosquelapersonallevamuchosaosenprisin,setratade
entenderquesalvoqueelinternomueraenprisin,lalibertadhadellegar.Ysetratadedecidirsihade
llegaraunapersonaanmsprisionalizada,anmsdescompensadapsquicamente.Puedeoptarsepor
deshumanizarlapenaeincrementarlosrasgosdedeshumanizacindelpreso,oporlavacontraria:reforzar
losrasgosmspositivosdelpreso,loquevienedelamanodelahumanizacindelapena.Peroesaopcin,
aunque tristemente real, no es legal porque la pena inhumana, tambin en su ejecucin, est
constitucionalmenteproscrita(Art.15CE) yporquelalgicadicequenianenelmsegostadelos
planteamientos,esconvenientequelaprisintorneenfierasalossereshumanos.Cabrapreguntarseacerca
delosrasgospositivosqueunpresopuedetener.Puedenservarios,peroalmenoshaydos:relacinafectiva
odeamistadyunaasociacindeapoyo(Auto9/99APMadridseccin5de13deenerode1999).
l) Por estar pendiente de incesar en un centro de rehabilitacin. En este supuesto la Audiencia
ProvincialdeGeronadictelAutode10.03.00,enelquesealaqueesteargumentoesinadmisibleyaque
taldatonopuedeinfluirparaconcederodenegarunpermiso;siloquesepretendeesevitarelriesgodeque
elinterno,aprovechandounpermiso,recaigaenelconsumodesustanciasestupefacientesqueensudale
llevaronadelinquir,loqueimplicaralaparalizacindesuingresoenelcentroteraputico,setratadeuna
situacin que no puede asumir la administracin penitenciaria, debiendo saber el propio interno las
consecuencias negativas que el consumo le podra acarrear. En definitiva nos encontraramos ante una
situacintananmalayKafkianacomodecirquenoselepuedeconcederunbeneficiodegradoinferior
(permiso)porqueseestpensandoendarleunodegradomayortratamientoencentroteraputico.
ll)Undatoimportanteessieltribunalsentenciadorinformfavorablementeaunindulto,todavezque

siendo segn la opinin del sentenciador que la pena impuesta resulta excesiva por las circunstancias
concurrentes, tal criterio no puede ser obviado, aunque no le vincule al Juez de Vigilancia. Pero si el
TribunalSentenciadorhaentendidoqueseraconvenientelaconcesindeunindultoparcial,cuantoms
procedenteserlaconcesindeunpermiso(AutoJVPMlagade20.03.00)
m)Serextranjeroytenerordendeexpulsin.Enestoscasoshabraqueversilaordengubernativade
expulsinestrecurridaosisehacanceladoporeltranscursodeseismesesdesdequeseemiti.Detodas
formas,aunconlaordendeexpulsin,nadaimpidelaconcesindelpermisopuesnopuede,enprincipio,ser
expulsadohastaquenofinalicelacondena,salvoqueenlasentenciacondenatoriaseexpreselocontrariopor
aplicacindelart.89CP.

17. Qu consideraciones se pueden realizar si la denegacin del permiso


se basa exclusivamente en hechos o circunstancias del pasado?
EnmuchasocasioneslosdatosqueutilizalacrcelparadenegarelpermisoNOserefierenalapersonalidad
delpenado,asuconductapenitenciaria,oasusituacinsocialofamiliar;esdecir,ningunoguardarelacin
conelpresenteoalfuturo.Encambio,losquealegalaprisinpuedenreferirsealpasado:elevadacondena,
gravedaddeldelito,trascendenciaoalarmasocialdelmismoylargoperodohastalalibertadinclusoeste
motivoesconsecuenciadelagravedaddeldelitodebidoaqueellargoperododetiempoparalalibertadque
aparececomopronsticoesconsecuenciadelapenaimpuestaynodeunaanteriorconductapenitenciariao
deunmalpronsticodereinsercin.Enestemismosentido,laguarectoradelospermisosnodebeserla
gravedaddelaconductasporlasquefuecondenado,sureiteracinypeligrosidad,sinoelcomportamiento
seguido por el interno, pues de lo contrario los delincuentes condenados por delitos graves no podrn
disfrutardeningunaclasedepermisohastasuexcarcelacin(AutoAPCantabriade17.01.00).
Pues bien, como seala el Auto 1161/2000 AP 5 de Madrid, el pasado debe tener consecuencias y
condicionarinclusoelfuturoperonomsalldelasdisposicioneslegales,ytodosesosdatosdelpasado
tienensutraduccinenlagravedaddelapenayenlamayordificultaddecumplirelrequisitolegalde
extinguirlacuartapartedelamismaqueeslafraccinfijadaporellegislador.Portanto,silosdatosdel
pasadonocondicionanelpermisosegnlaspremisasfijadasporellegisladorynoexistendatosdepresente
odefuturoencontradelgraveriesgodecomisindedelitoodequebrantamiento,elpermisodebe
concederse.

18. La administracin penitenciaria puede denegar un permiso por unos


motivos concretos cuando el Juez de Vigilancia o la Audiencia Provincial
concedieron uno anteriormente sealando que aquellos motivos de
denegacin no existan?
Spueden,dehechoocurreconmuchafrecuencia.ApesardequeelJuezdeVigilanciaolaAudiencia
Provincial concedan un permiso alegando que no concurren los motivos que expone la administracin
penitenciariaparadenegarelpermiso,sedenieganydenuevoelpresotienequerecurriralJuzgado.
Ahorabien,sielJuezdeVigilanciaylaAudienciasonquienestienenlaresponsabilidadconstitucionalde
"hacer ejecutar lo juzgado" as como del control jurisdiccional sobre la actuacin administrativa, no es
razonablecontradecirlosargumentosdesusresoluciones,salvoqueexistandatosposterioresqueavalenla
argumentacin denegatoria de la crcel, sin cometer un delito de prevaricacin (dictar una resolucin
administrativaarbitrariaasabiendasqueesinjusta).Pongamosunejemplodelarealidad:enlaprisinde
MadridIVsedeniegaunpermisopor"faltadegarantas",elpresorecurreyeljuzgadodevigilanciaentiende
queexistengarantasyporelloordenaqueseconceda;elpermisosecumplicorrectamente.Alosdos
meseslapersonapresavolviasolicitarunnuevopermisoylajuntadetratamientodelacrcellovolvia
denegarpor"faltadegarantas";elpresovolviarecurriryelJuzgadodeVigilanciavolviaconcederlo
sealando que "existan garantas"; el permiso se cumpli correctamente de nuevo. Al poco tiempo el
JuzgadodeVigilancialeprogresatercergradoenvaderecurso,yportantolecorrespondanlospermisos
desalidadefindesemana.ElpresolossolicitalaJuntadetratamientodurantelaestanciaenMadridIVen
esperadesertrasladadoalCISVictoriaKent.Lajuntalosvolviadenegarpor"faltadegarantas".El

JuzgadodeVigilancialovolviaconceder.Arazdeestasituacin,lapersonapresadenuncialaJuntade
tratamientodelaprisinporundelitodeprevaricacin.ElJuzgadodeInstruccinnum.1deNavalcarnero
admiti a trmite la denuncia y declar imputados en el mencionado delito al director, subdirector de
tratamientoy12miembrosdelaJunta.
Porotrolado,hayquehacerhincapienrazonesdeefectividadyreinsercinsocialparaargumentarquese
debenconcederfuturospermisossilosanterioressehandisfrutadocorrectamentesiemprequenohayan
cambiadolascircunstanciaspersonalesylosrequisitoslegalesqueimpidansuconcesin.Comosealael
Auto1015/2000deAPMadridde19dejuliode2000"alpresoselehaconcedidounpermisoporeste
Tribunal;siendoasdebepersistirseesalneayconcederelpresentecondicionadoalbuenusodelanterior.
Cualquierotrasolucincreainseguridadenelpresoypropendeasembrarlaconfusinydespertarsospechas
decaprichooarbitrariedadenlasresolucionesjudiciales.PeroademselTribunaltienequecontribuirenla
medidadesusposibilidadesalareinsercindelospresosentendidoenellimitadoydemocrticosentidode
vivirrespetandolaleypenalyparaellodebeemitirelmensajeinequvocodequesielpresodapautasde
respetarla,simuestrasuvoluntaddenodelinquir,elTribunalmantendrsulneadesucesivospermisos,se
atendralosprincipiosdeunsistemapenitenciarioprogresivoalahoradedecidirsobresuprogresinde
gradoyseesforzarenqueelinternoalcancesulibertadenlasmejorescondicionesposiblesyellonopor
razones humanitarias ni pietistas sino como compromiso de ejercer sin vacilaciones sus funciones
jurisdiccionalesycomoespecficamuestradesumisindelosjuecesalimperiodelaConstitucinylaLey
quebuscanlareinsercindelpenado"(Art.25.CEy59LOGP)(VerAuto182/2000APMadridseccin5de
11defebrerode2000).
AlgunaspersonasquebrantanporqueobtienenunpermisoaisladodeunJuezoAudienciaenvaderecurso.
Sabequecuandovuelvalacrcelselosvaadenegar.Anteellopuedenoptarpornovolver.

19. Se pueden recurrir las resoluciones de los Juzgados de Vigilancia


Penitenciaria que desestiman las quejas formuladas por la denegacin del
permiso?
S,antelaAudienciaProvincial.Esconvenienteaportartodoslosdatoseinformesquesetengan,ascomo
pedirnuevaspruebaspericialesyaquelasnormasaseguirparasutramitacinsonlasdelprocedimiento
abreviado(criterionmero83,JVP),ystasasloprevn(vermodelonmero39).
Entodocaso,sicuandolaAudiencianodisponedelosdatosconcretosparalaresolucindelpermiso,yde
losquesedisponesonincompletosysectariosporloquedeparcialeinmotivadotienen...conlosescasos
datosqueaportalaadministracin,quetienenlaresponsabilidaddeesaescasez,nohaymotivossuficientes
paradenegarelpermisoaquientieneyacumplidaslastrescuartaspartesdelacondena(Auto998/1997AP
5Madridde20deoctubrede1997).

20. Pueden disfrutar de permisos los presos preventivos?


S,perotienenqueseraprobadosporelJuezoTribunalquehayaordenadoelingresoenprisinpreventiva
(art.48LOGPyart.161.3RP).Paraello,habrquedirigirsealJuezcorrespondientesolicitandoelpermiso.

21. Pueden disfrutarse los permisos fuera de Espaa?


S, en casos excepcionales. Se conceden a los que estn clasificados en tercer grado, y cuando existan
comprobados motivos laborales o familiares importantes. En estos casos se ponen condicionantes
(presentacinenelconsulado,llamadastelefnicasaljuzgado...)afindegarantizarelbuenusodelpermiso
yelregreso(AutoJVPdeOviedode28deagostode1995).
Tambin se puede viajar fuera de la pennsula islas Baleares o Canarias siempre que el Juzgado de
Vigilanciapenitenciariacompruebelosbilletesdeidayderegreso,pueslosriesgosdefugapuedenverse
mitigados por los perjuicios que supondra para el penado: alta probabilidad de detencin, prdida de
redenciones, dificultad en la progresin de grado, la casi imposibilidad en plazo breve de la libertad
condicionalylanuevacondenaporquebrantamiento(AutoAPMadrid,5,de24demayode2001)

22. En qu casos se puede conceder los permisos extraordinarios?


Estos permisos se pueden conceder en situaciones extraordinarias, por razones humanitarias. La Ley
Orgnica General Penitenciaria no presenta un cuadro cerrado de situaciones (art. 159 RP), si bien la
valoracindelaimportanciaextraordinariadelassituacionesquepermitensuconcesinvaadependerdel
Director o de la Junta de Tratamiento. Se pueden conceder establecen en los casos de fallecimiento o
enfermedadgravedelospadres,cnyuge,hijos,hermanosyotraspersonasntimamentevinculadasconlos
internos,alumbramientodelaesposaopersonaconlaqueelpresosehalleligadaporsimilarrelacinde
afectividad.Lasposibilidadesdeotrossupuestosquedanabiertasconlacoletilladelartculocitadoas
comoporotrosimportantesycomprobadosmotivos.Laduracindecadapermisoextraordinariovendr
determinadaporsufinalidadynopodrexcederdellmitefijadoparalospermisosordinarios(modelo
nmero38).
Algunossupuestosquesepuedenquedarincluidosenotroscomprobadoseimportantesmotivossonlosde
exmenesenuniversidades,opresentacindealgnconcursooposicin(AutoJVPdeOviedode12de
marzode1997).Nosesuelenconcederpermisosextraordinariosparabautizos,comunionesobodasde
parientes por considerarlos actos de trascendencia social o religiosa normalmente incompatibles con el
acompaamientodemedidasdeseguridad.Ahorabien,respectodelabodadeunhijohabraqueafirmar
queademsdeserunactosocialoreligioso,tieneunaproyeccindefuturomuchomsampliaenunaesfera
quetrasciendealpropiosujetoquecontraermatrimonio,puesafectaporlogeneralasusparientesms
prximos, especialmente progenitores, y da vida a una nueva unidad familiar (Auto de JVP Mlaga de
11.10.99).Sisepuedeconcedercuandonopusoasistiralentierrodelpadreyquierevisitarsutumba(Auto
APMadrid,5,de19demayode2001)
Estos permisos son concedidos por el Centro Directivo y se impondrn las medidas de seguridad de
correspondanajuiciodelequipotcnico(custodiaporFuerzasdeSeguridaddelestado,acompaamientode
algnfamiliaroporalgnfuncionario.Encualquiercaso,laconcesindelpermisoquedarcondicionadaa
laconcurrenciadecircunstanciasexcepcionalesqueloimpidan

23. Se pueden conceder permisos para consultas externas mdicas?


ComoaportacinpositivadelnuevoReglamentoseprevlaconcesindepermisosdesalidaconlasmedidas
deseguridadadecuadasensucasoyprevioinformemdico,dehastadocehorasdeduracinparaconsulta
ambulatoriaexterna.Tambinsepuedenconcederpermisosdehastadosdasdeduracinparaingresoenun
hospitalextrapenitenciario.
Sielpenadotuvieraquedebierapermanecermstiempoenelhospital,elpermisodeberserautorizadopor
elJuezdeVigilanciacuandolapersonapresaestensegundogrado,yporlaDireccinGeneralcuandoest
clasificadoentercero. Este tipo de permisos pueden ser utilizados durante la tramitacin de la libertad
condicionalparaenfermosgravesconpadecimientosincurables.
Lospermisosextraordinariosnoestarnsometidosaningunamedidadecontrolcuandosetratedepersonas
clasificadasentercergrado;lomismoocurrirsiloestuvieranensegundoydisfrutasendepermisosde
salida(art.155.4y5RP).

24. Qu presos pueden disfrutar de los permisos extraordinarios?


Puedendisfrutardeelloslospenadosylospreventivos.Enelcasodelospenados,esindiferenteelgrado
penitenciarioenqueseencuentren.Noobstante,paralosqueestnclasificadosenprimergradonecesitan
autorizacinexpresadelJuezdeVigilancia.Enelcasodelospresospreventivosesnecesarialaautorizacin
delJuzgadoquehayaordenadolaprisinprovisional.
Hayquetenercuidadoconlaprcticadealgunascrcelesenlocasosenlosquelospermisosseconceden
peroluegosesuspendenparahacerefectivalaexpulsinasupasdeorigen.Estaprcticaesabiertamente
ilegaleinconstitucional(AutosAPJande10deabrilde1996y26demayode1995).Estaprcticanoest
permitidaenlaLOGPparalosnacionales,tampocodebeestarparalosextranjeros(Art.13y25CE).

25. Quin concede los permisos extraordinarios?


Sisondemsdedosdas,debernseraprobadosporelJuezdeVigilanciaPenitenciaria(art.155.3RP).No
obstanteenlassituacionesdeurgencia,elpermisoextraordinariopodrserautorizadoporeldirectordela
crcel,previaconsultaalaDireccinGeneralsihubierelugaraelloysinperjuiciodedarcuentaalaJunta
deTratamientodelaautorizacinconcedida(art.161.4RP).
Enelart.161.4RPseestableceunprocedimientoparasituacionesdeurgencialainstruccindelaDireccin
GeneraldeInstitucionesPenitenciarias1/1995de10deenero,seestablecequecuandoseaunasituacin
urgentedebidoalanaturalezadelmotivoquelojustifica(nacimientodeunhijo,fallecimientooenfermedad
graveconingresohospitalariodepadres,hijos,hermanosocnyuge,debidamenteacreditados,consulta

ambulatoriaporeltiemponecesario,hasta12horasoingresodehasta2das,enhospitalextrapenitenciario
de internos clasificados en segundo grado a los que, por disfrutar habitualmente de permiso, pueda
concedrselesunoextraordinariosincustodiapolicial)ytraslacomprobacindelmismosepuedeseguirun
procedimientoextraordinarioenelqueeldirectordelCentroPenitenciariopuedeadoptarelacuerdodesu
concesin,comunicandoelmismoalaJuntadeRgimenyAdministracinenlaprimerareuninquese
celebre; estos permisos no tienen que ser comunicados a la Direccin general, pero s incluidos en la
estadsticamensualsobrepermisos.Cuandonosedeunasituacindeurgenciaparaelestudioyconcesin
delpermisosedebeseguirelprocedimientodelrecursoordinario,adoptandoelacuerdolapropiaJuntade
tratamiento;tienenqueaadirelinformedelequipotcnico(I22/96).
Elcontenidodelacuerdoporelqueseconcedaelpermisoextraordinariodebecontenerunaaseriededatos
(I22/96):nombreyapellidosdelinterno,NIS,fechadenacimiento,situacinpenalypenitenciaria,motivo,
causadedisfruteyduracin,nombredelapersonaavisitaryparentescoorelacin,medidasdeseguridad
propuestas,sisetratadeunprocedimientoordinarioodeurgencia,fecha,acuerdodelaJuntayfirmadel
director.
Seadoptarnlasmedidasdeseguridadquequienconcedaelpermisoconsideraadecuadasysilasalidase
realizaaundomicilioparticularsetienequecontarconlaconformidadfamiliar(I22/96)

26. Es compatible la concesin de permisos ordinarios y extraordinarios?


S. La concesin de un permiso ordinario no excluye la concesin de uno extraordinario. Pero no se
concedern extraordinarios cuando el supuesto de hecho o las circunstancias concurrentes permitan su
tramitacincomopermisosordinarios(art.158RP).Perolorealmenteimportanteesqueseconsigacumplir
alafinalidadporlaquesesolicitaelpermisoextraordinario.Esevidentequesisemuereunfamiliarose
encuentra gravemente enfermo o se quiere asistir al nacimiento de su hijo, lo ms conveniente es la
tramitacinurgentedeunpermisoextraordinarioporlarapidezensuconcesin,sintenerqueesperarala
concesindeunoordinario,siempredetramitacinmscompleja.Porello,loimportanteesquelapersona
consigasatisfacersunecesidadextraordinariaylaadministracinpenitenciariaconsudeberdeprestarla,
conindependenciadelnombrequesequieraasignaralpermiso.

27. Qu ocurre si una persona presa aprovecha el permiso para fugarse o


para cometer un delito durante su disfrute?
Silapersonanoreingresadelpermisoynosehapuestoencontactotelefnicoconlacrcel,serealizauna
anotacinenel expedientepersonalyse dacuenta al Centro directivo para su grabacinen el sistema
informticodeincursospenitenciarios.
El aprovechamiento de un permiso para fugarse o cometer un delito durante el mismo, tiene dos
consecuencias:
a)ValoracinnegativaporelEquipodeTratamientoparalaconcesindefuturospermisos.
b)Otrasconsecuenciasenelordenpenaldelitodequebrantamientodecondenaypenitenciario(Art.
157.2RP).Noobstantesilapersonasepresentavoluntariamentepocosdasdespus,sepuedeafirmarque
no existe dolo es decir, conciencia y voluntad de eludir la accin de la justicia y dejar sin efecto el
cumplimientodelapena;porelloenalgunoscasosseprocedealaabsolucin(Juzgadodelopenalnm.1
deLugosentenciade23demarzode1995).
Siademsdenoreingresar,cometedelito,lasconsecuenciassonmsgraves:posibleregresindegrado,
nuevacausapenal;noacumulacindelapenaqueseimpongaensudaalaqueseestcumpliendoyporlo
tantosepueda tenerunacondenatanlargaqueexcedadeloslimiteslegalessinqueelJuezsentenciador
puedalimitarlos(vercaptulo17),suspensindelaclasificacinquesetengasielJuezdeInstruccinque
investigaloshechosdecretaprisinpreventiva;muchsimadificultadparaobtenerunnuevopermisoenel
futuro. Es claro, que entre tros motivos de carcter tico y humano, para no delinquir, est las graves
consecuenciasquedeellosederiva.

28. El no reingreso de un permiso, puede dar lugar a una sancin


disciplinaria del artculo 108 e) RP?
No,aunqueenlaprcticasesancionaalapersonaquequebrantanlacondenacuandovuelvealaprisin.Los
argumentosjurdicossondendoleinterpretativogramaticaldelanormadelart.108.e)RP.Hayquedefinir
gramaticalmente el trmino evasin para posteriormente analizar si dentro de su significado cabe o no
subsumir los hechos no reingreso de un permiso dentro de los elementos objetivos del art. 108 e):
intentar,facilitaroconsumarunaevasin.
Paraquealguienpuedaevadirseporlapropiafuerzadelosprincipioslgicossehaceimprescindibleque
esapersonaseencuentreenunmbitoclausurado,unespaciodecontroleinternamiento,yque,obviamente
serealiceunaaccindeevitarunaactividaddevigilancia,lasuperacindecierreoelrebosamientode
barrerasarquitectnicasofsicas.

Nadadeestoocurreenunquebrantamientodecondenapornoreingresodeunpermiso,porquenosetratade
evadirparaconseguirunalibertaddelaquegozaenplenitudnaturalenesemomentoestabadisfrutandode
unpermisodesalidaenesemomentoaunquetcnicamenteestabapenado(AutoJVPdeMurciade7de
juniode1991).Loquenicamenteocurreesquesehaproducidounmalusodelpermisoquepuedetenerse
en cuenta para la concesin de sucesivos permisos, o para la deduccin de testimonio por delito de
quebrantamientodecondena,peronoparaaplicarunasancindisciplinariaporlacomisindelainfraccin
delart.108e)RP.
Encuantoaldelitodequebrantamientodecondenaesimportantesealarquesilapersonavuelvealmenos
dosdasdespusdelmomentoenquetuvoqueincorporarsealacrcelysepuedejustificardealguna
maneraesasituacin,procedelaabsolucinpenal.EnestesentidosemuestralasentenciadelaAPde
Barcelonade15/6/99alsealarque:ladoctrinacientficaafirmalaatipicidaddelaconductadequebrantar
laprisinporcuantoelinstintodeautoliberacinesbsicoenlapersona,ascomo,queelcomportamiento
autoliberatorioesadecuadoyconsentidosocialmente,loquehacequenodebieraestarsujetoaintervencin
punitivaademslavoluntaddelsujetodebeserdequebrantarlacondenademaneradefinitiva

29. El tiempo de un permiso quebrantado es abonable a la condena?


S,aunquelapersonapresahayaquebrantadolacondenaynohayavueltoalaprisin.Porello,losdasque
legalmentecomprendaelpermiso,debenabonarsealtotaldelacondena.Enestesentido,semanifiestala
Consultanmero1/1978de6deabrildelaFiscalaGeneraldelEstado.Elperododequebrantamiento
comienzaacontaraldasiguientealquetendraquehaberseincorporadoelinterno,tantoaefectosdel
cmputodedascumplidos,comoderedencin.

30. Se puede condicionar la concesin de un permiso al buen uso del


anterior?
S.EsunabuenaprcticadelaAudienciaProvincialdeMadrid....Debeemitirelmensajeinequvoco
de que si el preso da pautas de respetarla, si muestra su volunta de no delinquir, el Tribunal
mantendrsulneadesucesivospermisos,seatenderalosprincipiosdeunsistemapenitenciario
progresivoalahoradedecidirsobrelaprogresindegradoyseesforzarenqueelinternoalcancela
libertadenlasmejorescondicionesposiblesyellonoporrazoneshumanitariasniticassinocomo
compromisodeejercersinvacilacionessusfuncionesjurisdiccionalesycomoespecficamuestradela
sumisindelosJuecesalimperiodelaConstitucinylaLeyquebuscanlareinsercindelpenado
/AutoAP,Madrid,5de14deseptiembrede2000y19dejuliode2000).

Captulo 7
LAS COMUNICACIONES

1. En qu consisten las comunicaciones?


Lascomunicacioneshacenposiblequelaspersonaspresaspuedanestablecercontactoperidicamente,de
forma oral y escrita, en su propia lengua, con sus familiares, amigos y representantes acreditados de
organismos e instituciones de cooperacin penitenciaria, salvo cuando el Juez haya ordenado prisin
incomunicada(art.51.1LOGPy41RP).
ElderechoacomunicarvienegarantizadoenlaConstitucinespaolanoslocomoexpresindelart.18.3
CE,sinotambinyprimordialmentedelart.25.2CE,puesesestepreceptoelqueconstituyelanorma
especfica aplicable a los derechos fundamentales de los reclusos. Este derecho tiene una incidencia
sustancialeneldesarrollodelapersonalidaddelospresosyadquiereporello,unagranimportanciaen
ordenalcumplimientodelaspenasprivativasdelibertad.Graciasalascomunicacioneselpresonoqueda
reducidoexclusivamentealmundocarcelarioyselepermiterelacionarseconelexterior.Endefinitiva,la
comunicacinposibilitalafuturavidaenlibertadenelsenodelasociedad(STC175/1997de27deoctubre).

2. Se puede comunicar el cambio de prisin o el ingreso en una crcel?


S.Adems,esunderechoejercitableinmediatamente.Lapersonapresapodrcomunicarasufamiliayal
abogadoladetencin,oeltrasladoaotracrcelenelmomentodeingresarenlamisma.Estacomunicacin
sertelefnicaynopodrsercomputadadentrodelasquelecorrespondanduranteelmes(art.52.3LOGPy
art.41.3RP).Encasodecarecerdedinero,lostrabajadoressocialestienenlaobligacindeproporcionarlos
medioseconmicosparaefectuaresallamada,obien,realizarlaatravsdeellos.

3. Las comunicaciones pueden quedar sometidas a restricciones?


S,porrazonesdeseguridad,deordenyenintersdeltratamiento.Encualquiercasosedeberespetaralmximola
intimidaddelospresos(art.51.1LOGPy41.2RP).Cuandohablamosderestriccioneshacemosreferencia la
posibilidad del Director de denegar una comunicacin con determinadas personas, o reducir el nmero de
comunicacionesodesuduracin.Enningncasosepuedenrestringirlascomunicacionesconelexteriorcuandola
personaestcumpliendounasancindeaislamiento,todavezqueellegisladornolohaprevisto.Eliminla
anterior referencia de que fuese entre cinco y diez minutos, y en cualquier caso no se puede hacer una
interpretacinanalgicacontralegemdeunamediarestrictivadederechos(AutoAPGranada17/97).

4. Qu requisitos se exigen para la intervencin/retencin o suspensin de


las comunicaciones orales, escritas, telefnicas ?
La contestacin a esta cuestin es vlida para todos los tipos de restriccin de una comunicacin,
(intervencin,retencinosuspensin)yparacualquieraquesealaformadesta(oral,escrita,telefnica).
Losrequisitosquedebenobservarseparalarestriccindeunacomunicacinsonlossiguientes,hansido
mantenidos reiteradamente por la jurisprudencia constitucional (SSTC192/2002 de 28/10/02,193/2002 de
20/10/2002,194/2002de28/10/02):
a)Elacuerdoderestriccindelascomunicacionesdebenotificarsedeformamotivadaeinmediataal
JuzgadodeVigilanciaPenitenciaria.Elart.51.1y5LOGPpermitequelaintervencinserealiceporla

administracinpenitenciariadandocuentaposteriormentealJuezdeVigilancia.ElTribunalConstitucional
entiendequelaexigenciadequelacrcelpongaenconocimientodelJuzgadodeVigilancialaintervencin
delacomunicacinnosolamentepuedeconsistirenlameracomunicacindelrganoadministrativoal
judicialparaconocimientodeste,sinoqueunverdaderocontroljurisdiccionaldelamedidaefectuado a
posteriori necesitaunaresolucinmotivada.AesterespectolaSTC106/2001de23deabril,estableceel
acuerdo de intervencin de la correspondencia escrita, en ambos sentidos (del exterior al interior y
viceversa),debecomunicarsealJVP,puessinoseespecificaelmbitomaterialdelacuerdo,ylaautoridad
judicialnodictresolucinmotivadaalrespecto,limitndoseaunamerarecepcindetalcomunicacin,el
amparodebeconcederse.
Ellosededucedeunanecesariaconsideracinsistemticadeaqulpreceptoconlosarts.76.1y2g)LOGP
conformealoscualeslecorrespondealJuzgadodeVigilanciasalvaguardarlosderechosfundamentalesde
los internos que cumplen condena. A la misma conclusin conduce el art. 106.1 CE por el que la
administracin, tambin la penitenciaria, est sujeta al control judicial de la legalidad de su actuacin.
Adems,paravalorarentodasudimensinlaimportanciadeestamedidadebemostenerencuentaquela
intervencindelascomunicacionesaunreclusoafectatambinalosciudadanoslibresconlosqueaquliba
acomunicar.
Se establece, por tanto, la exigencia legal de que la medida de intervencin adoptada se comunique
inmediatamente ala autoridadjudicial,conelobjetodeque staratifique, anuleo subsane ladecisin
administrativa,esdecir,queejerzaconplenitudsucompetenciarevisorasobrelarestriccindeunderecho
fundamental(STC106/2001de23deabril),constituyndosecomoautnticagarantaenelquesepretendeel
controljudicialdelaintervencinadministrativanodependadeleventualejercicioporelinternodelos
recursosprocedentes,puescomoestableceenvotoparticulardelasSTC106/2001ParaqueelJVPejerce
plenacompetenciarevisorasobrelarestriccindeDF,suintervencinesautnticagarantaconloquese
pretendequeelcontrolaposteriorinotengalugarnicamenteenelcasodequeelinternoafectadorecurrala
intervencin,puesalJVPlecorrespondelasalvaguardadelosderechosdelosinternosyelcontrolde
legalidaddelaactuacinadministrativaconformeal106.1CE.ElcomportamientoactivodelJVPnose
limitaalmomentoenelquesecomunicaelacuerdotomadoenelcentropenitenciarioosucesivasprrrogas,
sinoqueseprolongadurantetodalavigenciadelamedidayseproyectasobreloadecuadodelaadopcinde
sta,comodelaformaenllevarseacabo.CabeconcluirquesielJuzgadodeVigilanciaselimitaseala
simplerecepcindelacomunicacinyadoptaseunaactitudmeramentepasivaantelarestriccindeeste
derechofundamentaldelrecluso,noestaradispensandolaproteccindelderechoenlaformaexigidaporlas
mencionadasnormas(SSTC,183/1984,175/1997,de27deoctubre,200/1997de24denoviembre,141/1999,
de22dejulio,188/1999,de25deoctubre,106/2001,de23deabril).
Adems, se exigequelacomunicacindelaintervencin al Juzgado deVigilancia se realice deforma
inmediata,porqueencasocontrarioserainexistenteelcontroljudicialdesdelaadopcindelaintervencin
hastalafechaenqueeljuzgadorecibieralacomunicacin.
En nuestra opinin, que la comunicacin de la intervencin al Juez se haga a posteriori aunque sea
inmediatamente,noesacordeconlasgarantasquedebenprevalecerenunEstadodeDerecho.Esloquese
pretendaenlafrustradaparcialmenteLeyCorcuera:ampliarcompetenciaselejecutivoysusagentesen
detrimentodelaindependenciajudicial.
b) Elacuerdodeintervencindebesermotivado. Lanecesidaddemotivacindeestasresolucioneses
exigenciadelart.51.5LOGPrespectodelanormativageneral,segnlaLeydeRgimenJurdicodelas
AdministracionesPblicasydelProcedimientoAdministrativoComn(Ley30/1992de26denoviembre),
ensusartculos54.1.ay89.3.
Paraconsiderarsuficientementemotivadalaresolucinnobastaconlameracomunicacinalpresodela
intervencinydelacitagenricadeunpreceptoreglamentario.Suponequedebedictarseunaresolucin
consucintareferenciadehechosyfundamentosdederechoascomolasrazonesmaterialesoindicios
objetivosquehanllevadoaelloycualdelasrazonesestablecidasporellegisladorseguridad,buenorden
delestablecimiento,intersdeltratamientoaconsejanadoptarunamedidatandrsticaydesproporcionada
comolaintervenirlascomunicacionesescritas.Ademssetienenqueexplicitarlascircunstanciasdelcasoe
inclusodelapersonadelinternoquepermitenconcluirquelaintervencinresultaadecuadaparaalcanzarla
finalidadperseguida.Perorespectodelaindividualizacindelascircunstanciasdelinternonoseexigeque
seanlasconcretasdeunapersonaafectada,sinopuedenserdeungrupoocolectivo.Enestoscasosloque

debeindividualizarseesesacaractersticacomnqueajuiciodelaAdministracin.justificalaadopcinde
lamedida.Respectodelosaspectosformaleselacuerdodebetenerlosdatosnecesariosparaqueelafectado
y, posteriormente, los rganos judiciales puedan llevar a cabo el juicio de idoneidad, necesidad y
proporcionalidad,aunquenoresultaexigiblequeenelmismoseexpliciteestetriplejuicioporpartedela
admn., si los referidos datos puedencompletarse con los que de forma clara y manifiesta estn en el
contextoenelqueseha dictadoelAcuerdo(SSTC128/1997,de 14de julio 141/1999, de22 dejulio;
200/1997,de24denoviembre,106/2001,de23deabril).
Enestesentidoyamayorabundamiento,lasentenciadelTribunalConstitucional170/1996de29deoctubre
(vertambinSTC128/1997)declaraque:elartculo51LOGPslolegitimalarestriccindelderechoal
secretodelascomunicacionesencuantoconcurranyperdurenlasrazonesquejustificanojustificaronensu
dalaadopcin.Deah,laimportanciadelamotivacindelacuerdodeintervencin,nosloporqueaslo
exigeelart.51LOGP,sinoporqueconstituyeelnicomedioparaconstatarquelalimitadaesferajurdicadel
ciudadanointernoenunCentroPenitenciario,noserestringeomenoscabadeformainnecesaria,inadecuada
oexcesiva.Delocontrario,estamosanteunintentodedarcoberturaformalaunclaroincumplimiento
materialdelasobligacionesparaconlosadministrados,enestecaso,presosenunacrcel.Enestesentido
(JVPdeSoriaexp.392/1997,JVPdeSevillaexp.253/1997,JVPnm.2deAndalucaexp.227/1997,JVPde
Ceutaexp.249/1997).
QueunpresoestclasificadoenprimergradoeincluidoenelficheroFIES1nojustificaporssololaadopcin
de esta medida, toda vez que la intervencin de las comunicaciones de un recluso debe tener un carcter
individualizadoyexcepcional,yhadeconstituirunarespuestaapeligrosconcretosqueefectivamentepuedan
incidirnegativamenteenelbuenordenyseguridaddelosestablecimientos.Laadopcindelamedidademanera
sistemticayparaunsectordelapoblacinreclusaenatencinasugradodetratamientonoseadecuaadicho
precepto;siendocontrario,portanto,alderechofundamentalalsecretodelascomunicaciones(STC175/1997de
27.10.97).Enestecasolaintervencindeunreclusodelascomunicacionesvulnerabaelderechoalsecretodelas
comunicacionespuescarecademotivacinalgunaalnopoderreputarsecomotallaescuetareferenciaaunos
genricosmotivosdeseguridadquenoseconcretabanenrelacinconlascircunstanciasparticularesdelrecluso
y de la crcel; no aportaba los elementos para hacer posible el juicio de proporcionalidad, no determinaba
temporalmentelamedidaytampocosediocumplimientoalaexigenciadecomunicacininmediataalJuzgado
(vulneracindel18.3enrelacinconel25.2,ambosdelaCE).
Comomotivacinnosirvenlasjustificacionesdecarcterintemporal,talescomoencontrndoseustedenel
rgimendevidadelart.94.1RPyconelfindeevitarquesepudierantramaractosquemenoscabenla
seguridaddesteuotroestablecimientopenitenciario.EnestesupuestoelJVPdeOviedodeclaranulala
intervencin(AutoJVPOviedode10dejuliode1996).
No es suficiente con la motivacin basada en lograr un mejor control y un conocimiento ms
individualizadosobreelrecluso;enestoscasos,elmejorconocimientodelreclusopodraguardarreferencia
asuspropiasposibilidadesdetratamiento,peropasadountiempo,laintervencinyanoquedalegitimada
desdeunpuntodevistaconstitucional;lomismoqueelmejorcontrolpodravincularsearazonesde
seguridadgeneral,perostas,nobastan,siendoprecisalaexistenciaderazonesconcretasdeseguridad
(AutoAPCuencade31.3.1999).
c)Debeserproporcional.Seexige,adems,quelaintervencinseadecuealaexigenciaconstitucionaldela
proporcionalidad.Ellosupone(STC175/1997):
Que sea idnea, es decir, que la medida de intervencin sea adecuada para el fin que se ha
decidido.
Queseanecesaria,enelsentidodequenosepuedaacudiraotromediomenosgravosoquela
limitacindeunderechofundamental.
Que sea proporcional en el sentido estricto, es decir, que exista una ponderacin entre los
beneficiosparaelintersgeneralylosperjuiciossobreotrosvaloresobienesenconflicto.
d)Elacuerdodeintervencindebeserlimitadoeneltiempo.Laintervencindelascomunicacionesno
puedemantenerseindefinidamente(128/1997,de14dejulio,175/1997de27deoctubre,200/1997,de24de
noviembre,188/1999,de25deoctubre,175/2000,de26dejunio),ElTEDHdictdossentenciasambasde
fecha15denoviembre1996,asuntoDominichineyasuntoCalogeroDiana,relativasalaintervencindelas
comunicacionesdereclusos.Enambassetomaenconsideracinparasuenjuiciamientoladuracindela

medida y las razones que la pueden justificar. Ciertamente el establecimiento de un mbito temporal
predeterminadoparalainterceptacinvieneestrechamenteligadoalrequisitodelaproporcionalidaddela
misma, pues la adopcin de una medida de estas caractersticas sin lmite no es capaz de justificar su
idoneidad para el fin perseguido (STC 175/1997).. Debe levantarse en el momento en que deje de ser
necesariaporcesacinoreduccindelascircunstanciasquelajustificaronrazonesdeseguridad,buen
ordendelestablecimientoeintersdeltratamiento(Encasodeampliacinodeprrrogaobligaraamotivar
lasrazonesporlascualesesarenovacinoprrroga,noelacuerdoinicial,resultabanecesaria,puesdelo
contrariolarestriccindederechosfundamentalesdelinternopodranperpetuarsedeformaindefinida(Auto
APCuencade31.3.1999).Ahorabien,paraellonoesestrictamentenecesariofijarunafechaconcretade
finalizacin, sino que sta puede hacerse depender de la desaparicin de la condicin o circunstancia
concretaquejustificalaintervencin.Elacuerdopuede,endeterminadossupuestos,sustituirlafijacindela
fechaporlaespecificacindeesacircunstancia,cuyadesaparicinpondrademanifiestoquelamedida
habradejadodesernecesaria(170/1996de29deoctubre,175/1997de27deoctubre,141/1999de22de
julio;ATC54/1999de8demarzo).Entodocasoenelacuerdodeintervencindelacomunicacindeben
expresarselascircunstanciasalasquesecondicionasucontinuacin.
Esms,elacuerdodeintervencindelascomunicacionesdebecontenerexpresamenteladuracindela
medidadeintervencin(STC175/1997).Enestemismosentido,
Silaintervencinnocesa,hayquesolicitaraldirectordelacrcelqueladejesinefectooquesealeun
plazotemporal;sinoaccede,estomismohayquesolicitarloalJuezdeVigilanciaenunescritodeQueja.En
casodedenegacindelapeticinhabraquerecurrirenapelacinlaAudienciaProvincial.Ysisedeniega
esta, hay que interponer un recursode amparo al Tribunal Constitucional. Ahora bien, desde el primer
recursoqueseinterpongaalJuezdeVigilanciatienequeconstarquesevulneraelderechofundamentalala
libertaddecomunicacindelart.18.3CE,pues,lasalegacionesdevulneracindeDerechosFundamentales
setienenquehacerenlosprocesosjudicialespreviosparaquepuedancorregirsuactuacin,bienpara
ofrecerlasrazonesdesurechazooprocederasusubsanacin(278/2000,de27denoviembre,19/2001,de29
deenero).

e)Lamedidadeintervencin/retencindebenotificarsealinterno.
Cuandonosecumplantodosestosrequisitosencualquierrestriccindecomunicacioneshayquerecurrirenqueja
alJuezdeVigilancia(modelonmero41.a),posteriormenteenreformaanteelmismo;despusenApelacinante
laAudienciaProvincialysisedesestimaenamparoanteelTribunalConstitucional.Siesterganotambin
desestimaelrecursohayquerecurriralTribunaldeDerechosHumanosdeEstrasburgoenlaformaqueenotro
captulosedescribir.

5.Qu ocurre si se impone una sancin por unos datos obtenidos en una
intervencin de comunicaciones sin que la administracin penitenciaria haya
observado los requisitos exigidos por el Tribunal Constitucional?
Lasancinesnulaporvulneracindelderechoalapresuncindeinocencia.EnlaSTC175/2000,de26de
junioseotorgaelamparoanteunasancinqueseimponealdemandantequetienecomohechojustificador
nicolasexpresionesquesecontienenenelescritoqueaqulremitialaaudienciaprovincial,enelque
vertancrticasalosfuncionamientodelosserviciosmdicosdelCentroPenitenciarioyalosfuncionarios
que,segnl,censurabanelcontenidodelosescritosquedirigaalosrganosjudiciales.Lanicaprueba
existente en el expediente administrativo sancionador, por virtud del cual se estimaron acreditados los
hechos,fueelpropioescritocuyocontenido,ensntesis,serecogeenelpliegodecargos,enlapropuestade
laresolucinyenelacuerdosancionador.Laalegacindelrecurrentedequesehabavulneradoelderecho
alsecretodelascomunicaciones,tampocoobtuvorespuesta expresadel rganojudicialalresolverlos
recursos.Lasancin,diceelTCsedebiaunapruebaobtenidailcitamente,porloquesevulneraelderecho
alapresuncindeinocenciadelrecurrente.

6. Pueden suspenderse o intervenirse las comunicaciones con los letrados?


Lascomunicacionesentreletradosypresosslosepuedenintervenirpreviaordenexpresadelaautoridad
judicial(arts.51.2LOGPy48.3RP)(verentreotrasAutoJVPMelillade28dejuniode1996).Enestos
mismostrminosseexpresan:
a) La Sentencia del Tribunal Constitucional 183/1984, de 20 de junio que seala que las
comunicacionesdelosinternosconsusabogadosslopodrnsersuspendidasointervenidas,demanera
motivadayproporcionadaporlaautoridadjudicial,sinquelodispuestoenlosapartados2y5delart.51de
laLOGPautoriceenningncasoalaadministracinpenitenciariaparainterferiresascomunicaciones.
b)Elartculo18.3delaConstitucindisponequesegarantizaelsecretodelascomunicacionesy,
enespecial,delaspostales,telegrficasytelefnicas,osalvoresolucinjudicial.Lamismanormasuprema,
ensuartculo55.2establecequeunaLeyOrgnicapodrdeterminarlaformayloscasosenlosque,de
formaindividualyconlanecesariaintervencinjudicialyeladecuadocontrolparlamentario,losderechos
reconocidosenlosartculos17.2y18.2,3,puedensersuspendidosparapersonasdeterminadas,enrelacin
conlasinvestigacionescorrespondientesalaactuacindebandasarmadasoelementosterroristas.
c)ElDerechoconvencionalrepresentadoporlospactosyacuerdosinternacionalesenmateriade
proteccindederechosfundamentalessuscritosporEspaahacenreferenciaalagarantadelsecretodelas
comunicaciones.Enestesentido,laDeclaracinUniversaldelosDerechosHumanosde10dediciembrede
1948sealaensuartculo12quenadieserobjetodeinjerenciasarbitrariasensuvidaprivada,sufamilia,
sudomicilioosucorrespondencia.Porotraparte,elPactoInternacionaldeDerechosCivilesyPolticosde
19dediciembrede1966sealaensuartculo17quenadieserobjetodeinjerenciasarbitrariasoilegales
ensuvidaprivada,sufamilia,sudomicilioosucorrespondencia.
d)Hemosdealudirporltimo,alanormativaenmateriadeluchacontraelterrorismo.Deespecial
importanciasonlosartculos384bis,504bis,520bis,533y,579.3y4delaLeyOrgnica4/1988de25de
mayoquereformalaLeydeEnjuiciamientoCriminal.Elartculo579.3establece:Deigualforma,elJuez
podracordar,enresolucinmotivada,porunplazodehastadetresmeses,prorrogableporigualesperodos,
laobservacindelascomunicacionespostales,telegrficasotelefnicasdelaspersonassobrelasqueexistan
indiciosderesponsabilidadcriminal,ascomodelascomunicacionesdelasquesesirvanparalarealizacin
desusfinesdelictivos;y,elartculo579.4,Encasodeurgencia,cuandolasinvestigacionesserealicenpara
la averiguacin de delitos relacionados con la actuacin de bandas armadas o elementos terroristas o
rebeldes,lamedidaprevistaenelnmero3deesteartculo,podrordenarlaelMinisteriodelInterioro,en
sudefecto,eldirectordelaSeguridaddelEstadocomunicndoloinmediatamenteporescritomotivadoal
Juez competente, quien tambin, de forma motivada, revocar o confirmar tal resolucin en un plazo
mximodesetentaydoshorasdesdequefueordenadalaobservacin.

7. La necesidad de autorizacin judicial que ampara la intervencin de las


comunicaciones orales entre abogado y defendido-preso alcanza tambin a
las comunicaciones postales?
S.Laintervencindelascomunicacionesoralesentreabogadoydefendidotienequehacerseporordendela
autoridadjudicialyenlossupuestosdeterrorismo(requisitosacumulativosynoalternativos);estagaranta
debeextendersetambinalaintervencindelascomunicacionesescritas.
LaSTC58/1998,de16demarzo,sealaqueassepuede,yconstitucionalmentedebeentendersequeel
sistemadegarantasreforzadasparalaintervencindelart.51.2delaLOGPcomprendelascomunicaciones
escritasdeltipoquesean,entrepresoyabogadoyquelaalusindedichoapartadoalacelebracinde
departamentos apropiados no supone una exclusin de las comunicaciones escritas, sino una mera
especificacindelmodoenquedebencelebrarselasorales(F.J.7).Enestecaso,seestimaquelosAutosdel
JVPydelaAPvulneranlosderechosdelrecurrentealsecretodelascomunicaciones(art.18.3CE)yala
defensa(24CE).Elhondodetrimentoquesufreelderechoaladefensaarazdeestetipodeintervenciones,
sebasaenlapeculiartrascendenciainstrumentalquetieneelejerciciodeesederechoparaquienseencuentra
privadodelibertadypretendecombatirjurdicamentedichasituacinolascondicionesenquesedesarrolla.

Quedichodetrimentoseproduceporlaintervencindelascomunicacionesdelpresoconelabogadoyporel
hechodequedichaintervencinseaadministrativa,esalgotanostensiblequenorequieregrandesesfuerzos
argumentativos, a la vista tanto de la importancia que el secreto de tales comunicaciones tiene para el
adecuadodiseodelaestrategiadefensiva(comosealaelTEDHensussentenciasde28dejuniode1984
casoCampbellyFell vs. Reinounidopargrafos111yss.,yde25demarzode1992,casoCampbell
pargrafos46yss.).LoEstehechoquedemandalasmximasgarantasparasulimitacin,comodelhecho
dequesuobjetopuedeserlapropiaatribucindeinfraccionespenalesoadministrativasenlaadministracin
penitenciaria(FJ5,prrafo3).

8. En el caso de los presos preventivos, qu Juez es competente para


decretar la intervencin de las comunicaciones?
ConcarctergeneralseaceptaqueseaelJuzgadodeInstruccinqueacordlaprisin,siemprequeencaso
dequelainformacinqueelinternopuedadarorecibiratravsdelacomunicacinafectealainstruccinde
lacausa.Elpresoprovisionalpuededependerdevariosjuzgados.peroEllonoslosignificarquetodosy
cadaunotenganquehaderesolversobrelaintervencindelascomunicaciones,sinoquebastaconqueuno
loacuerdeomantengaparaqueselleveacabo,yencasodecontradiccinelTribunalqueconozcadela
apelacinpodrunificarcriterios.Silosdatosquesepuedandarorecibirsolamenteafectanalordeno
seguridad del centro penitenciario el Juzgado de Vigilancia podra ser el competente para decretar la
intervencin. Es decir si la intervencin se acuerda al amparo de lo establecido en el art. 51 LOGP,
corresponderalJuezdeVigilanciaPenitenciariaynoalJuezoTribunalacuyadisposicinseencuentre
(Criterio13reuninJVPenero2003).

9.

Quin

es

competente

para

conocer

de

los

recursos

contra

la

intervencin de las comunicaciones en caso de los presos preventivos?


ElconflictosurgeentreelJuzgadodeInstruccinoelJuzgadodeVigilancia.ElTribunalSupremoenAutos
de 16 de noviembre de 1999 y 10 de diciembre de 1999 resolviendo sendos conflictos negativos de
competenciahaentendidoqueescompetenteelJuzgadodeVigilanciaPenitenciaria.Enlaresolucinha
utilizadolossiguientesargumentos:
1)Segnelart.94LOPJsealaqueexistirnJuzgadosdeVigilanciacontrescompetencias:a)en
materiadeejecucindepenasprivativasdelibertad,b)controljurisdiccionaldelapotestaddedisciplinaria
de las autoridades penitenciarias, c) amparo de los derechos y beneficios de los internos en los
establecimientospenitenciarios.
2)LaLOGP,ensuartculo76enunciaconminuciosidadlascompetenciasdelJuezdeVigilancia
penitenciariaentrminosdeinequvocaatribucincompetencialaldecirque...correspondeespecialmenteal
JuezdeVigilancia..."yentreellasseencuentralaletrag)lade"...acordarloqueprocedasobrepeticioneso
quejasquelosinternosformulenenrelacinalrgimenytratamientopenitenciarioencuantoafectealos
derechosfundamentalesoalosderechosybeneficiospenitenciariosdeaquellos..."
3)Deladoctrinaconjuntadelosartculos94LOPJy76LOGPpuedeafirmarsesinriesgodeerror
que los Juzgados de Vigilancia constituyen dentro del orden penal, una jurisdiccin especializada,
encontrndoseelabanicocompetencialqueintegraestajurisdiccinespecializadaenelcitadoart.76LOGP,
delquedeberesaltarsealosefectosdelpresenterecurso,lacompetenciadecontrolfrentealasquejasque
procedandelpropiosistemapenitenciario.Talcompetenciaesunamanifestacindelprincipiodequeel
derechonosedetienealaspuertasdelasprisiones.Significativamenteelapartadog)delart.76quese
comentaserefierea"losinternos",eidnticaexpresinsecontieneenelart.51LOGPcuandosereconoceel
derechoalaintimidaddelascomunicacionesyalaposibilidaddeintervencin"dandocuentaalaautoridad
competente".Taldacindecuentastieneelcarcterdeefectivocontrolquesedeberconfirmarorechazar,

yaquelafuncindegarantedelosderechosdelosciudadanosinternos,noseacompasaalpapeldemero
notificado.Entodocaso, yaloque aquinteresaesclaro queesa autoridadcompetente es el Juez de
VigilanciaPenitenciariaportratarsedelimitacindeunderechofundamentaldeunciudadanoprivadode
libertadacordadoporlapropiaautoridadpenitenciaria.Lorelevanteparataladscripcincompetencialesla
situacindeencontrarseenprisin,siendoindiferentequeestcomopreventivoocomopenado,puesambas
condicionesseavienenaltrminointernoqueesexclusivamenteelutilizadotantoenelart.51comoenel76
LOGP.
4)EsciertoqueelRD1901/96de9defebrerosealaensusartculos43y46quelarestriccinde
comunicaciones deben ponerse en conocimiento del Juez de Vigilancia en el caso de penados y de la
autoridadjudicialencasodedetenidosopresospreventivos.Estanormavaencontradeloestablecidoenla
LeyOrgnica,porloquenopuedetenerseencuenta.

10. Qu tipos de comunicaciones existen?


LaLeyPenitenciariaestablecevariostipos:orales,escritas,telefnicasyespeciales.

11. Cmo se llevan a cabo las comunicaciones orales?


ElConsejodeDireccindecadaprisinfijarlosdasdelasemanaenquelaspersonaspresaspueden
comunicar(sbadosydomingos).Laconcesinserealizarpreviapeticindehora,bientelefnicamenteo
bienpersonalmenteporlaspersonasquedeseencomunicar.Paraellosedaraconocerelnmerodetelfono
yhorarioenquelosvisitantespodrnsolicitarlascomunicaciones.Losvisitantesofamiliaresautorizados
que soliciten la comunicacin debern manifestar el nombre, domicilio, DNI, parentesco, da y hora
preferentequedeseencomunicar.ElDirectorpodrautorizarelcambiodedayhoradelacomunicacin
cuandosejustifiquesuficientementelaimposibilidaddeacudiracomunicarlosdasyhorasestablecidos(I
24/96).Losfamiliaresdebernacreditardocumentalmenteelparentescoconlosreclusos.Essuficientecon
ellibrodefamilia.Enloscasosdeconvivenciadehechobastaconuncertificadodeconvivenciaexpedido
porelAyuntamiento,yenalgunascrcelesconelexpedidoporelcuradelaparroquia.
Parapodercomunicarconamigosyallegadossenecesitalaautorizacindeldirector.Paraello,elpresotieneque
solicitarlacomunicacinporescritoenunainstanciaaldirector,quienlaautorizarodenegar.Enlasolicitudpara
comunicarconamigosoconocidossedebenincluirsusnombresyelDNI.ParalospresosincluidosenelFIESse
exigetambinlafechadenacimientoyelnombredelospadresdelcomunicante.Estaprcticaesilegal,yanteella
nocabeobjetarqueelDNIdelvisitanteesenocasioneserrneo,pues:a)tambinpuedeserlolosdatosrelativosa
lospadresdelvisitanteyb)sielinternoaportaunnmerodeDNIequivocado,laresolucinsobresupeticin
podrretrasarsehastaqueaporteelcorrectoopodrtenersentidodesfavorable(AutoAPMadrid5241/99de3de
febrerode1999).Llamalaatencinquelacrcelatribuyaalosinternosla"inauditacalidad"de"administradoresde
privacidad"detercerosajenos,concretamenteladelosvisitantesquenosseanfamiliares;porqutienequeserel
presoquienaportededatosajenos?.Porotrolado,cabepreguntarseporqusolamenteseexigealospresos
incluidosenelFIESlamediafiliacin,hechoquesuponelavulneracindelderechoconstitucionalalaigualdad
(art.14CE)que"desdeluegolaspeculiarescaracteresdelarelacinde"sujecin"especialentreelinternoyla
administracin penitenciaria no queda legitimada para restringir de una manera carente de razonablidad y
proporcionalidad,comolaqueendefinitivaseestablece,alexigrselesolamentealosinternosincluidosenelFIES
(AutoAPNavarra38/99de17dejuniode1999).
Laspersonasquecomunicannopuedenexcederdecuatrosimultneamenteporcomunicacinylocutorio(art.42.3
RP).SisedenieganhayquehacerunescritodeQuejaalJuzgadodeVigilanciaparaqueautoricelacomunicacin
(modelonmero42.a).

12. Pueden concederse comunicaciones orales extraordinarias?


S.Ademsdelascomunicacionesordinariassealadassepuedenconcederotrasdecarcterextraordinariocomo
recompensasopormotivosdebidamentejustificados(art.41.6RP).

13. Con qu frecuencia se puede comunicar?


Las personas presas disponende dos comunicaciones de veinte minutos como mnimo por semana. No
obstante,silascircunstanciasdelacrcellopermiten,sepuedeacumulareltiempodelasdosenunanica
visitasemanal(art.42.3RP).
Porsuparte,laspersonasclasificadasentercergradopodrncomunicartodaslasvecesquequieranyque
permitasuhorariodetrabajo.

14. Pueden acumularse en un mismo da dos comunicaciones orales, o una


oral y otra especial?
S.Puedeocurrirqueporlejanadelaresidenciadelafamilia, stanopuedadesplazarseacomunicar
peridicamente.Enestecasohayquesolicitaraldirectordelacrcelqueseacumulenenunsolodalas
comunicacionesorales,ostasylasespeciales(visavis,familiares).
Labaselegalparaquesepermitaestaacumulacindecomunicacionesseencuentraenelart.42.4RPque
prevexpresamentequeantelasdificultadesdelosdesplazamientosdelosfamiliaressetendrnencuentala
organizacindelasvisitas.Estepreceptopermitequeseacumulenlascomunicacionesreseadas(vid,entre
otrosAutoJVPdeMelillade28dejuniode1996,20dediciembrede1996;AutoJVPdePalmadeMallorca
de28deabrilde1995).ElJVPdeLasPalmasenelAutode6deagostode1994permiteacumularlasvisitas
quemensualmentetengaderechoelinternodurantecuatrodasconsecutivosounfindesemanasegn
resultemsconvenienteparalaorganizacindelCentro(EnelmismosentidoJVPLaspalmasde18de
mayode1996).
Sehallegado,enocasiones,aordenareltrasladodeunpresoaotracrcelmscercanaaldomiciliofamiliar
porunperododeunmesparaquepuedacomunicarconsumadre,queporlaenfermedadquepadeca,no
podatrasladarsehastalacrceldondesuhijocumplacondena(AutoJVPCastillalaMancha2de21/06/99).
Estaposibilidadesmuyexcepcional,pero,entodocaso,lotienequesolicitarelpenadoconlosinformes
mdicosdelfamiliarconquienquierecomunicar.

15. Cules son los trmites para la intervencin o suspensin de las


comunicaciones orales?
Cuandolacomunicacinoralvayaaserdenegadaparaunadeterminadapersona,orestringidao,ensucaso,
intervenida(grabadaporsistemasdeescuchaenlocutorios)eldirectordebeacordarloporresolucinmotivadaenla
quedebenconstarlasrazonesdeladecisin.AsimismodebeexistiracuerdopreviodelaJuntadeTratamiento.
TodoellodebenotificarsealapersonapresaydebeponerseenconocimientoinmediatodelJuezdeVigilanciasila
personafuesepenada,ydelaautoridadjudicialcompetentesifuesedetenidoopresopreventivo(art.43.1RP).Ha
dehacerseconstarellmitetemporalquevaadurarlaintervencin,yhadeseradoptadacuandoseaadecuadaalos
fines buscados y cuando no existan otros medios menos atentatorios contra los derechos fundamentales
(proporcionalidad).

16.

De

qu

forma

debe

llevarse

cabo

la

suspensin

de

las

comunicaciones?
Eljefedeserviciospuedeordenarquesesuspendancuandoexistanfundadasrazonesparacreerquelas
personasquecomunicanestnpreparandoalgunaactuacindelictivaoqueatentecontralaconvivenciaola
seguridad de la crcel, o que estn propagando noticias falsas que perjudiquen o puedan perjudicar
gravementealaseguridadoelbuenordendelestablecimiento(art.44.1.aRP).Eljefedeserviciosdeberdar
cuentainmediatadelasuspensinaldirectoryste,asuvez,siratificalamedidaenresolucinmotivada,
deberponerloenconocimientodelJuezdeVigilanciaenelmismodaoenelsiguiente.Debernexistirlos
requisitosfijadosporlajurisprudenciaqueyahemosrepetidoanteriormente.

17. De qu forma deben llevarse a cabo las comunicaciones escritas?


Las personas presas pueden comunicar por escrito con las personas, asociaciones, profesionales e
institucionesquequieran.
Noseestablecenlimitacionesencuantoalnmerodecartasotelegramasquesepuedanrecibiromandar
salvoenlossupuestosdeintervencin,encuyocaso,slopodrnmandarsedosporsemana(art.46RP).
En las cartas que manden las personas presas deber figurar el nombre y apellidos del remitente y se
registrarnenunlibro.Cuandoestascartasllamenlaatencinalfuncionarioencargadodelregistroporsu
volumeno,respectodelosdatosdelpreso,sedevolvernasteparaqueenpresenciadelfuncionariolas
introduzcaenotrosobrequeserfacilitadoporlaadministracin(art.46.3RP).
Lacorrespondenciaqueserecibaseanotarenunlibroderegistrodeentrada.Seleentregarpersonalmente
yseabrirenpresenciadesteparacomprobarquenocontieneobjetosprohibidos.

18. En qu casos se puede intervenir la correspondencia?


Laintervencinpuedehacerseporordendeldirectorsobrelabasederazonesdeseguridad,deintersdel
tratamientoobuenordendelestablecimiento.Enlapreguntacuartadeestecaptuloyaseexpusieronlos
requisitosnecesariosparallevarlasacabo.
Lacomunicacinescritaentrepresosyabogadosdefensoresoprocuradoressolopodrserintervenidapor
ordendelaautoridadjudicial.Noobstante,cuandounapersonatengaintervenidalacomunicacinescritay
mande una carta a alguna persona manifestando que es su abogado defensor o procurador, dicha
correspondenciasepodrintervenir,salvocuandohayaconstanciaexpresaenelexpedientedelpresodeque
dichapersonaessuabogadooprocurador(art.46.6RP).Esteartculovulneraclaramenteelderechoal
secretodelascomunicacionesentreabogadoydefendido.Elargumentoessencillo.Puedeserqueuna
personatengavariascausaspendientes,yqueporningunadeellassehayadecretadoprisin;encasodeque
remitaunacartaalabogadopersonadoenalgunadeestascausaspuedeserintervenida,puesenlacrcelno
tienenconstanciadelamisma.Lomismopuedeocurrirensituacionesmssencillas:enlascrcelesno
constantodoslosabogadosdefensoresdelascausas,porquesepuedevisitaralpresocomoexpresamente
llamado.Enestecaso,lacartatambinpuedeintervenirsesinlaautorizacinjudicialporqueelnombredel
letradonoconstaenlacrcel.
Encasodequeestoocurra,hayqueponerloenconocimientodelJuzgadodeVigilancia,ydelJuzgadode
Guardiaporlaposiblecomisindedelito.

19. En caso de intervencin de la correspondencia, queda limitado el


nmero de cartas que se pueden escribir/recibir por parte de los presos?
No.ElReglamentonofijalmitesencuantoalasquepuedanrecibir.Ahorabien,elart.90RPnoestablece
unnmeromximosinomnimodecomunicacionesoralesystasvienenlgicamentelimitadasporlas
posibilidades de la crcel y por los derechos de los dems internos. Pero este no es el caso de las
comunicaciones escritas pues el servicio de correos no queda afectado por un ligero incremento de la

correspondencianielhechodequeunpresoescribamscartaslimitaelderechodeotrouotros.Aellohade
aadirsequeunavezintervenidalacorrespondencianoseadviertecomopeligrodequelosreclusosse
sirvandeellaparafacilitarinformacinsobrefuncionariososobreinstalaciones.Adems,lascartastanto
puedenocuparunacuartillacomovariosfoliosytampocoseentiendecomounaeventualdistribucindesu
contenidoendossobrespuedaserinocuaypasaraserpeligrosasiseintroduceenmsdedos(AutoAP5
797/1997,de23dejuliode1997yde28dejuniode2000).Entodocaso,ellmitedebequedarfijado,como
mnimo,endoscartascadasemanaparalaspersonasquetenganintervenidalacorrespondencia,debiendoel
centropenitenciarioprocurarquepuedanescribirmsdedos(AutoAP5299/99de5demarzode1999y
AutoAP5331/99de16demarzode1999).

20. En caso de limitacin de las comunicaciones escritas puede un preso


solicitar que otro agote su cupo?
S.Puedeocurrirqueunapersonahayaagotadodoscomunicacionesescritasynecesiteescribirotracarta.En
estecasopuedepediraotropresoquedentrodelcupodecomunicacionesquestetienemandelasuya.
El fundamento legal de esta posibilidad tiene como base que la nica finalidad de limitar las
comunicaciones escritas que se encuentren intervenidas es facilitar el control por parte de la
Administracinpenitenciaria, afinde prevenir un excesivonmerodecomunicaciones quehicieran
inviable ese control. Si ello es as, es claro que mientras no se exceda por cada preso del tope
reglamentarionosevulneralafinalidaddelalimitacin,ynopuedeconsiderarseprohibidooilcito
queuninternoquehayaagotadosusdoscomunicacionesescritas,solicitedeotroqueagotesucupo,
remitiendolascomunicacionesqueelprimeronopuedemandarporesaexclusivaraznnumrica.Es
unamanifestacinmsdelalibreeleccindelospresosque,sindaoalgunoparanadieysinvulnerar
preceptoslegalesnireglamentarios,puedenejercer(vid.AutoJVPCiudadRealde14denoviembre
1990).

21. Se pueden mandar cartas de prisin a prisin?


S,perosecursarnatravsdeladireccinypodrnserintervenidas(art.46.7RP).Setratadeunanueva
vulneracindelderechoalsecretoenlascomunicaciones.Estepreceptosuponeunadirectalimitacindel
contenido esencial del derecho fundamental por cuanto la intervencin de la correspondencia es un
eufemismoquenotieneotrainterpretacinquelalectura,estoes,queelconocimientoportercerosdel
contenidodelascartas,locualesdirectaeinsalvablementeincompatibleconelsecretoquepreservala
Constitucin(art.18)ynosecontemplacomounaexcepcin,susceptibledejustificacincasoporcaso,sino
comounmandatogeneral,comounaobligacinimpuestaaldirectordelestablecimiento,excusadadetoda
motivacin. Esta limitacin constituye un ataque directo al secreto de las comunicaciones sin aparente
contrapartida(AutoAP5deMadridde28demayode1994).EstanormaReglamentariahasidocorregida
porlajurisprudenciadelTribunalConstitucional,enelsentidodequesedebenexigirlosmismosrequisitos
quealascomunicacionesgenricas(STC169/2003,de29deseptiembre)puessibiensepuedenrestringir
derechosdelosinternosnopuedeadmitirsequeseaconstitucionalmentelegtimoestablecerunarestriccin
alsecretodelascomunicacionessinlasexigenciasestablecidasporelTribunalConstitucional(portodas
SSTC193/2002y194/2002,ambasde28deoctubre).EnestecasootorgaelTCotorgaelamparosolicitado
porqueelacuerdodeintervencincarecedelamotivacinconstitucionalmenteexigiblepuesesunamedida
desproporcionadaporlafaltadeunajustificacinrazonable,afectaalageneralidaddelosreclusospresentes
yfuturosynotienelmitetemporal.Deestaintervencindecorrespondenciaentrepresossederivuna
sancin disciplinaria motivada por las expresiones injuriosas frente a funcionarios. El Tribunal
Constitucionaltambinlaanul.
Noestdemsrecordarqueelcondenadoapenasdeprisingozardelosderechosfundamentales,aexcepcinde
losqueseveanexpresamentelimitadosporelcontenidodelfallocondenatorio,elsentidodelapenaylaLey
Penitenciaria.Dadoquenilasentenciacontienerestriccionesalacorrespondencia,nielsentidodelapena
tampoco,slosepuedenintervenirenloscasosestablecidosenlaLOGPyconlosrequisitosjurisprudencialmente
establecidosqueyahemossealadoenlapreguntacuartadeestecaptulo.Demaneraquesolamentepodrn

intervenirselacorrespondenciaquemantenganentresinternosencrcelescuandoconcurranlascausaslegales
paraello:seguridad,buenordenotratamiento(AutodelJVPdeSevillade10deabrilde1996).Estajurisprudencia
hasidoratificadaporelTribunalConstitucionalenlaSTC188/1999de25.10.99.Enstaseresuelveelrecurso
deunpresosancionadoporenviarcartaaotraprisindirectamentesinpasarporladireccindelCP;la
sancintienesufundamentoenqueintentsacardelacrcelunacartadeformanoreglamentaria.ElTC
mantienequeelJuzgadodeVigilanciadictautojudicialcarentedemotivacinexpresa;yadems,notuvo
encuentaqueseestabasancionandoaunapersonaporejercerunderechoconstitucionalreconocidoenelart.
18.3CE.Lasresolucionescarecandemotivacinydelanecesariaponderacindelderechofundamentalal
secretodelascomunicacionesgarantizadasconstitucionalmente.Elautojudicialnopermitaconocerlas
razones jurdicas tenidas en cuenta para rechazar la pretensin del recurrente; tampoco analizaban la
incardinacindeloshechosenelpreceptolegalaplicadonilaincidenciaenloshechosdelart.98.5RPdel
quesederivalaobligacinderemitirlacorrespondenciaatravsdelDirectordelaprisin.Ademssilencia
absolutamente las posibles vulneraciones de Derechos fundamentales. Parece lgico que por razones de
seguridadydebuenordensepuedajustificarunarestriccinenlaformadelenvoyenlanecesidaddeque
seefecte atravsdel directorde lacrcel;dichasrazones pueden servir desoportepara unaeventual
intervencin;perostanopuedeserautomticaynopuedeprescindirseparasuprcticadelasformasyde
lasgarantasqueordenaelart.98.4RP.Porexigenciasdeesteltimopreceptolaintervencinhadeser
ordenada motivadamente por la Junta de Rgimen o por la direccin, ha de notificarse al interno y
comunicarsealJuezdeVigilanciaPenitenciaria.
Cuando se intervenga una carta entre internos hay que interponer Recurso de Queja ante el Juez de
VigilanciaPenitenciaria(vermodelosnmero41.b).

22. En qu casos se puede comunicar por telfono?


Sepuedecomunicarportelfonoconlasmismaspersonasquepuedenhacerlodeformaoral,cuandoaqullas
residanenlocalidadesalejadasdelCentroPenitenciarioynopuedandesplazarseparalascomunicacionesorales.
Tambinesposiblecuandoelinternodebacomunicaralgnasuntoimportantealosfamiliares,abogadodefensoro
aotraspersonas(art.47RP),siemprequelascircunstanciasdelestablecimientolopermitan.Pero,sinoseadmiten
las llamadas por circunstancias del establecimiento, la Junta deber motivar estas circunstancias con datos
objetivos,puesdelocontrario,lascomunicacionestelefnicasdebernautorizarse(AutoAPSoriade20.11.2000).
La comunicacin se debe solicitar al director; ste una vez comprobados los requisitos la autorizar y
sealardayhoraenquedebacelebrarse.Siemprequeseaposibleporlainfraestructuradelacrcelpodrn
hacersecincollamadasporsemana,enpresenciadeunfuncionarioyconunaduracinnosuperioracinco
minutos(art.47.4RP).Noobstante,losjuecessealanquelaposibilidaddeusodetelfonoenelmedio
penitenciarionodeberapresentarespecialesproblemas,pueslasllamadastelefnicassonalgotancotidiano
comopasearoverlatelevisin,ylapenaprivativadelibertadnadatienequeverconlanecesidadde
limitarlasoimpedirlas,salvolacuestinprcticaquesurgecuandosetratadedistribuirlautilizacindel
telfonodeformaequitativaentretodoslosreclusos(AutoAPLaRiojade4.4.2001).
Estascomunicacionespuedenhacerseensupropialengua,todavezqueelart.51LOGPdisponeque:los
internostienenderechoacomunicarseperidicamentedeformaoralyescritaensupropialengua";ylo
mismohabraqueafirmaraunquenoexistieseestanorma,puesnegarestederechoalhablarportelfono
equivaldra en ocasiones a la del propio derecho a comunicarse, con independencia que por motivos
fundamentados de seguridad la comunicacin se intervenga (Auto AP 5 Madrid de 17.12.1998). Para
solicitarlacomunicacinconalabogadosetienequeexpresaraldirectorelmotivoconcretoylaurgencia
parahacerlallamada(AutoAPMadrid,5,de17demayode2001).

23. Se pueden sustituir comunicaciones orales por telefnicas?


S.Estopuedeocurrircuandounapersonanocomunicaoralmenteconsusfamiliaresporlejanadellugarde
residencia. Enestecaso, sinsobrepasar el lmite decincollamadas semanalesqueseestablecenporel
Reglamento,lasdoscomunicacionesoralesalasquesemanalmentesetienederechopuedensustituirsepor
comunicacionestelefnicas.

Labaselegalparaestaposiblesustitucinseencuentraenunainterpretacinsistemticadelart.47.1RPque
establecequepodrautorizarselacomunicacintelefnicadelosinternoscuandolosfamiliaresresidanen
localidadesalejadasonopuedandesplazarseparavisitaralpreso.Esteartculopuestoenrelacinconel51.4
LOGPpuedellevarnosalaconclusindequelascomunicacionesoralestelefnicassonsustitutivasdelas
orales previstas en el art. 42 RP, toda vez que si los internos tienen derecho a un mnimo de dos
comunicacionesoralesporsemana,hadeentendersequesinopuedendisfrutardetalescomunicacionespor
lalejanadellugarderesidenciadesusfamiliares,podrnefectuartalescomunicacionesdeformatelefnica
(VerAutoJVPdeMelillade20dejuniode1996).

24. Se puede llamar desde el exterior a las personas presas?


Generalmenteno,salvoencasosexcepcionalescuyanecesidadserapreciadaporeldirector.Encasodeque
losdoscnyugesofamiliaresseencuentrenpresos,unodeellos,necesariamentedeberecibirllamadasdesde
elexteriordadalaimposibilidaddedesplazamientoacomunicaryelderechodeambosacomunicarse.En
estecaso,loscentrospenitenciariosdeberanadoptarlosmediosnecesariosparaqueestacomunicacin
pudiesellegaraejecutarse(AutoAPPalenciade11.9.2001).

25. En qu consisten las comunicaciones especiales?


Enlaposibilidaddecomunicarvisavis(caraacara),esdecir,sincristalesnibarrotes.Puedenserdetres
tipos:ntimas,familiaresydeconvivencia(art.45RP).Todasellassoncompatiblesyacumulablesyse
puedensucedereneltiemposalvoqueperjudiquenauntercero(criterio33reuninJVP,2003)
a)Lasntimasseconcedernunavezalmescomomnimo.Serealizarnenlocalespreparadosalefecto.Los
horariossernestablecidosporlosConsejosdeDireccinysuduracinnoserinferioraunahoranisuperiora
tres.Losfamiliaresquerealicenestascomunicacionesnopodrnportarbolsosopaquetes.Tampocopodrnllevar
consigoaniosmenores(art.45.3RP).Ahorabienesindiferentequeloscomunicantesseandelmismosexo(Auto
JVPCastillaLaMancha2de11.11.99ycriterio27reuninJVP2003).Estascomunicacionespuedenconcederse
aunquelosdosmiembrosdeunaparejaestnenprisin(Criterio28ReuninJVP2003);ynoexisteinconveniente
enquelavisitantimatengalugarconunapersona(esposaonoviaactual)ylascomunicacionesdeconvivenciase
realicenconloshijos,inclusoacompaadosporpersonadistintaalaanterior(Criterio31reuninJVP,2003).
Estascomunicacionespuedenrealizarseconfamiliaresoconpersonasunidasporvnculosdeafectividadde
hechooderecho(art.41.1y45.3RP).Sesueleexigirlapresentacindecertificadosdeconvivenciaconla
personaquesepretendetenerlacomunicacinvisavis.Peropuedeocurrirquenohayanvividonuncajuntos
ysmantenerunarelacinafectiva.Probarestoesimposibleenlasituacinenlaqueseencuentranlos
comunicantes;porello,algunosJuecesentodocasolasconceden(AutoJVPPuertodeSta.Marade9de
mayode1997;AutoJVPZaragozade27deagostode1996).
Ahorabien,enocasioneslosjuecesseadmitenestascomunicacionessinelcertificadodeconvivencia.El
Reglamento Penitenciario, en el art. 45.4 RP al establecer las comunicaciones ntimas no establece el
requisitodequeseacnyugeopersonaligadaporsemejanterelacindeafectividad(estovieneenel
num.5paralascomunicacionesfamiliares).Porellonoincluyecomonecesarialaconvivenciapreviaparala
comunicacinntima.Siseexigeestaconvivenciapreviaseniegaalreclusoelpoderestablecerrelaciones
afectivasapartirdesuingresoenprisin,delquelgicamentenopuedeprivrsele;nopuedenegarseesta
potencialidad humana, que dimana de su dignidad y libre desarrollo de la personalidad. Por ello, en
ocasionessolamenteseexigeladeclaracindequeconunadeterminadapersonasemantieneunarelacin
sentimentaldepareja,nonecesariamentedeconvivencia,talycomoocurreeneldesarrollodelavidaen
libertad: se supedita, en todo caso, que la otra persona tambin lo solicite, o que la administracin
penitenciaria aporte las pruebas por las que se opone a la mencionada comunicacin basadas en la no
existencia de relacin sentimental (Auto AP 2 Huelva de 20.1999) Con estas resoluciones judiciales se
inaplicaloestablecidoenlaInstruccin24/96delaDGIPporlaqueseexigeparalascomunicaciones
ntimaslaacreditacindocumentaldelarelacindeafectividadynohabercelebradootrasconanterioridad
durantelosseismesesanterioresconpersonadistintaalasolicitada.

En estas comunicaciones se autoriza la entrada de sbanas, cabezal y toallas propias atendiendo a la


individualizacindeltratamientoquesuponeatribuirauninternounapersonalidad,queenelcasoquenos
ocupapuedellevaraunarepugnanciahaciaropasuministradaporlacrcel,quepodrestarlimpia,peroque
seguroestusadaporotrospresos(AutoJVPdeZaragozade12dediciembrede1996).
b)Asimismoseconceder,unavezalmescomomnimo,unacomunicacinconfamiliaresyallegados
duranteunespaciodetiempodeunaatreshoras(art.45.5RP).Elsignificadodeltrmino"allegados"para
poderaccederaestascomunicacionesnopuedenentendersetalesenlostrminostanestrictoscomolohace
laadministracinpenitenciaria.Losallegadosnopuedenserlolosqueequivalganacariodelospadreso
hermanos,olosvinculadossentimentalmentealosinternosenformasimilaralmatrimonioolafiliacinu
otroparentescoporafinidad.Loquespuedelaadministracinesfijarunsistemadeprioridadesenquelos
allegadoscedandichaprioridadalosparientes,sobretodosilosmediosparalasvisitassonlimitados(Auto
AP Madrid 1101/98 de 2 de octubre de 1988). Allegados no pueden ser todos los amigos, sino los
especialmentecercanos,msansipensamosquelaleynohabladeallegados,sinodeallegadosntimosyes
evidentequeelReglamentoserefiereastos,pueselart.45RPdesarrolla,almenosenparte,elart.53
LOGPqueserefierealosallegadosntimosestoesalosinmediatamenteprximos.Laproximidadntimano
esposibleconmuchaspersonas,peroentodocasolecorrespondealpresodecidirquienespertenecenaese
reducidocrculoalquepuedenaccederpersonasnuevasydelquepuedensalirotras.Yesadecisinnopuede
censurarlanadiepuesespropiadelmbitodesentimientos,pasiones,impulsosyaficionesdecadapersona.
Loquespuedepedirsedeunapersonaesquehagacreblessusmanifestacionesyqueporlotantopresente
unalistadeallegadosntimosrazonablementereducida(Autos553/00y640/00APMadrid5de27deabril
de2000y19demayode2000y25deoctubrede2000).Elsentidodeasimilarallegadoaamigo(ynoa
familiar)semanifiestaunanumerosajurisprudencia(AutoAP2Castellnde6.2.y6.6.2001);enotras,se
considera allegado cuando previamente haya comunicado oralmente con el interno en alguna ocasin
previa(AutoAP2Guipzcoade29.12.2001).Algunasresolucionesjudicialesvalorantambinlascartas
enviadas y recibidas (Auto AP Cdiz, de 5.7.2001) Por ello, en estos casos, en el recurso al Juez de
VigilanciaPenitenciariahayquesealarlasvecesconlasquesehacomunicadooral,telefnicayporcarta
conlapersonaconlaquesepretendelacomunicacinespecial.Encasodequelapersonapresaquiera
cambiarlacomunicacinconelcnyuge,dentimaafamiliar,esposiblehacerloaunque,enprincipiolos
centrospenitenciariosseoponen.Enestecaso,setienequehacerunrecursodequejasealandoqueel
cnyugetienelaconsideracindefamiliaryqueesperfectamenteposiblequeunreclusosecomuniquecon
sucnyugesinnecesidaddemantenerrelacionesdecarcterntimo(AutodeAPZaragozade28.5.2001).
c)Lascomunicacionesdeconvivenciasepuedenconcederalaspersonaspresasparaquesecomuniquencon
sucnyugeopersonaligadaporsemejanterelacindeafectividadehijosmenoresdecatorcediezaos.La
duracinmximaserdeseishoras,mnimadecuatrohorassegnlaI24/96).LosJuecesdeVigilanciahan
establecidoensusreuninde2003quesealamximaposible(criterio30).
Seplanteaenocasioneslanegacindeestascomunicacionesporlanoexistenciadehijos.Aesterespecto,
hayquesealarqueesextensibleaquienesacreditenconlosinternosunarelacindeconvivencia,con
independenciaquesetengaonohijos;criteriointerpretativoextensivoeintegradorquesedesprendedela
propia lectura del precepto invocado y de la preposicin e, que divide los dos bloques de personas
autorizadasacomunicar,preposicinquenovinculaalprimergrupo(AutoJVPdeAndalucanm.1de28
deoctubrede1996).Laadministracinpenitenciariasueledenegarestascomunicacionesporconsiderarque
entodocasoesnecesarialapresenciaenlacrceldeloshijosmenoresde10aos.Estainterpretacines
incorrecta."Lascomunicacionesdeconvivenciatienenporobjetofacilitarstaenelordenfamiliar,ysteno
puedeserperturbadoporlaadministracin.Debenserlospropioscnyugesoconviventesenconsideracina
smismosyalosderechosydeberesinherentesalapatriapotestadquienesdecidanlaformamsidneade
esasvisitasdeconvivenciaylosqueparticipanenlamisma.Cualquierintromisindelaadministracin
penitenciariaenesteterrenoqueafectaarelacionesyobligacionespersonalsimasquenodesaparecencon
laprisincarecedeapoyojurdico.Ymenossipretendehacerseentrminosgeneralesdadalariquezade
situacionesdelavida:vgr.Aunodeloshijosdediezaosselehaocultadolacondicindepresodelpadre
pordecisindesteydelamadre;o,trasconcederselavisita,enfermaunodelosvarioshijosmenoresdel
preso; o el interno tiene hijos menores de diez aos con su cnyuge y con otra persona con quien ha
convivido.Seraabsurdodenegarlacomunicacindeconvivenciaenelprimercaso,yobligaracelebrarla

contodosloshijosdelasunionesysuspluralesascendienteseneltercero.Laadministracindebelimitarse
aponerlosmediosparafacilitartalesvisitasyaestablecersuduracinconarregloalasposibilidadesde
cadacentro.Elrestoesunainmisinintolerableenloqueeselcontenidodelapatriapotestadoenlas
relacionesconyugalesodesimilarafectividad"(AutosAPMadrid580/99de26deenerode1999y1478/98
de16dediciembre).Dichoconotraspalabrasporquenoacudaelhijomenorde10aosnopuedeexcluirseal
internoelderechoaunacomunicacinestablecidaparareforzarlosvnculosconlafamilia(AutoAPLa
Riojade11.1.2001;AP5Madridde12.1.2001,AutoJVPValladolidde9.02.99).
La I 24/96 seala que se celebrar una cada tres meses, como mnimo. Pero estas comunicaciones de
convivencia se celebrarn tambin una vez al mes aunque el art. 45.6 RP no diga nada acerca de la
frecuencia;.Elargumentoesclaro.UnodelosobjetivosdelReglamentoPenitenciarioeslaaperturadelas
prisionesalasociedadparaque,entreotrosfines,sepotencienlosvnculosentrelospresosysusfamilias,lo
quesepretendeconseguirmediantepermisos,comunicacionesespecialesyotrosmedios.Hayqueteneren
cuentaquelascomunicacionesdeconvivenciafavorecenelcontactotantoconelcnyugeoconviventecomo
conloshijosmenoresde10aos,personastodasellasqueintegranelncleofamiliarmsdirectoyprximo
delpresoyconquieneslarelacindebeserlamsfrecuente,afindeevitarladesconexindeaqulcon
quienformapartedesucrculomscercano,destacandodeformaespecialaloshijosdecortaedad,porlo
quenoresultalgicoqueenestoscasosselimitaranlasvisitasdeestetipodeunaaltrimestre(Auto539/00
AP5Madridde28deabrilde2000).
Comoconclusinsepuededecirquesepuedencompatibilizartodasestascomunicaciones,puesobedecena
diferentesfinalidades:lasntimasarazonessexuales;ladelosfamiliaresoallegados,amantenerloslazos
conpersonasvinculadasporrazonesdeparentescooamistad;ylasdeconvivencia,aconservaryreforzarlas
relacionesconyugalesopaternofiliales,oambas(AutoAP2Madridde30.1.2001,AutoAPCiudadRealde
22.12.99).
Todasestascomunicacionesdebensersolicitadasporlapersonapresaatravsdeunainstanciadirigidaal
directordelacrcel.Tambintienenderechoaestascomunicacioneslospresosclasificadosenprimergrado
oart.10LOGP,encasodedenegacinhayquerecurriralJuzgadodeVigilancia(modelonmero42.b.).
Estascomunicacionesnopuedendenegarseporqueenelcentropenitenciarionoexistanlocalesparaello,
todavezquelascomunicacionesdelosinternossonautnticosderechosqueseenmarcandentrodelpropio
tratamientoyquesirvenparaquemantenganloslazosfamiliaresposibilitandolareinsercinsocial(AutoAP
1CiudadRealde5.12.2001)
LamayoradelosJuecesdeVigilanciaexigenqueconcurranalacomunicacinloshijosmenoresde10
aos,peroencontraexistenotrapartedeJuecesquemantienenlosargumentosexpuestosenlosprrafos
anteriores(Criterio29reuninJVP2003)

26. Se puede someter a un cacheo con desnudo integral a los visitantes en


las comunicaciones especiales?
S.Legalmenteseestableceestaposibilidadcuandoexistanrazonesindividualesycontrastadasquehagan
pensarqueseocultaenelcuerpoalgnobjetopeligrosoosustanciasusceptibledecausardaoalasaludo
integridadfsicadelaspersonasodealterarlaseguridadoconvivenciadelacrcel(arts14.6y68RP).No
obstante,elvisitantepuedenegarse,encuyocasolacomunicacinnosellevaracabo.
AlgunosJuecesdeVigilancia(AutoJVPdeZaragozade6defebrerode1991)hanresueltoqueelcacheono
podr exceder del examen de prendas superfluas y de la aplicacin a la propia persona de los medios
mecnicosdedeteccin.Y,entodocaso,handeexistirindiciosdequeportaobjetossusceptiblesdecausar
daoalasalud,conintegridadfsica...alterarseguridad;puesdelocontrarioelcacheonoesajustadoa
derecho(vid.AutoJVPdelPuertodeSta.Marade13defebrerode1997,enelqueseintentrealizarel
cacheoporlaexistenciadeindiciosdequeelvisitantellevabatarjetasfalsificadasparaeleconomato.El
visitanteseneg,yelJuezestimquelaspresuntastarjetasnoponanenpeligrolaseguridad,nilavida,y
por tanto resolvi declarando no ajustada a derecho el cacheo y orden que se volviese a realizar la
comunicacin).
NoobstantelaposibilidaddecacheocondesnudointegralprevistaenelReglamentosuponeunavulneracin
al derecho a la dignidad y a la intimidad de las personas. No es suficiente con que existan razones

individuales y contrastadas para desnudar y cachear a un ciudadano libre y mucho menos que, con la
autorizacin del jefe de servicios, sea posible la prctica del cacheo. En todo caso, debera haberse
establecidolanecesidadderesolucinmotivadaenlaqueconstasenlasrazonesporlasquesecreequeel
visitantellevasustanciasprohibidasdentrodesucuerpo.Adems,laautorizacindeberaserconcedidapor
elJuezdeVigilancia.
Habrqueexigirlasresponsabilidadespenalesoadministrativasenquepudiesenincurrirlosfuncionarios
queordenanuncacheoalvisitantecuandostefueseinfructuosoyhayapodidoexistirabusodepodero
arbitrariedad.
ElDefensordelPueblohaefectuadodosrecomendacionesPenitenciariasyalaDireccinGeneraldela
Policaenrelacinalaprcticadecacheosenlasvisitasainternosdecentrospenitenciarios,antelanoticia
dequeestasvisitaspudierantratardeintroducirestupefacientesenelinteriordedichoscentros.
Aesterespectosehatomadoenconsideracinqueladetencinycacheoavisitantesacentrospenitenciarios
slo debe realizarse una vez examinada con detenimiento la informacin facilitada por las autoridades
penitenciarias,ytrashabercontrastadopolicialmentelaexistenciaderazonesfundadasquejustifiquenla
adopcindelamedida.Laautoridadpolicialnopuedelimitarsearecibirlainformacinsobralaposible
introduccindeestupefacientesenprisinyprocederaladetencinyposteriorcacheo.Esnecesarioque
procedaaexaminardetenidamentelainformacinqueselefacilitadesdeelcentropenitenciario,afinde
valorarlaexistenciaderazonescontrastadasquejustifiquenlaadopcindedichamedida(Recomendaciones
realizadasporelDefensordelPuebloalaDireccinGeneraldeInstitucionesPenitenciariasdurante1998;
BoletnOficialdelasCortesGeneralesde21dejuniode1997)..

27. Qu ocurre si sancionan a la persona que tiene que comunicar?


Laspersonasquecumplansancionesdeaislamientoenceldaodefindesemananopodrnhacerusodelas
comunicaciones reguladas en los puntos anteriores. A tal fin el director de la crcel procurar que el
cumplimientodelassancionesnocoincidaconlafechaautorizadaparalacelebracindelascomunicaciones
anteriores,exceptocuandosetratedesancionesdeinmediatocumplimientooaplicacindeaislamiento
provisional(art.72RP).Sillegaraacoincidireneltiempolasancinylacomunicacinysedemorarasta
hastadespusdelcumplimiento,habraqueautorizaralsancionadounacomunicacintelefnicaconelfin
deavisaralafamilia.Sinosepuedeponerencontactoconlafamiliaparasuspenderlacomunicacin,ysise
desplaza sta, se le puede autorizar a una comunicacin oral de veinte minutos, procedindose, previa
peticindelinterno,asealarunanuevafecha,delacomunicacinsuspendida(I24/96).

28. Pueden comunicar oralmente o vis a vis personas presas de distintas


prisiones o de la misma?
S, es un derecho, y no como argumentan algunos directores de prisiones que es una gracia o un
beneficioquepuedenootorgarsealossancionados(AutoAP3Oviedode24dejuniode1996).La
condicindepresosdeambosnoesobstculolegalnireglamentario.Cabenobstculosderivadosdela
separacinfsicadeloscnyugesoparejas,peroentalcasoeldeberdelaadministracinesnoacentuarlos
conseparacionesdelargadistancia.Tampocopuedelaadministracininvocarcompetenciasexclusivasen
materiadetrasladospuestambinlosjuecespuedenacordardirectamentelostrasladosyconduccionesej.
Para asistir a juicio o por va indirecta ej.mediante cambio de grado que origine el paso a otro
establecimientosinquelaadministracindebahacerotracosaqueejecutarloacordadojudicialmente.Sila
leynodistingueacercadelascomunicacionesparasituacionesdedobleprisindeambosconviventes,el
intrpretedelanormatampocopuededistinguir(AutoAPMadrid571/99de22deenerode1999).
Estetipodecomunicacionessuelefuncionarigualquesisetrataradecomunicacionesconelexterior.Hande
serautorizadas,yencasodecomunicacionesespecialesentreespososocompaerossentimentales,hade
acreditarsetalcircunstanciay,adems,contarconlaautorizacindelaJuntadeRgimenydelaDireccin
General de Instituciones Penitenciarias. Si se encuentran en prisiones diferentes, una vez aprobada la
comunicacin,sedebeprocederaltrasladodeunodeellos.
La comunicacin entre personas presas es una cuestin que, si bien excepcionalmente puede quedar

delimitada, no puede ser prohibida, toda vez que a nadie se permite entrar en esferas de intimidad y
afectividadquelosinternos,comocualquierotrociudadano,notienenquecompartirconnadiemsquecon
aquellaspersonasqueelijan.Demaneraqueelnicoelementoquesedebecontrolareslavoluntariedaddela
comunicacinporambossolicitantes,evitandopresionesoimposicionesdeunouotro.
Esindiferentequelasparejastenganonociertaestabilidad,oqueseconociesenconanterioridadalaentrada
enprisin,oquedebaprolongarsemsalldeloquelosimplicadosdeseen(AutoJVPdeLaCoruade12
demayode1993).
Nosepuedeargumentarparaladenegacindelascomunicacionesentrepresosquenoexisteunaregulacin
concreta,esdecir,quecarecendesoportelegalparasuconcesin.Estascomunicacionesintercarcelarias,si
bien no estn especficamente previstas en las normas penitenciarias, s lo estn las especiales art.51
LOGP.Enstashayqueentenderincluidasaqullas.Parallegaraestaconclusinhayqueacudiralos
mtodos interpretativos de las normas teleolgico, sistemtico y gramatical admitidos por la doctrina
penal.Aesterespectohayquesealarqueeltrminocomunicacinsignifica,segneldiccionariodela
RealAcademiadelalengua,transmisindesealesentreunemisoryunreceptor.Deloquesededucequela
existenciadecomunicacinesindependientedelascualidadespersonalesdelaspartesquesecomuniquen,y
delasituacinfsicaenqueseencuentren.
Aslascosas,elart.51LOGPautorizaacomunicarperidicamentedeformaoralyescrita,ensupropia
lengua,consusfamiliaresyamigos...Porello,enunainterpretacingramaticaldelostrminosdeeste
artculo,podemosincluirlascomunicacionesentrepresosancuandoestnendistintasprisiones.Adems
hayqueinvocarenestemomentoelprincipioUbilexnotdistinguit,necnosdistingueredebemus(dondela
leynodistingue,elaplicadordelaleytampocodebehacerlo).Queremosdecirquesiellegisladornoha
prohibidolegalmentelascomunicacionesentrepresos,quiennopuedehacerloeselaplicadordelaley.
Por otra parte, la interpretacin teleolgica ampara nuestra afirmacin dado que la finalidad de la
comunicacineselmantenimientodeloslazosdeamistadofamiliares,ynocabeningunadudaquesiuna
personapresatieneamigosyfamiliaresenprisin,hayquefacilitarelmantenimientodelosvnculos.Delo
contrario, existira una discriminacinno razonable entre los presos cuyos allegados estuvieran libres y
aquellosquelostuvieranenlacrcel;y,adems,estaransufriendounplusdepenosidadalequiparrselesa
estosefectos,sinfundamentoalguno,alospresossometidosalart.10LOGP.Enconsecuencia,nosepuede
admitirestadiscriminacinqueseencuentraprohibidaenelart.3LOGPqueporcircunstancias,ajenalauna
(laprisindelallegado),ygeogrficalaotra(estanciaencrcelesdistintas),hechosquenodependendesu
voluntad,seveanprivadosdeunderechodecarctergeneralolimitadosporlascircunstanciasnilegalni
reglamentariamente(AutoJVPnm.3deMadridde1demarzode1994).
Si se denegase la autorizacin de la comunicacin debera hacerse mediante resolucin MOTIVADA
SUFICIENTEMENTE,loquesuponequesejustifiqueracionalylgicamentelasrazonesporlasquela
comunicacinponeenpeligrolaseguridadoelordendelacrcel,oeltratamientodecualquieradelosdos
presos(vid.AutoJVPMelillade15deabrilde1997).Dehecho,existenresolucionesenlasqueapresos
clasificadosenprimergradolacrcelleshanegadolacomunicacinentreellos,yelJuezdeVigilanciano
ha considerado suficiente las alegaciones hechas por la administracin tratamiento, peligrosidad e
inadaptacin,habercomunicadoconotrapersonaconcarcterntimoyselashaconcedido(vid.Auto
JVPdeTenerifede14demarzode1994).
Estascomunicacionesintermodulares,encuantoalafrecuenciaynmerotienenelmismorgimendel
generaldelascomunicacionesdelart.42RP.Noobstante,segnsealaelapartado5delaInstruccin
24/1996delaD.G.I.P.altratarsobrelascomunicacionesentreinternosdelmismocentropenitenciario,todas
lascomunicacionesquesecelebrenentresreclusosdelmismocentropenitenciarioperoqueseencuentren
endiferentesmdulosserntenidasencuentaparaelcmputototaldelasmismas,exceptolasordinariasque
nosecontabilizarnparadichocmputo.Porellounapersonapuedetenercomunicacionesoralesdurantela
semanaconotraspersonasdedistintomduloyesamismasemanatenercomunicacionesoralesconun
familiar(AutoAPPalenciade29.11.2001).Esms,cadaunodelaspersonaspresastienenderechoasus
propiascomunicaciones,porello,unacomunicacinnosepuedenimputaralosdos,sinoaunodeellos,
pueselotrotendrderechoaotradistinta(AutoAPLaRiojade17.4.2002)
Estas comunicaciones pueden ser intervenidas. En este caso, la intervencin deber realizarse mediante
resolucinmotivadadeldirectordelacrcel,cuandoasujuicioexistanlasrazoneslegales(orden,seguridad
ointersdeltratamiento)quehaganaconsejablelaadopcindedichamedida,queentodocasodeberser
puestaenconocimientodelJuezdeVigilanciayguardartodoslosrequisitosqueyahansidoexpuestosalo

largodeestecaptulo.LabaselegalparaestaconclusintienesurazndeserenlapropiaLeyOrgnica
GeneralPenitenciaria,queenvirtuddelart.9.3C.E.quegarantizalajerarquanormativa,debeprevalecer
sobrelanormativadelReglamento.Asimismo,estecontrolesnecesarioparagarantizarmsefectivamenteel
derechoalsecretodelascomunicacionespostalesrecogidoenelart.18.3delaConstitucin(vid.AutoJVP
deSoriade12deagostode1992).

29. Se puede comunicar con sacerdotes, profesionales, mdicos ajenos a


la institucin penitenciaria?
S,perodebersersolicitadaporlapersonapresaaldirectordelaprisin.Encasodequesedenieguehay
quehacerunrecursoalJuezdeVigilanciaexponiendolasrazonesparalavisita.Estacomunicacinesmuy
importanteparapersonasqueestnbajoseguimientomdicoopsicolgicoconprofesionalesdeterminados.
Ahorabien,lajurisprudenciaentiendequenoesunderechoilimitado,demaneraquesolamentepueden
autorizarse cuando los medios a disposicin de la administracin penitenciaria sean ineficaces para
garantizarlaseguridaddelosmdicosocuandoexistanmotivosacreditativosdeunabusoenelejerciciode
derecho (por innecesariedad de la asistencia mdica o exceso en la reclamacin de la misma, por la
frecuenciaonmerodeprofesionales)(AutoAP5Madridde26.10.2001).

30. Se puede comunicar con amigos?


S,segnloprevistoenelart.51.1LOGP.Encasodequesedeniegueunacomunicacinconunamigoes
necesarioqueelacuerdodedenegacindelacomunicacinseencuentreMOTIVADO,yseexpresenenel
mismolasrazonesporlasqueesacomunicacinpuedeafectaralaseguridad,alintersdeltratamientoyal
ordendelacrcel(vid.EntreotrosAutoJVPdeMelillade28dejuniode1996).Deellosededucequeel
directordelacrceldebeautorizarsiemprelasmencionadascomunicacionesamenosqueconcurraalguna
delastrescausasanteriormentereseadas,loquesedebermotivaryprobarencadacaso(AutoJVPde
Sevillade10deoctubrede1989,AutodelJVPBadajozde20demarzode1990,AutoAPdeOviedode19
denoviembrede1990).
Noesmotivodeprohibicinqueelcomunicanteseaunexpreso(AutoJVPCastillaLennm.1de21de
octubrede1996),puesestacircunstanciapermanecerinalterableparasiempre,conloquevendrexcluidala
temporalidaddelamedidasegnsevieneexigiendoparalaintervencindelascomunicaciones(AutoAP
Madrid1492/98de18de diciembre de 1998). Tampoco se puede denegar unacomunicacin porquese
desconozcaelorigendelaamistad,quebienpudoseratravsdeunarevistaoperidico(AutoAPMadrid,
5,de20deabrilde2001).
SinosemotivalaresolucinhayquerealizarunrecursodequejaalJuezdeVigilanciapenitenciaria.

31. Las personas presas pueden recibir paquetes del exterior?


S,perodebernserentregadospersonalmenteenladependenciaquecadacrceltienehabilitadaalefecto;
estprohibidalarecepcindepaquetesporcorreooagencia(I24/96).Sepodrrecibirdospaquetesalmes,
salvoenlosdepartamentosdergimencerrado,queserdeunoalmes.Enestoslmitesnosecomputarnni
librosnipublicaciones,nitampocoropa.Elpesodecadapaquetenoexcederdecincokilos(art.50RP).
Nosonautorizadoslosartculosuobjetosquepuedensuponerunpeligroparalaseguridad,alaordenada
convivencia o la salud, las drogas txicas, estupefacientes y sustancias psicotrpicas salvo prescripcin
facultativa, las que contengan alcohol y los productos alimenticios (art. 51.1 RP). Cabe, por tanto, la
posibilidaddequedesdeelexteriorentreguenmetadonaaunapersonaquehayaingresadoenprisinyque
estuviesesometidaaunprogramadeestetipoenlacalle.
ParaqueelCentroPenitenciariopuedadenegarlaentradadeunpaquetepormotivosdeseguridaddebe
justificar que el contenido del mismo pone en peligro la mencionada seguridad. De manera que, a las
personasprivadasdelibertadnoselespuederestringiranmslaesferavital,salvoquepongaseponganen
peligrovalorestanimportantescomolaseguridadinteriordelacrcel(Auto2/95APNavarra3de31de

enerode1995).
Enelcasodequeloquesemetanseansbanas,algunoscentrospenitenciariosponendificultadesydeniegan
estaposibilidadargumentandoquelaadministracinyalesdasbanasyqueporellonoesimprescindible
ropapropiadecama;ademssesueleargumentarquesitodoslospresoslopidieran,lasrequisasyregistros
enlasceldassedificultaranenexceso.Sinembargo,pensamosquesisepuedetenerropadecamapropiae
introducirlaporpaquetes.PrimeroporquelaLOGPreconoceelderechodevestirropapropia;ensegundo
lugarporquetambinlaadministracintienelaobligacindeproporcionaralimentacincontroladaporel
mdico, convenientemente preparada y no por ello se prohbe que los reclusos consuman productos
adquiridoseneleconomato.Porltimosealarquetenerunoodosjuegosdesbanasnoincrementael
volumendelosenseressusceptiblesdeestarenlasceldas.Msdudosoesqueseadmitancortinasycolchas
(AutoAPMadrid5de22.5.2001)

32. Cunto tiempo tiene la administracin penitenciaria para contestar una


peticin de comunicacin con amigos, allegados o familia?
Podranser15das.Enocasioneslaadministracintardamsdeunmesencontestar.Enestecaso,es
convenientehacerunescritodequejaalJuzgadodeVigilanciaPenitenciaria.NiellaLeypenitenciarianiel
Reglamento penitenciario existen plazos para que el centro penitenciario conteste las peticiones de los
ciudadanospresosenreclamacindesusderechos.Siestaspeticionespudieranpendientesdecontestacin
deformaindefinida,supondralanegacindesusderechos.Elsilenciodelaadministracinpenitenciaria
suponeunalimitacindederechosreconocidos.Comonoexisteplazolegalhayquehacerunainterpretacin
delordenamientojurdico.Enprimerlugar,elReglamentopenitenciarioanterior,yaderogado,establecaun
plazo de quince das para la contestacin (art. 134 RP 1981); en segundo lugar, toda inactividad de la
administracin penitenciaria supone la restriccin de un derecho fundamental. En tercer lugar, la
administracinengeneral,tambinlapenitenciaria,estobligadaaresolver,conarregloalplazoqueencada
procedimiento corresponda. En este sentido, es conveniente integrar el plazo de 15 das del anterior
Reglamento penitenciario, con los principios jurdicos constitucionales (seguridad jurdica, legalidad y
proporcionalidad)ademsdetenerencuentalodispuestoenelart.117yss.DelaLPACensedederecurso
dereposicincontraresolucionesexpresasopresuntas.Porello,unplazocorrectodecontestacinserade
15das(AutoAPLARiojade20.12.2000).

33.- Qu requisitos deben existir en las resoluciones judiciales para la


denegacin de las comunicaciones a las que nos hemos referido se
denieguen?
Seexigequeladenegacindelascomunicacionessefundamenteymotive.NoesaceptablequelosJuecesde
Vigilanciaestablezcanlosmotivosdeseguridadgenricosqueargumentenloscentrospenitenciarios.Esta
formalidaddedarporreproducidoslasrazonesdelaadministracinpenitenciariaenresolucionespropiasde
formulariosjurdicos,contradiceelderechoalatutelajudicialefectivaquecorrespondealJuezdeVigilancia
comogarantedelosprivadosdelibertad.Aestasinsuficienciasformalescabeaadirquelajurisprudencia
delTribunalConstitucionalsegnlacuallosderechosyprincipiosconstitucionalesquenoestnimpedidos
porlapropiaesenciadelacondena,aconsejaquelalimitacindederechosseaobjetodeinterpretacin
restrictiva de conformidad con las exigencias derivadas del principio de prohibicin del exceso (SSTC
57/1994,2/1987,97/1995,297/1993)

34.Se

puede

solicitar una

comunicacin

con

los

representantes del

Defensor del Pueblo?


Syademsesconvenientehacerloenloscasosdemalostratosodesituacionesdeabusosporpartedela
administracinpenitenciaria.ElDefensordelPueblotienecomoprincipalfuncinladefensaytuteladelos
derechosfundamentales,ascomoelcontroldelaAdministracinPblica.Estainstitucinnotieneningn
impedimentoparaacudirauncentropenitenciario,niselepodrnintervenirlascomunicacionesdeningn
tipo.

35Qu ocurre con las visitas a los presos que se encuentren enfermos?
Puedeocurrirqueseestnenlaenfermeradelaprisinoingresadosenunhospital.Enelprimercaso,se
admitealosfamiliaresqueentrendentrodelaprisinyvisitenapiedecama,paraellosenecesitainforme
delmdicoodelJefedeserviciosmdicosenelqueconstequeelinternodebepermanecerenlaenfermera
ynopuederecibirvisitasdeotramanera(I9/2001).Enelsegundoesmscomplicadoporquequienpone
loshorariosdevisitaeslapolicadecustodiay,normalmentesolodejanunahora.Estasituacinhayque
denunciarlaaloscomitsdeticadeloshospitalespblicosascomoaljuezdevigilanciapenitenciariapara
queampleelhorario(vermodelonmero42.c).Cuandolapersonapresaestabaenlacrcelpodapasarlas
maanasylastardesenelpatio,esdecir,selefacilitabalacomunicacinconotrossereshumanos.Eneste
rgimendevidareguladonoserelacionaconningnserhumano,aexcepcindelosmdicos,porqueno
tieneningunaposibilidaddehacerlo,msalldeloscuarentaycincominutosmencionados.Segnelart.
217ReglamentoPenitenciario"lasvisitasdelosfamiliaresyallegadosalosreclusosinternadosenun
hospital extrapenitenciario se regirn por las normas de funcionamiento del centro hospitalario
correspondiente,debiendorealizarseenlascondicionesyconlasmedidasdeseguridadqueestablezcanlos
responsablesdesucustodia,quienesserninformadosporelcentropenitenciariodelgradodepeligrosidad
delenfermo".Desdeesteyotroshospitalesseentiendequelosenfermoshandetenerlaposibilidadde
accederaunrgimendevisitassuficientementeamplio,deahelhorariohabitualquelofacilita.Seentiende
queesteraputicopodercompartiruntiemposuficienteconaquellaspersonasqueaportanmsseguridad
emocional,fundamentalmentefamiliayamigos.Entiendoque,enunaInstitucinSanitaria,laspersonas
ingresadashandeserconsideradasfundamentalmentecomoenfermosynocomopresosydeahdebesurgir
lanormativaqueposibiliteelapoyoteraputicoyhumanoquetodoenfermonecesita.Segnloscriteriosde
losJuecesdeVigilanciaPenitenciaria(1994),lasvisitasdebernautorizarseatendiendoarazonesmdicasy
hospitalariasynoacriteriosdergimenpenitenciario.Porotrolado,laLeyGeneraldeSanidadreconocea
todosel"respetoasupersonalidad,dignidadhumanaeintimidadyestableceque"lasnormasdeutilizacin
delosserviciossanitariossernigualesparatodos,independientementedelacondicinenqueseaccedea
losmismos(art.10.1yart.16LGSLO14/1986de25deabril).
Asimismo,el Convenioparalaproteccindelosderechoshumanosyladignidaddelserhumanocon
respectoalasaplicacionesdelaBiologaylaMedicina(ConveniodeOviedo)delConsejodeEuropa,en
vigorennuestropasdesdeel1deenerode2000,establecedeigualmodoensuartculo1quelasPartes
delpresenteConvenioprotegernalserhumanoensudignidadysuidentidadygarantizar,atodapersona,
sindiscriminacinalguna,elrespetoasuintegridadyasusdemsderechosylibertadesfundamentalescon
respectoalasaplicacionesdelabiologaylamedicina,ensuartculo2queelintersyelbienestardelser
humanodebernprevalecersobreelintersexclusivodelasociedadolaciencia,y,porltimo,ensu
artculo3,quelasPartes,teniendoencuentalasnecesidadesdelasanidadylosrecursosdisponibles,
adoptarnlasmedidasadecuadasconelfindegarantizar,dentrodesumbitojurisdiccional,unacceso
igualitarioalosbeneficiosdeunasanidaddecalidadapropiada.
Portanto,lasnicasrazonesquepuedenexigirseparalimitarlasvisitasaestaspersonassonlasdendole
estrictamenteclnica,lasmismasqueseaplicanacualquieradelosdemsenfermosingresadoseneste
hospital.Locontrariosuponeunaclaraformadediscriminacinquevulneraclaramentelasdisposiciones
legalesantescitadasyquebrantalosprincipiosticosdenomaleficenciayjusticia.Dichadiscriminacin
estademsagravadaenestecasoporlaextremavulnerabilidaddelqueesalavezpresoyenfermo.Quese

amplelashorasdevisitade45minutosacuatrohoras,nosloesunacuestindejusticiamaterialen
relacinconelrgimendentrodeprisin(hastaelrgimenmsrepresivodeprimergradoorgimencerrado
selesautorizaaestarenelpatiodurantetreshorasconotropreso),sinoquenogeneraningnproblemade
seguridad.Estamoshablandodeun"bunker"cerrado,contodaslasmedidasdeseguridadquetieneuncentro
penitenciario.Haydospolicasquelecustodian.Yunavezqueseautorizalaentradadeunapersonaaunque
seapordiezminutos,losproblemasdeseguridaddesaparecenporquesiquiereintroduciralgninstrumento
peligroso o sustancia estupefaciente, lo puede hacer en cuanto entre a comunicar. Por otro lado, los
funcionarios de polica pueden realizar, y as lo hacen, los registros personales y de las pertenencias
correspondientes.
LaI9/2001DGIPregulaelrgimendevisitasa estas personas enfermas.El centropenitenciario
informar a las fuerzas de seguridad acerca del grado de peligrosidad del interno paciente. Los
visitantesdebernsometersealoscontrolesoportunosporpartedelasfuerzasdeseguridad.Las
visitas pueden ser de familiares como de allegados y debern ser previamente autorizadas por el
Directordelacrcelquienlocomunicaralapolicaquecustodia.Igualmentelasvisitasdebern
contarconelconsentimientoexpresodelenfermo.Ladenegacindepermisoparavisitaraunenfermo
hospitalizadosecomunicaralpacienteporescritoydeformamotivada,advirtindoleentodocasode
su derecho arecurrir lamismaante el juzgado de vigilancia correspondiente. Se entiende que la
autorizacinser valida paratodo el tiempo que dure el ingreso hospitalario de que se trate. En
generalysalvossituacionesexcepcionales,elhorariodevisitashadeserelmismoquecadacentro
hospitalariohayaestablecidoparatodoslosenfermosensusnormasdergimeninterior.Epreferible
quelasvisitastenganlugarsiempreenhorariodetardeyfinesdesemana.Amodoindicativolavisita
nodeberaserinferioralascuatrohorasdiarias.Nodeberapermitirselapresenciasimultneadedos
omsvisitantesporenfermo,pudiendonoobstanterepartirseeltiempototaldelavisitadiariaentre
mspersonas.Puedeincluso,estarunapersonadeformapermanenteconelenfermosielmdicolo
autoriza,encuyocasosernecesarialaautorizacindelDirectordelacrcel.Lasvisitasdeabogados,
procuradores,autoridadesoprofesionalesdebentenerlugartantoenhorariodemaanacomode
tarde,debiendoprimalanointerferenciaconlaactividadclnica(I9/2001DGIP)..

Captulo 8

RGIMEN DISCIPLINARIO Y RECOMPENSAS


"Dondehaydolorhayunsuelosagrado.Algndalagente
comprenderloqueestosignifica.Hastaentoncesnose
entendernadadelavida"(OscarWilde)

1. A qu hace referencia el rgimen disciplinario penitenciario?


Elrgimendisciplinariohacereferenciaalasconductasprohibidasdentrodelaprisinyalassanciones
previstasparaloscasosenqueaquellasserealicen.Seaplicaatodaslaspersonaspenadasypreventivassalvo
las que se encuentran ingresadas en centros psiquitricos (art. 188 RP), o se trate de la sancin de
aislamientoenceldaamujeresembarazadasogestanteshastaseismesesdespusdelaterminacindel
mismo,omadreslactantesconhijos(art.254.3RP),oalosenfermosmientrasnohayansidodadosdealta
(art.254.2RP).Seaplicaalasinfraccionescometidasdentrodelacrcelyalasquesecometanenlas
conduccionesosalidasautorizadas(art.231.2RP).

2. Por qu tiene importancia para la persona recluida en un Centro


Penitenciario el rgimen disciplinario?
La imposicin de sanciones y su consiguiente anotacin en el expediente penitenciario tiene graves
consecuencias para la persona recluida. Por un lado, el deterioro fsico y psquico que conlleva el
cumplimientodealgunassanciones(aislamientoencelda)y,porotro,lainfluenciadelabuenaconducta
(carecerdesancionessincancelar)enlaconcesindeposiblesbeneficiospenitenciarios,permisosdesalida,
progresionesdegrado,yenlaobtencindelalibertadcondicionalyenlaconcesindelosbeneficios
penitenciarios.Adems,nohayqueolvidarlaindudableinfluenciaqueelrgimendisciplinarioejercesobre
elordenylaconvivenciacarcelaria.

3. Cul es la relacin en la que se encuentra el ciudadano recluso respecto


del aparato sancionador de la administracin penitenciaria?
Frente al rgimen disciplinario de otros ordenamientos jurdicos, el que se desarrolla en el entorno
penitenciarioadquiereuncarcterespecialporlasituacinquetieneelpresorespectodelaadministracin
penitenciaria.Estarelacinesdenominadadesujecinespecial.Elinternamientopenitenciariocualificala
relacin administracinciudadano y la hace distinta de la que tienen el resto de los ciudadanos con la
administracin.
Larelacindesujecinespecialdeberagarantizarenmayormedidalosderechosdelosciudadanospresos
frentealaadministracinpenitenciariayno,comoocurreenlaprctica,alrevs.Laspersonaspresasestn
enunaposicindegraninferioridadfrentealrestodelosciudadanosdebidoalaespecialconfiguracindela
realidadsociolgicadelacrcelque dejaalciudadanopresoenunasituacindeabsolutavulnerabilidad
frentealpoderdelEstadomanifestado,enestecaso,enelpoderabsolutodelaautoridadpenitenciaria.Un
ciudadanopresonopuedemoversefsicamentecomoharaunciudadanoenlibertadybuscarunabogado
que le defienda en un expediente disciplinario (no existe la defensa de justicia gratuita en el proceso
sancionador),oparabuscarpruebasque demuestrensuinocencia,cuandoenlacrcelladificultadenla
obtencinyrealizacindelasmismasesgrande(inclusoparaquelaComisinDisciplinarialasadmita).De
especialimportanciaeslaabsolutadependenciadelcomportamientodelpreso,noslorespectodelrgimen,
sino tambin respecto del funcionario para poder conseguir permisos, progresiones de grado, libertad
condicionalybeneficiospenitenciarios.Estasituacinmotivaquelasumisindelciudadanoreclusoalpoder
carcelarioseaabsoluta;ycuandoelpoderesabsoluto,lavulnerabilidaddelsometidoesmayor.
Por ello, si alguna caracterstica debe tener la relacin de sujecin especial entre preso y crcel es el
reforzamiento de la posicin de la parte ms vulnerable: el preso. No slo a fin de garantizar un
procedimientoequitativo,sinotambinparapaliarlaasimetraqueposibilitaqueelpresoquedesometidoa
laarbitrariedaddeestepoderpblico.Lanicaformadehacerloesgarantizandoelrespetoescrupulosoalos
derechosreconocidosenelart.24delaConstitucin.
Porello,siestarelacindesujecinespecialtienecomofinlalimitacindelosderechosdelosreclusos,ms
bien,deberamoscomenzarlabsquedadevaslegalesparaconseguirunarelacindeequilibrioqueiguale
eltratodelospresosconelrestodelosciudadanos.Enestesentido,ladoctrinadelTribunaldeKarlsruhe,
lugardondeseacuestetrmino,ensusentenciade14demarzode1972,declarqueelconceptode
relacinespecialdesujecinsuponaunavaconstitucionalmenteinadmisibledelimitacindelosderechos
fundamentalesenelmbitopenitenciario.

LasltimassentenciasdelTribunalConstitucionalvanlimitandolaeficaciadelarelacinespecial,alentenderla
cadavezmsenunsentidoreductivocompatibleconelvalorpreferentedelosderechosfundamentales(97/1995).
MscontundenteeslaSTC192/1996de25denoviembrecuandosealaqueesclaroquelasituacindesujecin
especial del interno en un establecimiento penitenciario no puede implicar la eliminacin de sus derechos
fundamentaleseimpedirquelajusticiasedetengaenlapuertadelasprisiones(STC143/1995,de3deoctubrey
STC39/1997,de27defebrero).Porltimo,elpropioTribunalrealizaunciertoabandonodelabusodela
catalogacinderelacinespecialalreferirsealosinternos.As,ensentencia83/1997de23deabrillosustituye
porlaexpresinpeculiaridadesdelinternamientoyenlassentencias143/1997de15deseptiembrey200/1997
huyedelfcilargumentoderecurriralconocidorecordatoriodequeelinternoseencuentraenunarelacinde
especialsujecin.

4. Cules son los fines y qu principios deberan inspirar el rgimen


disciplinario?
Elrgimendisciplinariopersiguecomofinalidadesesencialeslaseguridadylaconvivenciaordenadaenla
prisin(art.41.1LOGP).
Porello,slopuedeintervenircuandoseaabsolutamenteimprescindibleparaelmantenimientodelordendentrode
lacrcel.Enestesentido,elprincipiodeintervencinmnimaadquiereunaimportanciaesencial.Elrgimen
disciplinariodebetenderaencontrarelequilibrioentreelordenyelrespetoalosderechosfundamentales.
Ahorabien,esteobjetivonopuedepasarporaltoelcontenidodelmandatoconstitucionaldelartculo25.2de
laConstitucinqueestablece elhorizonte reeducativo al que debe tenderelcumplimientodelaspenas
privativasdelibertad.Aesterespecto,cuandolaaplicacindeunasdeterminadassancionespudieseoriginar
efectoscontrariosatalesfinesreeducativos,deberaquedarensuspenso.Enconsecuencia,cuandoexistaun
equilibrioentreconcienciacolectivadeordeneintersresocializador,lassancionesdeberansersuspendidas
(principiodeoportunidad).Estaposibilidadtieneconcrecinlegalenlosartculos255y256delReglamento
quepermitenlaposibilidaddesuspenderyreducirlassancionesimpuestasatendiendoafinesdereeducacin
yreinsercinsocial.
Porltimo,hayquehacermencinalprincipiodeproporcionalidad.Esteprincipio,admitidoporelTribunal
Constitucional(STC62/1982,de15deoctubre),yreconocidoentextosinternacionales(art.8Declaracin
UniversaldelosDerechosdelHombreydelCiudadano,ascomoenelart.18delConveniodeRoma)tiene
unasnotasesenciales:imprescindibilidaddelamedida,necesidaddeconocerelgradodeperjudicialidady
daosidaddelamisma,ylaconcordanciadelaentidaddelasancinylaimportanciadelobjetivoquela
justifica1.TrasanalizarlasconductasprohibidasenelReglamentollegamosalaconclusindequeesdifcil
quedeterminadasnormaspudieranaguantaruncontrasteserioconlasexigenciasdelaimprescindibilidado
daosidad,atendiendoelfinquesediceperseguirconlalegalidaddisciplinaria(garantizarlaseguridady
conseguirunaconvivenciaordenadaart.41.1LOGP).
Laproporcionalidadsuponeunacomparacinentrelaentidaddeldaocausadoyelbienjurdicoprotegido.
Deellosurgelasancinqueseestimaadecuadaparaconseguirlarestauracindelordenlesionadoyla
prevencin. Las disfunciones en ese juicio de comparacin (castigando de manera rigurosa acciones
intrascendentesomenores)comportanunalesinodesconocimientodelmencionadoprincipio.Dehecho,
los Juzgados de Vigilancia Penitenciaria en las resoluciones de los recursos en materia de rgimen
disciplinariorebajanconsiderablementelassancionesimpuestas.
Porltimosealarlosprincipiosdelegalidad,entantoquelaspersonassolamentepodrnsersancionados
porlasconductasdescritasenelReglamento(prohibicindelaanalogaqueperjudiquealpenado),yelde
culpabilidad,entantoquesolamentesepuedesancionarsilaconductahasidodolosaoculposa.Habraque
reflexionar si es posiblelaaplicacinde las atenuantes oeximentesdelCdigopenal. Adems,como
veremos ms adelante, en el proceso sancionador en el mbito penitenciario, se tienen que observar el
derecho a la defensa, el derecho a utilizacin de los medios pertinentes de prueba y el derecho a la
presuncin de inocencia (Sentencias del Tribunal Constitucional de 18/1981, 2/1987, 297/1993,
97/1995,195/1995,39/1997,181/1999,81/2000,157/2000y27/2001).

5. Cmo se clasifican las faltas?


Las faltas se clasifican en: muy graves, graves y leves. Siguen vigentes las descritas en Reglamento
Penitenciarioderogado.

6. Cules son las infracciones muy graves?


Lasfaltasmuygravesvienentipificadasenelartculo108delReglamentoPenitenciarioaprobadoporReal
Decreto1201/1981:
a)Participarenmotines,plantesodesrdenescolectivos,oinstigaralosmismossistossehubiesen
producido.

b) Agredir, amenazar o coaccionar a cualesquiera personas dentro del Establecimiento o a las


autoridades o funcionarios judiciales o de Instituciones Penitenciarias, tanto dentro como fuera del
establecimientosielinternohubierasalidoconcausajustificadadurantesuinternamientoyaqullosse
hallarenenelejerciciodesuscargosoconocasindeellos.Estesupuestoreproducediversostipospenales
atentado contra la autoridad o funcionario pblico, o bien desacatos contra los mismos, amenazas y
coaccionessinrigorsistemticoalguno. Entodocaso,esnecesarioqueelpliegodecargosdetallelas
frasesamenazantesdirigidasalfuncionario.Delocontrario,elJuezdeVigilancianopuedevalorarenel
recursosiobjetivay/osubjetivamentelaspalabraspuedenconsiderarseconstitutivasdeamenazas(AutoJVP
CastillaLen num.3 de 18 de febrero de 2000). En referencia a las coacciones hay que acudir a su
interpretacinlegalyjurisprudencialenmateriapenal.Aesterespecto,lasautolesionesporpartedeun
internocomomtodooformadeprotesta,noconstituyelafaltadecoaccionesprevistaenelRP,puescomo
esobvio,carecendeentidadsuficienteparaobligaralosfuncionariosahacernoquenoquierenhacer,ypor
tanto,debeconsiderarsecomomedioinidneoparalacomisindelainfraccin(AutoJVPCastillaLen
num.3de1dediciembrede1999).
c)Agredirohacerobjetodecoaccingraveaotrosinternos.
d)Laresistenciaactivaygravealcumplimientodelasrdenesrecibidasdeautoridadofuncionarioen
ejerciciolegtimodesusatribuciones.Laresistenciaactivaygraveesaquellaconductaqueseoponeauna
ordenlegtimayconcretapormediodeunareaccinfsicayabiertamenteviolenta.Porelcontrario,la
resistenciapasivaomenosgrave,tipificadacomoinfraccingrave,semanifiestaatravsdeunaconducta
obstativafrentealmandatoquemuestrainclusounaspectofsico,peroentonomspasivoquelaanterior,
puesvadirigidatansloamantenersuoposicindentrodeesteplanodefensivoynopasaaserunaactitud
msabiertamentehostilsinintencindecausardaoalfuncionario.Porltimo,ladesobediencia,tipificada
comoleve,essimplementeelincumplimientodeunaorden,aunquefuerepersistente,sinqueseadviertan
talesconductasoreaccionesfsicasporpartedelinterno(AutodelJVPdeSoriade19dediciembrede
1994).
En los posibles recursos que se interpongan hay que describir los hechos y justificar el motivo de la
desobediencia.EnelAutodelJVPCastillaLennum.3de11defebrerode2000seanulaunacuerdo
sancionador porque unos reclusos se negaron a acudir al destino de limpieza antes de que les fuera
suministradaladosisdiariademetadona.Lanegativaaacudiraldestinoestabajustificadaporqueunretraso
enlaadministracindiariadeladosispuedeprovocarlaaparicindelosprimerossntomasdelsndromede
abstinencia.Sielretrasoesconsecuenciadeladescordinacindelosserviciossanitarios,oporotracausa,el
mismodebesolucionarse,peroloquenuncapuedehacerseesimponerunasancinalospresoscuandoslo
selimitaronareclamarloprocedente.
e)Intentar,facilitaroconsumarlaevasin.Solamentesepuedehablardeevasinsiseestdentrodel
establecimiento penitenciario. Pero no puede evadirse, aunque s quebrantar condena, el penado que se
encuentradisfrutandodeunasituacindelibertadcomolapropiadeunpermisoordinario/extrosdinariode
salidaynoregresaalcentropenitenciario.Desdeunainterpretacingramatical,evadirsesuponesalirdela
crcelsinautorizacinalguna,perono,enningncaso,noentrarenelCentroPenitenciarioparacontinuarel
cumplimientode la condena. El bienjurdico protegido en el delito de quebrantamiento de condena es
distintoaldelainfraccindisciplinariaporevasin.Enelquebrantamientoseprotegeelintersjurdico
poltico de cumplir las sentencias penales condenatorias. En la infraccin administrativa por evasin se
sanciona el incumplimiento de los deberes bsicos que ste asume cuando es internado en una crcel:
permanecerenelmismoadisposicindelaautoridadjudicialquehubieredecretadosuinternamientoopara
cumplirlascondenasimpuestashastaelmomentodesuliberacin(art.4LOGP).Porello,elnoregresoala
crceltraseldisfrutedeunpermisodesalidaautorizada,apartededarlugaralarevocacindelpermiso,
conformealart.157.2RP,tendrconsecuenciaspenales(posibledelitodequebrantamientodecondena)y
penitenciariosenordenalaclasificacin,disfrutedeotrospermisos,peronoenelordendisciplinario(Auto
JVPcastillaLennum.3de26deoctubrede1999.
Hayresolucionesquesealanquelaevasinnopuedeproducirsecuandounapersonanovuelvealacrcel
despus de un permiso, pues la fuga presupone un mbito de clausura, un mdulo de control e
internamientoacuyaquiebrasetiendemediantelaelusindeunaactividaddevigilancia,lasuperacinde
instalacionesdecierreoelrebasamientodebarrerasfsicasoarquitectnicas(AutodelJVPdeMurciade7
dejuniode1991).
f) Inutilizar deliberadamente las dependencias, materiales o efectos del establecimiento o las
pertenenciasdeotraspersonascausandodaosdeelevadacuanta.Elproblemaesdelimitarcuandonos
encontramosantedaosdeelevadaoescasacuanta,paraloquesedeberacudiralaregulacinpenal.
g)Lasustraccindematerialesoefectosdelestablecimientoodelaspertenenciasaotraspersonas.
h) La divulgacin de noticias o datos falsos con la intencin de menoscabar la seguridad del
establecimiento. Bajo este supuesto, en ocasiones, se sanciona el hecho de denunciar a los medios de
comunicacinoasociacionesdeapoyoapresosdeterminadosacontecimientosquehanocurridodentrodela
crcel.
Esevidentequeenestoscasos,lasancindebeserdeclaradanulaenbasealderechofundamentalala
libertaddeexpresin;yentodocasodeberaquedartotalmenteacreditadalarelacincausalexistenteentrela

divulgacin de noticias y la puesta en peligro de la seguridad de la crcel. Adems, claro est, la


administracinpenitenciariadebeprobarlafalsedaddelasnoticias.
i)Atentarcontraladecenciapblicaconactosdegraveescndaloytrascendencia.Estafaltaconstituye
unatotalyabsolutadesvinculacin,noslodelostanrepetidosprincipiosquedebeninspirarelrgimen
disciplinario,sinounalejamientoconsiderabledelarealidadsocial.

7. Cules son las faltas graves?


Lasfaltasgravesvienentipificadasenelartculo109delReglamentoPenitenciario(RD1201/1981):
a) Calumniar, insultar y faltar gravemente el respeto y consideracin debidos a las autoridades,
funcionariosypersonasdelapartadob)delartculoanterior,enlascircunstanciasylugaresqueenelmismo
se expresan. Las expresiones vertidas por la persona presa en defensa propia en el curso de un
procedimientosancionador(ej.elfuncionariomegolpeprimero)quedaranamparadasenelderechode
defensadelart.24delaConstitucin,aunquenofueranexactas,noconstituyensancinalguna(Autodel
JVPdeSoriade7dediciembrede1994).Igualmente,losposiblesinsultosaparecidosenlacorrespondencia
intervenidanosonmotivodesancinpueslascartasnovandirigidasalconocimientodeaquellosque,silas
conocen,esexclusivamentepormotivosdeseguridad(AutodelJVPnm.1deMadridde24deoctubrede
1989).
b) Desobedecer las rdenes recibidas de autoridades o funcionarios en el ejercicio legtimo de sus
atribucionesoresistirsepasivamenteacumplirlas.Esnecesarioverificarlalegitimidaddelaordenparaque
puedaexistirdesobediencia;stanoeslegtima,porejemplo,enlaexigenciadeprocederauncacheocon
desnudo integral sin motivoalguno (Auto del JVPde Zaragoza de 11 de septiembre de 1990), o en la
realizacindecacheosconradiografassinautorizacinjudicial(AutodelJVPdeZaragozade28deenero
de1992).
c)Instigaraotrosreclusosamotines,plantesodesrdenescolectivos,sinconseguirsersecundadospor
stos.
d)Insultaraotrosreclusosomaltratarlesdeobra.Estamodalidaddeinfraccinsefundamentaendos
tiposdistintosdeconductaspenales:unataquealhonoryunataquealaintegridadpersonal.Enocasiones,la
irrelevanciadelsucesooelusodeexpresionesnormalesenellxicohabitualentrelajuventuddelmediodel
queprocedenlaspersonaspresasconviertenenatpicasciertasexpresiones(AutodelJVPdeMadridnm.1
de13deoctubrede1991).
e) Inutilizar deliberadamente las dependencias, materiales o efectos del establecimiento o las
pertenenciasdeotraspersonascausandodaosdeescasacuanta,ascomocausarenlosmismosbienes
daosgravespornegligenciatemeraria.
f)Introducir,hacersaliroposeerenelestablecimientoobjetosquesehallarenprohibidosporlasnormas
dergimeninterior.Enestecasoysinosequiereprovocarunarealinseguridadjurdica,deberacreditarse
elconocimientodelinternodelcatlogodeobjetosprohibidos(AutodelJVPdeZaragozade2demarzode
1992).Latenenciadeunacuchilladeafeitarnopuedeconsiderarseobjetoprohibidoyportantonopuedeser
sancionadoalserunobjetodeaseopersonalquesefacilitaalinternoporpartedelCentropenitenciarioyen
consecuencianosuponeunpeligroparalaseguridadolaordenadaconvivenciadelacrcel(AutoJVP
CastillaLennum.3de24dediciembrede1999).Entodocaso,parapodersancionarcualquierobjeto
prohibidoencontradoenunacelda,lacrceldebeprobarqueperteneceaquienlahabitaynoaotrapersona
quelopudoesconderallpreviamente(AutoJVPCastillaLennum.3de18deoctubrede1999).
g) Organizar o participar en juegos de suerte, envite o azar, que no se hallaren permitidos en el
establecimiento.
h)Ladivulgacindenoticiasodatosfalsosconlaintencindemenoscabarlabuenamarcharegimental
delestablecimiento.
i) La embriaguez producida por el abuso de bebidas alcohlicas autorizadas que cause grave
perturbacinenelEstablecimientooporaquellasquesehayanconseguidooelaboradodeformaclandestina,
ascomoelusodedrogastxicas,sustanciaspsicotrpicasoestupefacientes,salvoprescripcinfacultativa.
LosjuecesdeVigilanciapenitenciariaenlasconclusionesdelareunindeenero2003hanestablecidola
necesidad de incorporar. o integracin del interno en alguno de los programas de tratamiento o
deshabituacindedrogadictos(Criterio49).

8. Cules son las infracciones leves?


Lasinfraccioneslevesvienendescritasenelart.110RPde1981:
a)Faltarlevementealaconsideracindebidaalasautoridades,funcionariosypersonasdelapartadob)
delartculo108,enlascircunstanciasylugaresqueenelmismoseexpresan.
b) La desobediencia de las rdenes recibidas de los funcionarios de Instituciones Penitenciarias en
ejercicio legtimo de sus atribuciones que no causen alteracin de la vida regimental y de la ordenada
convivencia.
No todo incumplimiento de rdenes debe ser sancionado automticamente, es exigible una mnima

proporcinentrelagravedaddelasancinprevistayloshechosacaecidos.As,porejemplo,hablarconotros
compaerosdereclusin(AutodelJVPdeCastillaLennm.1de9dediciembrede1991).
c)Formularreclamacionessinhacerusodeloscaucesestablecidosreglamentariamente.Seimpidecon
estanormaquelospresospuedanreivindicarporconductosnooficialeslaviolacindesusderechos.As,de
lacrcelnopuedesalirningunainformacinquenosealaoficial.Deestaformaseanulatodacapacidad
crtica. Y los internos que mantengan ciertos niveles de denuncia vern suspendidos sus permisos, sus
progresionesengrado,sufrirntrasladosdeprisinenprisin.
d)Hacerusoabusivoyperjudicialdeobjetosnoprohibidosporlasnormasdergimeninterior.Este
preceptollevadohastasusltimasconsecuenciaspuedellevarnoshastasituacionesridculas.Unavezquese
encuentrareguladalainfraccinpordaos,resultapeligrosodesdeelpuntodevistadelaseguridadjurdica,
elmantenimientodeesteabsurdoprecepto.
e) Causar daos graves en las dependencias, materiales o efectos del establecimiento o en las
pertenenciasdeotraspersonasporfaltadediligenciaocuidado.Seintroduceenestepreceptountrmino
genrico:cuidado.Elloslopuedeocasionarresponsabilidadesobjetivas.Denuevosevuelveaquebrarel
artculo41delaLOGP.
f) Cualquier otra accin uomisinque implique incumplimiento de los deberes y obligaciones del
interno,produzcaalteracinenlavidaregimentalyenlaordenadaconvivenciaynoestcomprendidaenlos
supuestosdelosartculos108y109,nienlosapartadosanterioresdeesteartculo.Realmentesedebe
producirunaverdaderaalteracindelavidaregimentalparaqueloshechospuedansersancionables.Nolo
es,porejemplo,comunicarseporsilbidosconotrapersonapresadelamismacrcel(AutodelJVPde
CastillaLennm.1de7deenerode1990).

9. Puede sancionarse un hecho como delito por el ordenamiento penal y


tambin por el penitenciario?
Enprincipionodeberaserposible,porqueestaramoscastigandodoblementeunmismohecho.Adems,el
castigoquesepuedeimponerenalgunoscasosesdelamismanaturaleza.Porejemploposeerdrogas
txicas (se entiende destinadas para el trfico), implica la imposicin de una pena de prisin en el
ordenamientopenal y una sancinde aislamiento en el penitenciario; ambas medidas son privativas de
libertad.
Noobstante,enelartculo232.4RPsepermitequesepuedanimponerambassanciones,lapenalyla
penitenciaria,cuandoelfundamentodeestaltimasealaseguridadyelbuenordenregimental.
Aunqueellegisladorhaqueridoponerlmitealadoblesancin,estamossegurosquedadalaambigedadde
lostrminosseguridadybuenorden,lassituacionesdedoblecastigovanasermuyfrecuentes.Es
difcilencontrarunaaccinconstitutivadedelitoquenoafecteasuvezalordendelaprisin.
EsteplanteamientonoesacordeconlospostuladosdeunEstadosocialydemocrticodeDerecho.
Porello,elbuenordenregimentalnecesitaserinterpretado.Existendossignificados:
Elprimero,genrico,suponequetodapersonapresacuandocometeundelitoounafaltavulnerael
ordenregimentalporqueconsuconductaatentacontralosdeberes,enabstracto,alosqueestobligadoa
cumplir.
Elsegundosignificadoesunaconcepcinmaterialmsconcreta.Secentraexclusivamenteenlavida
colectivadelinteriordelaprisin.Solamenteexistealteracindelordensiunaconductaafectaavarios
presos, y debido a ella, pueden originarse plantes, motines, o actos comunes que pongan en peligro la
integridadfsicadelosinternos.
Sepodraentenderquelapropiaregulacindelamateriapermiteeseentendimientocuandosedistingue,
comohaceelart.232,entrebuenordenregimentalyotrossupuestos,comoloscontenidosenelart.41
LOGP que habla de convivencia ordenada, o el art. 102.5 RP donde habla de normas generales de
convivencia ordenada. Ello supondra que no todo incumplimiento de las normas de rgimen interior
conlleveunalesinaeseordenregimentalmsrestringido,auncuandopuedatenerrepercusinenlamarcha
regimentalopuedaafectaraloqueseralaconvivencia2.
Porotrolado,lasancindelaadministracinpenitenciariadependedesisecondenaonoenelproceso
penal.Noessuficientequelacrcelquieraquelasancinadministrativaseapliqueantesdequeseresuelva
elprocedimientopenalargumentandoquelaintervencinpenitenciariatienequeserinmediata,paraesos
finesdeurgenciacuentanconlosmedioscoercitivos.
Tambinescriticableque,encasodequesedictesentenciaabsolutoriaenelprocesopenal,elReglamento
Penitenciarionoconcretelanecesidaddequelasancinnoseimponga.
Enconclusin,cuandoporunaconductaquenoafectealaseguridadcolectivadelacrcelsedicteuna
condenapenal,yasuvezunasancinadministrativa,sevulneraelprincipiononbisinidem,puescomo
yahemosdicho,segnladoctrinayelart.133delaLey30/1992,nocabeimponerlasancinadministrativa
cuandosehayaimpuestounapenalsiexisteidentidaddepersonas,hechosyfundamentos.
As,porejemplo,ensituacionesenlasqueunapersonaescondenadaporundelitodeatentadoyresistencia
contralaautoridad(contrafuncionariodeprisiones),nopuedeserposteriorocoetneamentesancionado
administrativamente,porqueenlaimposicindelasancinexistelatripleidentidadalaqueserefiereel

preceptomencionado(AutoJVPOviedode19dediciembrede1996).
Esms,sisecumplieselasancinadministrativapreviamente,luegopodrapedirsealJuezsentenciadorque
abonaseesosdasdeaislamientoalcumplimientodelacondena.Enalgunaresolucinjudicialsereconocela
posibilidaddequeunavezcumplidounaislamientocomosancinadministrativaseprocedaasuabonopara
lacausapenal,evitandoasladuplicidaddesancionesporunmismohechomientrasserespetalaprioridad
delasancinpenalsobrelaadministrativa(AutodelJuzgadodeloPenalnm.5dePalmadeMallorcade1
deenerode1994).
EnlossupuestosenqueelJVPsuspendalatramitacindeunrecursocontraunasancindisciplinariahasta
queexistaunasentenciafirmeenlajurisdiccinpenal,unavezalzadalasuspensin,siseconfirmala
sancindisciplinaria,eltiempodecancelacinsestacomenzaracorrercomosisehubieracumplido
efectivamentelasancinimpuestaensuda(Criterio72ReuninJVPenero2003)

10. Cules son las sanciones disciplinarias?


Lassancionesaplicablesseencuentranestablecidasexpresamenteenelartculo233RP.Adiferenciadela
posiblearbitrariedadquesededucedeladescripcindelasinfracciones,lassancionesquedansometidasde
unaformaescrupulosaalprincipiodelegalidad.Noobstante,sibiennopuededecirseconcarctergeneral
quesuponenunavulneracindelprincipiodeproporcionalidad,sonmuycriticablesporquesuaplicacin
afectaaaspectosqueaparecenmuymermadosenlaprisinyquetienenunagraveincidenciaenlasaludy
enlaestabilidadpsquicadelafectado.Adems,escuestionablequenoserecurraaotrasmedidasmenos
gravosasperoigualmenteeficacesquehansidorecogidasenotrosordenamientosjurdicosyquepodran
haberafectadoaotrosbienesdemenorentidad3.
Lassancionesseencuentranenumeradassiguiendounciertoordendeprioridad:
a)Aislamientoenceldanosuperioracatorcedas.
b)Aislamientohastasietefinesdesemana,desdelasdiecisishorasdelsbadohastalasochodellunes
siguiente.
c)Privacindepermisosdesalidaporuntiempoquenopodrsersuperioradosmeses.
d) Limitacinde comunicaciones orales al mnimo de tiempo reglamentario, durante un mes como
mximo.
e)Privacindepaseosyactosrecreativoscomunes,encuantoseacompatibleconlasaludfsicay
mental,hastaunmescomomximo.Enlaprctica,estasancinseconvierteenunasancinmuysimilara
ladeaislamientoporquesiinterpretamosquelaprivacinserealizartodoeltiempoenqueelpresonoest
ocupadodesempeandotareas,actividadesuocupacioneslaboralesy,comolarealidadesqueapenasexisten
stas,elloimplicaqueelpresoestartodoeldaenceldas.Alaadministracinpenitenciarialecorresponde
laobligacindefavorecerycrearactividadeslaboralesyocupacionales;peroestaexigenciaesincumplida
sobretodoenlosmesesdeverano.Porello,nopodemosvariarelcontenidodeunasancin,incrementando
su castigo, por motivos cuya responsabilidad radica exclusivamente en una posible negligencia
administrativa.
Enelcasodelospresosdeprimergradooaplicacindelart.10LOGPquefuerensancionadosconprivacin
depaseosafindehacermsgravosasusituacindeaislamiento,seequiparar,tresdasdeprivacinde
paseosconundadeaislamiento(Criterio73,reuninJVP2003).
f)Amonestacin.
Laimposicindesancionesdisciplinariasdenaturalezasdistintasalasaqutasadasnocabeporaplicacin
estrictadelprincipiodelegalidad.As,nosonaceptablessancionesnoestrictamenteprevistasporlaley
comoseralaprivacindetenenciadeT.V.(AutodelJVPdeAlicantede23demarzode1993).

11. En qu consiste y en qu condiciones debe cumplirse la sancin de


aislamiento?
Estasancinconsisteenestarencerradoenunaceldaveintidshorasalda.Elsancionadoslopuededisfrutarde
doshorasdepatioensolitarioynopodrrecibirpaquetesdelexteriorniadquirirproductosdeleconomato,salvo
losautorizadosexpresamenteporeldirector(art.254.5RP).
Lalegislacin,conscientedelaseveridaddelcastigo,exigeunaseriedemediosdecontrol.Seestableceque
lasancindeaislamientosecumplirconelprevioreconocimientodelmdicodelacrcel.steobservar
diariamentealaspersonaspresasmientraspermanezcanenestasituacin,debiendoinformaraldirector
sobreelestadodesaludfsicaymental.Siensuopininesconvenientelasuspensinomodificacindela
sancin impuesta, lo solicitar al director. En casos de enfermedad del sancionado, y siempre que las
circunstanciasloaconsejen,sesuspenderlaefectividaddelasancinhastaqueseadadodealta(art.254.2
RP).
Estasancinnoseaplicaralasmujeresgestantes,niaaquellashastaseismesesdespusdelaterminacindel
embarazo,nialaslactantes,nialasquetuvieranhijosconsigo.
Laceldaenquesedebecumplirlasancindeberserlamismaqueocupanormalmentesalvoqueseacompartidao
que,porpropiaseguridadoporelbuenordendelestablecimiento,selepaseaunadeanlogascaractersticas(art.

254.3y4RP);aunquelocontrariodeberjustificarserazonadamente(criterio75reuninJVPenero2003);nose
puedealegarqueaunquelaceldaseadesimilarescaractersticaselpatioesnotablementeinferiorencuantoasus
dimensionespueselReglamentoPenitenciarionoestablecenadaalefecto(AutoAPLARiojade23.11.2001).
Ahorabien,elcambiodeceldadebejustificarsecondatosobjetivablesnosiendosuficientelareferenciaalbuen
ordendelcentro.Enalgunasocasionessehajustificadoelcambiodeceldapara"noperturbarlasactividades
normales de otros mdulos". Como no se dice cul es esa perturbacin la explicacin de la excepcin es
insuficiente(Auto916/99APMadridseccin5de30dejuniode1999). Adems,nosepuedenaadirms
restriccionesquelasestablecidasenlaley(22horasdeceldayprohibicinderecibirpaquetesdelexteriornidel
economato),todaslasdems(cacheosextraordinarios,requisas,registros)sonilegales.Deahquelaexistenciade
mdulosparacumplirlasancindeaislamientoconnormasespecficasderestriccindederechossonilegales
(Auto916/99APMadridseccin5de30dejuniode1999).
Cuandoestasancinsupereloscatorcedasconsecutivos,sernecesarialaaprobacindelJuezdeVigilancia
Penitenciariaparaqueseaejecutiva(art.253.1RP);tampocopuedesobrepasarlos21enlossupuestosde
cumplimientosucesivo(art.235RP),nide42enloscasosdecumplimientosucesivo(art.236.3RP).ElJuez
deVigilanciacompetenteparasuaprobacineseldelacrcelenquesevaacumplirlasancin,con
independenciadeculsealacrcelquehubieradictadoelacuerdosancionador.Parecerazonablequesea
steporinmediacinyproximidadalapersonasancionada,yaqueestenmejorescondicionesparaverificar
elcontroldelalegalidaddelcumplimientodelasancindeaislamiento;nocabedudaquequienmejor
puedevalorarsiconcurrenenelpenadounaenfermedaduotracircunstancia queaconsejensuspenderla
efectividaddelasancineselJuezdeVigilanciadelacrceldecumplimiento(Criterio4JVP,enero2003).
Aunquelapersonaestaisladanoseimpideque:
Puedacambiarsederopaconlamismafrecuenciaquelohacapreviamente,pueslahigieneduranteel
aislamientodebemantenerse.
Tenga una radio. A falta de prohibicin expresa, debemos entenderlo permitido. Adems, no sera
legtimoquemediantelaaplicacinextensivadeunanormareglamentariaquedarasuprimidounderechode
entidadconstitucionalcomoeselderecibirunainformacinveraz(art.19.2).
Exija la no existencia de chapas metlicas en la ventana, si con ello se rompe la exigencia de
semejantesmedidasycondicionesdelaceldadeaislamientoenrelacinconlahabitual.Porello,sidicha
chapanoeshabitualenlamayoradelasceldasdelCentro,tampocodebeserloenlasdeaislamiento.
Pueda hacer uso de tabaco, leche, agua y pilas durante el aislamiento. El uso prohibido es el de
productosdenuevaadquisicin,peronodelosqueyatuvieraelpresoensupoder,segnsededucedela
interpretacinliteraldelaSTC21deenerode1987.Sloselimitarlaposibilidadderecibirpaquetesdel
exterior,ydeadquirirciertosartculosdeleconomato,omitiendotodareferenciaaluso(AutodelJVPdeLas
Palmasde24dejuniode1994;AutosdelJVPdelPuertodeSantaMarade12deagostode1994,23de
agostode1994y23defebrterode1995).
Setienederechoalascomunicacionesespeciales(visavis).Algunasresolucionesdelaadministracin
penitenciarianieganqueunpresosancionadoconaislamientopuedatenercomunicacionesespeciales.Esto
esunainterpretacinilegal.Enart.41RPprevquesepuedanrestringirlascomunicacionesovisitaspor
razndeseguridad,intersdeltratamientoybuenordendelcentro.Noexistenormasimilarrespectodelas
comunicacionesespeciales,peroellonoautorizaaprivarlasorestringirlassinms,alegandoexclusivamente
razonesdeseguridaduordeninterno,quenitansiquieraconstanenlanegativadelcentropenitenciario.Pero
es ms, dado el sistema restrictivo que ha de prevalecer en todo procedimiento sancionador, carece de
fundamento que el cumplimientode la impuesta al interno deba ir acompaada de la restriccin de un
derechodecomunicacinnoprevistalegalmente.Aesterespecto,elart.254RPensuprrafo5describe
cmo se cumplen las sanciones de aislamiento, haciendo mencin a las dos horas diarias de paseo en
solitarioyalanorecepcindepaquetesoproductosdeleconomato,salvolosautorizadosexpresamente.De
esa descripcin no puede deducirse que tambin queden limitadas las comunicaciones porque sera una
conclusin"contralegem",apartedemsperjudicialparaelinterno(Auto85/97APJande25dejuniode
1997).Esms,dadoelsistemarestrictivoquehadeprevalecerentodoprocedimientosancionador,carece
defundamentoqueelcumplimientodelaimpuestaalinternodebairacompaadadelarestriccindeun
derechoalacomunicacinnoprevistalegalmenteAutoAPGranada,rollodeapelacin17/1997).

12. Puede considerarse la sancin de aislamiento como una situacin similar


a la pena privativa de libertad?
Pensamosques.Elcumplimientodeestasancinincidedirectamentesobrelaesferadelalibertadpersonal
de movimientos. Se trata, como seala el TC en la sentencia 74/1985, de una medida coercitiva de
aislamientoenceldaqueimplicaunagraverestriccindelayarestringidalibertadinherentealcumplimiento
delapena.
Ennuestraopinin,consisteenunaautnticaprivacindelalibertadqueelpresotodavatienedentrodela
crcel.Esclaroqueestalibertadestmodificadarespectodelalibertadpreviaqueelciudadanoposeeantes
delingresoenprisin,peroencualquiercasoestanuevasituacindeberecogersedentrodelmbitodel
derechoalalibertadreconocidoconstitucionalmenteenelartculo17CE.

Nocabeningunadudaquecuandounapersonaestencerradaveintidshorasenunacelda,laimposibilidad
demovimientosnoesotracosaqueprivacindelibertadREALYMATERIAL,aunquelajurisprudencia
siga empeada en una determinada interpretacin legal del precepto. El Tribunal Constitucional, como
veremos seguidamente, establece que el aislamiento o el rgimen cerrado es una modificacin de las
condicionesdevidadentrodelacrcel,pero:quconsecuenciastieneesecambiodecondiciones?La
respuestaesclara:privacindelibertad.
Aesterespecto,elTribunalConstitucionalensentencia2/1987de21deenero,considerquelasancinde
aislamientonopuedeentendersecomounaprivacindelibertad,sinouncambioenlascondicionesdevidaen
prisin:unarestriccindelalibertaddemovimientosdentrodelestablecimientopenitenciarioaadidaauna
privacindelibertadimpuestaexclusivamenteporsentenciajudicial....Deellosededucequecomoyaexisteuna
privacindelstatuslibertatisporlasentenciacondenatoria,lassucesivassancionesadministrativasyanopueden
privardeesalibertadinicial porquelospresosyalatienenprivada.Deestamanerasejustificaencasode
adopcinporpartedelaadministracindeunasancindeaislamiento,clasificacinenprimergrado,oaplicacin
deart.10LOGPquenoexisteconfrontacinconelart.25.3CE.
Noobstante,estaposicinjurisdiccionalvacambiando.ElTribunalConstitucionalensentencia119/1996
(votoparticulardelMagistradoCarlosPISUNYER,alqueseadhiereTomsVIVESANTN)establecequesibien
esciertoqueelinternoenunestablecimientopenitenciarioseveprivadoenloprimordialdesuderechoala
libertad(porquelohasidoporsentenciapenal)yporelloelaislamientonopuededenominarseunanueva
privacindelibertad,ellonocomportaquesunuevasituacindelibertadenprisin(alqueseotorga
otrostatusdelibertatismodificado(STC2/1987,57/1994,35/1996)distintodelciudadanoqueestfuera
deprisin)noseintegredentrodelmbitodelartculo17CE,yenconsecuenciaquelasrestricciones
relevantesdelmismodebentenerlaadecuadacoberturalegalparapoderlimitarlosderechosfundamentales
delCaptuloSegundodelTtuloPrimerodelaConstitucin.
La cuestin prctica en este tema es que, si el aislamiento es considerado como privacin de libertad, la
administracinnopuedeimponertalessancionesoregmenesdevidaenprimergradooart.10LOGP,porqueel
artculo25.3CEprohibealaadministracinlaimposicindesancionesquedirectaosubsidiariamentesupongan
privacindelibertad4.Demaneraque,paraacordarestasmedidasrestrictivasdelibertad,deberanseradoptadas
porunJuezatravsdeunprocedimientoenelqueseobservasentodaslasgarantasprocesalesyserespetasenlos
derechosConstitucionales.Delocontrario,laadministracinpodraestarvulnerandoelartculo23CE.Anteesta
situacincaberecursoanteelJVP,laAudienciaProvincialyelTribunalConstitucionalporvadelrecursode
amparoporvulneracindelartculo17enrelacinconel25.3CE.

13. Todo acto de violencia o agresividad lleva consigo la sancin de


aislamiento?

No.Estasancinpuedeimponersecuandosehayamanifestadounaevidenteagresividadoviolenciapor
partedelinterno.Elusodelasancindeaislamientoesgeneralizado,ylascomisionesdisciplinariasacuden
con rapidez a esa sancin para castigar las infracciones graves y muy graves, resultando incumplido el
mandatodelart.42.4LOGPquesloautorizaasuusoenlasituacinanteriormentereseada.
Elusodelaviolenciaoagresividadplanteaunproblemadeinterpretacin.DesdeelpuntodevistadelFiscalPiol
Rodrguez,yconelnimodelimitarelusodeesasancin,entendemosquenoseproducirasimplementeporla
constatacindeunactoagresivooviolento,aunquenormalmentepuedequeasocurra,sinoquehabraque
revelarseporelactounareaccindesmedida,sinaparentejustificacinyactualopotencialmentepeligrosa.As,
unapeleaentredospresos,notiene,sinms,queconllevarlaaplicacindelaislamientosinoserevelaconellola
existenciaporpartedecualquieradelosimplicados,deesaagresividadconsistenteenlaforma,losmedios
empleados,lareiteracinenlosactosdeacometimientooenlosresultadosproducidos.
Este es el argumento que hay que utilizar en el recurso que se interponga ante el Juez de Vigilancia
Penitenciariaenloscasosdesancindeaislamientoporactoviolento.

14. Se puede suspender una sancin de aislamiento?


S.LaComisinDisciplinaria,deoficio,obienapropuestadelaJuntadeTratamiento,puedesuspenderla
ejecucindelasancindeaislamientoimpuestacuandolascircunstanciasloaconsejen.Hadehacersea
travsdeunaresolucinmotivada(modelonmero45).
CuandolaComisinDisciplinaria,enatencinalosfinesdereinsercinyreeducacino,alascircunstancias
personalesdelsancionado,estimeoportunomantenerlasuspensindelasancinduranteelplazodetresmeses,de
oficiooasolicituddelapersonasancionada,aplicarlareduccindelasancinprevistaenelartculo256.1RP
(modelonmero46).
CuandoelJuezdeVigilanciahayaintervenidoenlaimposicindelassancioneslasuspensinnecesitarla
autorizacinjudicial(art.255.3RP).
Estasuspensindelasancindeaislamientoestpensadaquelaspersonasquehastaesemomentohubiesen
tenidobuenaevolucinpenitenciaria(buencomportamientoyparticipacinenactividades)yestasancinle
provocarelaprdidadepermisosodelaconcesindeltercergrado;tambinsepuedesuspenderaquienes

cometanporprimeravezunainfraccinyquesuscaractersticaspersonasseaaconsejablelasuspensin.La
suspensinserealizarapropuestadelaComisinDisciplinariayserporuntiemponosuperioratres
meses; transcurrido dicho plazo la Comisin podr reducir la sancin y el perodo de cancelacin,
computandoparalacancelacinlostresmesesqueestuvoensuspenso.Durantelasuspensinlapersona
podrtenerpermisos,einclusounaprogresindegrado(I16/96)..

15. Cul es la correlacin entre infracciones y sanciones?


Porlacomisindefaltasmuygravespodrnimponerselassiguientessanciones(art.233.1RP):
a)Deaislamientoenceldadeseisacatorcedasdeduracinsiemprequehayamanifestadounaevidente
agresividadoviolenciaporpartedelinternoocuandostealteredeformareiteradaygravelanormal
convivenciaenelCentro.
b)Sancindeaislamientodehastasietefinesdesemana.
Porlacomisindefaltasgravespodrnimponerselassiguientessanciones(art.233.2RP):
a)Sancindeaislamientoenceldadelunesaviernesportiempoigualoinferioracincodas,siempre
queconcurranlosrequisitosdelapartadoanterior.
b)Lasrestantesfaltasgravessesancionarnconprivacindepermisosdesalida,limitacindelas
comunicacionesoralesoprivacindepaseosyactosrecreativoscomunesdesdetresdashastaunaocomo
mximo.
Porlacomisindefaltaslevesslopodrncorregirseconprivacindepaseosyactosrecreativoscomunesde
hastatresdasdeduracinyconamonestacin(art.233.3RP).

16. Cmo sern graduadas las infracciones?


La determinacin de la sancin y de su duracin se llevar a efecto atendiendo a la naturaleza de la
infraccin, la gravedad de los daos y perjuicios ocasionados, el grado de ejecucin alcanzado, la
culpabilidad,elgradodeparticipacinylasdemscircunstanciasconcurrentes(art.234RP).
Seramsacordeconlafinalidaddelrgimendisciplinarioydelobjetivoreeducador,tantodelapenacomo
de los establecimientos penitenciarios, que los elementos a tener en cuenta fueran: las circunstancias
personalesdelinfractorenrelacinconeltratamiento,lanaturalezadelhechoenrelacindirectaconel
gradodedesordenydeinseguridadprovocadasconlainfraccin.
Segnestredactadoesteartculo,esposiblelapresentacindepruebasparaanalizarlaconcurrenciadelas
eximentes del Cdigo Penal en los comportamientos realizados (causas de inculpabilidad (anomala o
alteracinpsquica,intoxicacinplenadedrogasetc.),causasdejustificacin(legtimadefensa,estadode
necesidad,obrarencumplimientodeundeber)ydemselementosdelateoradeldelito.

17. Qu ocurre cuando se repite la infraccin?


Encasoderepeticindelainfraccin,lasancinpodrincrementarsehastalamitaddesumximo.Habr
repeticin, a los efectos sealados, cuando la persona hubiese sido sancionada con anterioridad por
infracciones graves o muy graves y las correspondientes anotaciones en el expediente no se hubiesen
cancelado(art.235RP).

18. Qu ocurre cuando sean varias las faltas enjuiciadas y sancionadas?


Cuandoseanvariaslasinfraccionesenjuiciadasdeberncumplirsesimultneamentesifuereposibledebidoala
naturalezadelasmismas(ejemplo:privativasdelibertadaislamientoyprivativasdederechosprivacinde
comunicaciones);encasocontrario,secumplirnsucesivamenteporordendesurespectivagravedadoduracin
(art.236.1RP).
Encasodelcumplimientosucesivodelassanciones,ellmitemximosefijareneltriplocorrespondientea
la ms grave de ellas. La sancin de aislamiento en celda no podr exceder de cuarenta y dos das
consecutivos.Enelsupuestodecumplimientosucesivodesancionesdeaislamientoencelda,cuandose
superenensuconjuntoloscatorcedasdeaislamiento,debernseraprobadasporelJuezdeVigilancia(art.
236.3RP).
Encasodequeunmismohechoseaconstitutivodedosomsfaltasocuandounaseamedioparacometer
otra,sloseaplicarensulmitemximolasancincorrespondientealafaltamsgrave,salvoquelasuma
delassancionesqueprocedancastigandoindependientementelasinfraccionescometidasresultedemenor
gravedad,encuyocasoseaplicarnstas(art.236.4RP).
Cuandoserealicendiversasaccionesuomisioneseinfrinjanelmismoosemejanteprecepto,enejecucinde
un plan preconcebido o aprovechando idntica ocasin, se impondr la sancin correspondiente a la
infraccinmsgraveensulmitemximo(art.237RP).

19. Pueden ser reducidas las sanciones?


S. La Comisin Disciplinaria, de oficio o, a propuesta de la Junta de Tratamiento puede reducir las
sanciones atendiendo a los fines de reeducacin y reinsercin social; la reduccin consistir en una
minoracindelagravedaddelasancinimpuesta(art.256.1R.P).
Para conseguir estas reducciones hay que hacer un escrito a la Comisin de Disciplina explicando los
motivosporlosqueelcumplimientodelasancinvaasuponerunretrocesoenlareeducacinoreinsercin
socialdelpenado(posibilidaddesalirdepermiso,estadofsico,situacinpsquica,estarhaciendouncursoo
enundestinoquenosequiereabandonarporelaprendizajelaboralquesupone,etc.).
Ahorabien,sienlaimposicindelasancinhaintervenidoelJuezdeVigilancia,biendirectamenteobien
porvaderecurso,lareduccinnopodrhacersesinsuautorizacin(art.256.3RP).Recordemosaququeel
AutodelJVPdeMadridnm.3de14.11.1995reconocelavigenciadelprincipiodeoportunidadenDerecho
sancionadoradministrativo.

20. Se puede revocar una sancin?


S.CuandoseadviertaquehuboerrorenlaaplicacindeunasancinquenohayasidorecurridaanteelJuezde
Vigilancia,independientementedequesehayacumplido,laComisindeDisciplinao,ensucaso,elCentro
Directivo,procederaunanuevacalificacindelainfraccin,siemprequenoimpliqueunasancinsuperiorala
impuestao,ensucaso,larevocarlevantandoinmediatamenteelcastigoycancelandoautomticamentelas
anotaciones.SielJuezdeVigilanciaintervinoenlaaplicacindelasancindeberautorizarlarevocacin(art.
256.2RP).

21. Se puede abonar a otra sancin el tiempo cumplido por una infraccin que
ha sido recurrida y luego estimada el recurso total o parcialmente?
S.Eltiempocumplidodeunasancinposteriormenterevocadaoreducidaenloscasosprevistoseneste
artculoocomoconsecuenciadeunrecursoestimadototaloparcialmente,podrtenerseencuentaparael
cumplimiento posterior de otras sanciones, siempre que stas hubiesen sido impuestas por acciones u
omisionestambinanterioresalamencionadarevocacinoreduccin(art.256.2RP).SegnlosJuecesde
Vigilancia,elpodrtienequeserobligatorio,esdecir,tendrnqueabonarsesiempre(Criterio65reunin
JVP,enero2003).
Estoscasosocurrenenlassituacionesenlasqueseejecutalasancindeformainmediata;porelloes
conveniente que esta ejecucin sin esperar la resolucin final del recurso por parte del JVP, sea
excepcionalsima.
Comoocurreconelabonodeprisinpreventivadeunacausaqueluegofueabsolutoriaocondenatoriaa
pena inferior de la que cumpli preventivamente, sera importante resear, como ya explicaremos en el
captulo17,queloimportantenoesquelapersonahayacometidoloshechosalosquesequiereaplicarel
tiempo de exceso con anterioridad a la revocacin o reduccin, sino se requiere que los podra haber
cometidohastaelmomentoenqueelpenadoconozcaquelasancinvaaserrevocadaoreducida.Porque,es
apartirdeestemomentocuandosurgelateoradelchequeenblanco:comolapersonasabequelevan
revocarunasancinqueyacumpli,yleesabonableaotra,puedecometeractosquesuponganunamximo
delvalordelasancinquefuerevocada.
Enconclusin,losactosalosquesepuedeaplicarelexcesooreduccindeotrasancindebenhaberse
realizado cuando la persona presa tenga conocimiento de la produccin de exceso de cumplimiento
(notificacindelAutodelJuzgadoreduciendoorevocandolasancin;notificacindesobreseimiento,...)
(AutodelJVPdeCiudadRealde20deoctubrede1993).

22. Se deben cumplir las sanciones impuestas y no cumplidas por la


excarcelacin del penado si ste vuelve a reingresar con posterioridad por
otra condena?
No, porque conla puesta en libertadse extingue la especial relacin jurdica que une a la persona con la
administracinpenitenciariaqueeselfundamentoqueposibilitalapotestadsancionadora.Nopuedeentenderse
queelnuevoingresosupongaunareanudacindelarelacinjurdicaanterior,sinoelnacimientodeunanueva
relacinjurdica(criterionmero36delosJuecesdeVigilanciaPenitenciariay,entreotros,AutodelJVPde
Sevillade24dediciembrede1987).

23. Cundo prescriben las infracciones?


Cuandotranscurreundeterminadoplazodetiempo,lasfaltasqueundasecometieronnopuedenenjuiciarse;esto
sedenominaprescripcin.Cadatipodefaltatieneunplazodiferente.As,lasfaltasdisciplinariasmuygraves
prescribirnalostresaos,lasgravesalosdosaosylaslevesalao.

Estos plazos comienzan a correr cuando se haya cometido la falta, pero se interrumpe cuando se haya
iniciadoelprocedimientocorrespondiente,conconocimientodelpreso.Laprescripcinvolverainiciarsesi
elprocedimientoseparalizadurantemsdeunmesporcausasquenodependandelpresuntoautor(art.
258.1RP).
Distintoeslacaducidaddelprocedimientorecogidoenelart.246.2enelqueseestablecequeelacuerdo
deberdictarseenelplazomximodetresmesesdesdelainiciacindelprocedimientodisciplinario.Se
entender caducidad de oficio y se proceder al archivo de las actuaciones, de oficio o a solicitud del
interesado. La caducidad nosupone la prescripcin de manera que el procedimiento puede nuevamente
volverainiciarse(art.92.3LRJAPPAC)

24. Cundo prescriben las sanciones?


Lassancionesimpuestasporfaltasmuygraves,gravesoleves,prescribirnenlosmismosplazossealados
paralasinfraccionesprevistasenelart.258.1RP.Elplazocomenzaracontardesdeeldasiguienteenque
laresolucinseafirme(quenosepuedarecurrirlo,ensucaso,desdequeselevanteelaplazamientodela
ejecucinolasuspensindelaefectividadodesdequeseinterrumpaelcumplimientodelasancinsiel
mismoyahubiesecomenzado(art.258.3RP).

25. Cundo se cancelan las faltas?


Lasfaltas,cuandohatranscurridoundeterminadoplazoapartirdequesecumplaefectivamente,setienen
comosinosehubiesenimpuesto.
Lasfaltasmuygravesserncanceladasdeoficiooainstanciadepartealosseismeses;lasgravesalostres
mesesylaslevesalmes.Estosplazoscomienzanacontardesdeelcumplimientodelasancin(art.260.1
RP).Seexige,adems,quelapersonapresaduranteeseplazo,nohubieraincurridoenunanuevainfraccin
disciplinariamuygraveograve.Losplazosdescritossepodrnacortarhastalamitaddesuduracinsi,con
posterioridadalasancin,elinternoobtuvierealgunarecompensadelasprevistasenelartculo263(art.261
RP).
Cuandosesancionenenunmismoactoadministrativodosomsfaltas,susplazosdecancelacincorrern
simultneamente.Elcmputosehardeformaconjunta.Lafechadeinicioserladelcumplimientodela
sancin ms reciente y se tomar como duracin del plazo el que corresponda a la ms grave de las
infraccionesacancelar,transcurridoelcual,secancelarntodaslasanotacionespendientesenunsloacto
(art.260.3RP)
Encasodenocumplimientodelasancinporrazonesmdicasodeotroordennoimputablesalapersona
presa,losplazosdecancelacincomenzarnacontarsedesdelafechaenqueaqullapudohabersecumplido
(art.260.4RP).Enloscasosenloquesereduzcaeltiempodelasancinporabonodesancionesrectificadas
porvaderecursooreducidasorevocadas,elplazodecancelacincomenzaracomputarsedesdeeldaen
quequedcumplida.

26. Qu efectos tiene la cancelacin de las sanciones?


Lacancelacindelassancionesllevaraparejadaladelasfaltasporlasqueseimpusieronysituaral
penado,desdeelpuntodevistadisciplinario,enlamismasituacinquesinolashubierecometido(art.262
RP).Peroapesardequenosetenganencuenta,seguirnconstandoenelexpedientedelinternosancionado
conlalgicainfluencianegativa.Ahorabienaefectosdepermisos,libertadcondicionalsalidasprogramas,y
beneficiospenitenciariosnosepuedealegarmalaconductasilassancioneshansidocanceladas.

27. Cmo se inicia el proceso sancionador?


El director de la crcel, cuando aprecie indicios de conductas que pueden dar lugar a responsabilidad
disciplinaria5,dariniciomotivadamentealprocesosancionadordealgunadelassiguientesformas(art.241
RP):
a)Porpropiainiciativa,cuandotengaconocimientodelaexistenciadehechossancionablesatravsdeun
partedefuncionario,informadoporelJefedeServiciosoporcualquierotromedio.Enestecasopuedeser
queelfuncionarioremitaparteescritoinformandosobredatosqueselesolicitenparteinformativoosobre
conductasderelevanciadisciplinariapartedisciplinario.Estospartesseremitirnalsuperiorjerrquicoque
ser,normalmenteeljefedeservicios,ysiesstequiendaparte,loharaldirector.Estospartestienen
constandeunencabezamiento:identificacindelfuncionarioquelosuscribe,departamentoolugardondese
hanproducidoloshechos,expresindeldaydelahora.Posteriormentesetienequereflejarunrelato
escuetodeloshechosysuscircunstancias,delaformamsobjetivaposible,sinvaloracionespersonales,
poniendoelnombreonombresdelaspersonasqueparticiparonenelincidente.Porltimodebendescribirse
sisehantomadomedidasconcretas(medioscoercitivos,asistenciamdica,recogidadeobjetos...).
b)Porpeticinrazonadarealizadaporcualquierotrorganoadministrativoquenoseasuperiorjerrquico
(policasquerealizanunaconduccin,personallaboraletc...).

c)Pordenunciaescritadepersonaidentificadaqueexpreseelrelatodeloshechosquepudieranconstituir
infraccin,fechadecomisinytodocuantoseaposibleparalaidentificacindelospresuntosresponsables.
d)Porordenemitidaporunrganoadministrativosuperiorjerrquico.Sepuedeentenderporordendel
directorosubdirectoresgeneralesquehayantenidoconocimientodirectooporreferenciadealgnhecho
sancionable.
Paraelesclarecimientodeloshechos,eldirectorpuedeacordarlaaperturadeunainformacinpreviaquese
practicarporunfuncionariodelacrceldesignadoporeldirector,quienelevaraaquluninformeconel
resultadoyvaloracindelasdiligenciaspracticadas.Estainformacinpreviaseacordarsiemprequeun
interno formule o denuncie hechos susceptibles de sancin disciplinaria, salvo cuando sta carezca
manifiestamentedefundamento(art.245.2RP).Estemecanismoconstituyeunmedioeficazparanoiniciar
procedimientosquenotienensolucinlegalalgunaporsuextraordinariadificultadypermiteorientarla
informacinhacialaspruebasquesetienequeproponer.

28. Cmo se desarrolla la instruccin del proceso sancionador?


Se nombra instructor del expediente disciplinario al funcionario que el director estime conveniente,
excluyendoalquehayapracticadolainformacinpreviayalosquepuedanestarimplicadosenloshechos,
as como, obviamente, a los que forman la Comisin Disciplinaria; el funcionario instructor se elige
preferentementeentrelosCoordinadoresdeservicio(I19/96).
Enlaactualidad,yadiferenciaconelprocedimientoestablecidoenelReglamentoanterior,queelinstructor
noformepartedelrganodecisor,implicaquenobastaelmeropartedisciplinarioparapodersancionar,sino
que tendr que practicarse una actividad probatoria que, como en el proceso penal, pueda servir para
determinarlaexistenciadeloshechosdenunciados,lascircunstanciasconcurrentes,laspersonasimplicadas,
susparticularidadesytodoaquelloquepuedacondicionarunaadecuadavaloracindelasconductas.Esel
derechoalapresuncindeinocencia,querigesinlimitacindentrodeesteprocedimiento,elqueexigeque
ello sea as, pues el imputado no ha de acreditar su inocencia, sino que habr de ser el que asume la
acusacinquienhadepreocuparsedeello.
Elfuncionarioinstructor,alavistadelosindiciosqueencuentre,formularpliegodecargosdirigidoa
lapersonapresacuyaconductaseapresuntamenteconstitutivadefaltadisciplinaria.
Laacusacinseexplicitarenunpliegodecargosenelquedeberconstar:
a)Identificacindelapersonapresuntamenteresponsable.
b)Formadeiniciacindelprocedimiento(sielexpedientesehaincoadodeoficio,porordensuperior,
envirtuddeparteescritodefuncionariooaresultasdeinformacinprevia).
c)Nmerodeidentificacindelinstructorypuestodetrabajoqueocupa.
d)Organocompetenteparalaresolucindelexpedienteynormaqueleatribuyetalcompetencia.
e)Relacincircunstanciadadeloshechosimputados.Estederechodeinformacindelaacusacinal
internolepermitesudefensa.Conciertahabitualidadsedescribenconductasconunassimplesfrasescomo
porejemplo,insultaunfuncionario,posesindeobjetosprohibidos.Estasfrasesnosonunrelato
circunstanciadodeloshechos.Deestaforma,elpresoveimpedidasudefensapuesdifcilmentepuederebatir
loquenoconoceconexactitud.Porello,elpliegodecargosdebecontenertodosloshechosdelosquesele
acusacontodoslosdatosrelativosalosmismos.
f)Calificacinjurdicadetaleshechos,indicandoelapartadoconcretodelartculodelRealDecreto
1201/1981enelquepuedanestarcomprendidos,ascomolassancionesque,ensucaso,sepodranimponer
conlaindicacindelpreceptoaplicable.
g)Medidascautelaresquesehayanacordado,sinperjuiciodelasquepuedanadoptarseduranteel
procedimientodeconformidadconlodispuestoenelartculo243.
h)Indicacindequelapersonapresadisponedetresdashbilesdesdeelmomentodesurecepcinpara
presentar pliego de descargos por escrito o para manifestar su deseo de alegar verbalmente ante el
instructor.Porello,elacuerdosancionadorslopuedesertomadopasadootranscurridodichotiempo,delo
contrarioseoriginaindefensin(verAutodelJVPdeCceresde28deoctubrede1992);tampocopuede
celebrarseJuntadeRgimenantesdevencidoelplazo(verAutodeJVPdeMadridnm.2de14deoctubre
de1993).Nosecuentanlosdomingosnifestivos.Podralegartodoloquecreaconvenientesobreloscargos
formulados,proponiendolaspruebasquecreaconvenientesparasudefensa(vermodelonmero43).
i)Laposibilidaddeasesorarseporletrado,funcionariooporcualquierpersonaquedesignedurantela
tramitacindelexpedienteyparalaredaccindelpliegodedescargos.(STC74/1987,de18dejunio;2/1987,
de21deenero;190/87de1dediciembre,161/1993,de17demayo;229/1993de12dejulio;14371995,de3
deoctubre;181/1999,de11deoctubre;27/2001de29deenero;104/2002de6demayoy236/2002de9de
diciembreEntrelasgarantasqueconsagraelartculo24delaConstitucinseincluyeelderechoaladefensa
yalaasistencialetrada.Estederechotieneporfinalidadasegurarlaefectivarealizacindelosprincipiosde
igualdaddelaspartesydecontradiccin.
Ya desde la sentencia del Tribunal Constitucional 18/1981 se viene declarando reiteradamente que las
garantasprocesalesestablecidasenelartculo24delaConstitucinsonaplicables,nosloenelproceso
penalsinotambinenlosprocedimientosadministrativossancionadoresconlasmatizacionesqueresultende

supropianaturaleza,encuantoqueenamboscasosactaeliuspuniendidelEstado(SSTC2/1987,145/1992,
297/1993).
LaSentenciadelTribunalConstitucional74/1985analizaestederecho.Establecequelaasistenciadeletradodebe
serpermitidaenformaygradoestimablescomoproporcionadosalafalta,alasancinyalprocedimiento.Nose
trata(sealalaSentenciadelTribunalConstitucional2/1987)deunderechoalaasistencialetradaentendidacomo
underechoplenoincluyendolaasistenciajurdicagratuita.Nohaynadaquereprochar,segnestaSentencia,ala
negativaadesignarunletradodeoficio.Ahorabien,loquenosepodrnegareslacomunicacinconunletradode
sueleccin.Portanto,elasesoramientopuedepedirsealabogado.Enestesentidosemanifiestanlassentenciasdel
TribunalConstitucional74/1985,190/1987,192/1987,etc.
EstaposturadelAltoTribunalescuestionablepuestoqueslopodrntenerdefensaquienestenganmedios
econmicosparaello.Esciertoqueelprocedimientoadministrativonoexigelaasistenciadeletrado.Peroen
estembito,dondeelpresoseencuentraenunascircunstanciaspersonalesdelimitacin,lanoasistencia
preceptiva de letrado le coloca en una clara inferioridad respecto del resto de los ciudadanos. Debera
admitirsesinningntipodecortapisasladesignacindeletradosdeturnodeoficioparaladefensaen
expedientesdisciplinariosparagarantizarelderechoaladefensaanteunaposiblelimitacindelibertad(art.
17CE)quepuedeimponersecomoconsecuenciadelcomportamientoinfractor.
Deberahaberseaadidoenlaredaccindeesteartculolaposibilidaddequelapersonapudieseiracompaadade
letradoalaAudienciasiaslosolicitase.Noobstante,legalmentesloseprevqueleasistaenlaredaccindel
pliegodedescargoparaproponerlaspruebasoparaefectuarconsultasantesdelacomparecencia.Elderechoala
defensadebeserefectivo,nopuedequedarseenmeraspalabras;hadeserrealcomosealalaSTC21/1981donde
de manera enftica se establece: enningn caso la Constitucin tolera que el derecho a la defensa quede
convertidoenunameraformalidad,producindoseendefinitivaindefensin.
Parecieralgicoquepudiesesolicitarseeseasesoramientoalosjuristasdelacrcel,puestienenlaobligacin
deinformaralospenadosacercadesusituacinpenal,procesalopenitenciaria,bienporpropiainiciativa,
bienapeticindelinterno(STC161/1993).Peroenlarealidadenpocasocasionesselesconsultaporque
estosfuncionariospertenecenalaadministracinqueeslapartecontrariaenelproceso.Ahorabien,encaso
dequesesolicitesuasesoramiento,tienequeconcederse.,puesdelocontrarioelTribunalConstitucional
(STC180/1990de15denoviembrey143/1995de30deoctubre,181/1999de11deoctubre)considera
lesionadoelderechoaladefensadelart.24.2CEenuncasoenelquepedidoentiempoelasesoramientodel
criminlogodelaprisin,noseresolvilapeticinysesancionalreclusosinhabersidoatendidola
solicitud del interno. En caso de que se solicite asesoramiento al jurista y se deniegue, o se dicte la
resolucinsinhabersidoatendidoshayquerecurriralJuzgadodeVigilanciaysolicitarquesedeclarenulo
deplenoderechotodoloactuado(providenciaJVPCastillaLennum.3de27deabrilde2000),puesste
tieneeldeberdesalvaguardarlosderechosdelosinternosycorregirlosabusosydesviacionesquepuedan
producirse(Art.76.1LOGP).Sieljuzgadonocontestaalaquejasevulneraelderechoalatutelajudicial
efectiva(Art.24.1CE)(STC181/1999de11deoctubre).
Lapasividadosilencioporpartedelaadministracinantelasolicitaddeestetipo,realizadaentiempo
yformaanteunrganocompetentepuedesignificarlalesindelart.24CEsisuponelaprivacin
definitivadelaoportunidadderecibirunaasistencianecesariayeficazparalapreparacindesu
defensa(STC143/1995,128/1996,de9dejulio,83/1987,de22deabril,181/1999y236/2002).Slose
considerasiladefensaefectivaesincapazdecontribuirsatisfactoriamentealexamendelascuestiones
jurdicassuscitadas,loqueserconstatableencadacasoconcreto (233/1998, de1 dediciembre);
atendiendoalamayoromenorcomplejidaddeldebateprocesalyalaculturayconocimientojurdicos
delcomparecido,deducidosdelaformayniveltcnicorealizadoensudefensa.
Los Jueces de Vigilancia Penitenciaria recomiendan la presencia de los abogados en la defensa de los
derechosdelosinternosantelaComisinDisciplinariaenlosestablecimientospenitenciariosdebidoala
influenciaqueelmbitosancionador tieneenlavidapenitenciariadelrecluso(Criterio70,reuninJVP
enero2003).
j) Posibilidad de asistirse de un funcionario o interno como intrprete, si se trata de una persona
extranjeraquedesconozcaelcastellano.
k)Fechayfirmadelinstructordelexpediente(art.242RP).
El procedimiento contina con la posibilidad de adoptar medidas cautelares, escrito de descargo y
proposicindeprueba,escritodealegacionesyfasedeaudiencia,resolucinfinal.Todasellasmerecenun
estudiodetalladoquevamosarealizaracontinuacin.

29. Se pueden imponer medidas cautelares durante la instruccin?


Eldirectorpuedeacordarencualquiermomentodelprocedimiento,medianteacuerdomotivado,lasmedidas
cautelaresqueresultennecesariasparaasegurarlaeficaciadelaresolucinquepudierarecaeryelbuenfin
delprocedimiento,ascomoparaevitarlapersistenciadelosefectosdelainfraccin(art.243.1.RP).

LaadopcindeestasmedidasdebernnotificarsealapersonapresaycomunicarsealJuezdeVigilancia
Penitenciaria.
Lacrticaaesteartculopartedequesibienlasmedidaspodrnseracordadasporeldirector,nolasdelimita,
porloqueestamosanteunsistemainnominadodemedidas,queesrecusableporlaamplituddefacultades
queconcedeyporsudifcilcontrol.
Ennuestraopinin,laadopcindeestasmedidascarecenderacionalidad,porqueelcontrolqueentodomomento
setienesobrelosreclusosanulalaposiblefinalidaddemedidascautelaresenordenaasegurarlaeficaciadela
resolucinyelbuenfindelprocedimiento;pareceevidentequeningnpresosevaaesconderdentrodelrecinto
penitenciario.Porotrolado,esabsolutamenteimpropioacordarunamedidacautelarcuandoellotengacomo
exclusivafinalidadevitarlapersistenciadelosefectosdelainfraccindurantelatramitacindelasancin.Ello
supondraotorgaralamedidacautelarunafinalidaddeprevencinespecialyconelloconvertirse,enalgunoscasos,
enunaespeciedemedidadeseguridadpredelictual,siemprediscutibledesdelaperspectivadelrespetoalas
garantasylibertadesconstitucionales.
Lamedidacautelarnuncapuedeserunasancinanticipadaporquealpresuntoinfractorsiempreleamparala
presuncindeinocencia.
En nuestra opinin, no es suficiente que se comunique la adopcin de la medida cautelar al Juez de
Vigilancia,sinoquetendraqueseradoptadaporste,yaquelamedidaimplicaprivacindederechosyde
libertad(aislamiento).
Cuandolasancinquerecayesecoincidaennaturalezaconlamedidacautelarimpuesta,staseabonarpara
elcumplimientodelasancin(art.243.4RP).Allegisladorparecequeselehapasadoporaltoqueuna
medidacautelar,entodocaso,implicaunaprivacindederechos;enconsecuencia,tantosicoincideconla
naturalezadelasancincomosino,debeabonarsealasancin.Enelprimercaso,elabonoesunacuestin
matemtica; en el segundo, se debera tener por ejecutada la sancin en aquella parte que se estimase
compensada.

30. Cmo se desarrolla la fase de prueba y de audiencia?


Dentrodelosdiezdassiguientesalapresentacindelpliegodedescargoso,alaformalizacinverbalde
alegaciones,otranscurridoelplazoestablecidoenelart.242.h),sedebernpracticarlaspruebaspropuestas
porelreclusoylasqueelinstructorconsidereconvenientes.
Elpresotienederechoaproponerlaspruebastendentesaobtenersuexculpacin.Yestoesmuyimportante.
Tienenquepedirsetodaslaspruebasquesenecesiten,porqueelderechoautilizarlosmediosdepruebaes
underechoinseparabledelderechomismodedefensayexigequelaspruebassolicitadasseanadmitidasy
practicadassindesconocimientoniobstculos(SSTC30/1986,147/1987,97/1995).
Enlaprctica,sielpresonosolicitalapruebadedescargo,ladecargosedaporsupuestaconelsimpleparte
delfuncionario,loquehacequesesobrevaloreelcitadoparte,dndoleunapresuncindeautenticidaddela
quecarece.Esposiblequeenmuchoscasosbastelasimpleratificacindelfuncionarioenelparte,peroen
otros,habrquecomplementarleconaportacindedatostcnicos,oconpruebastestificalesqueacreditelo
denunciadoenelparte.Elargumentoqueenocasionesseofreceparadenegarlaspruebasconsisteenquela
pruebapropuestanoalteralaresolucinfinaldelexpediente,reflejadoenelpliegodecargosloshechosque
seleimputanausted,siendosolamentestoslosquecalificanlasupuestainfraccin..Estaformulacines
muyforzadaparajustificarladenegacindelapruebatestifical.ElTribunalConstitucional,localificade
arbitrariaeirrazonablepueseltextotrascritocarecelamsmnimavaloracinacercadelaprocedenciadela
pruebasolicitada,puescomportaunprejuicionegativoacercadelresultadodelaprueba,peseaquesta
versabasobreelsentidodelospropioshechosenjuiciados;yensegundolugardicharespuestavacade
contenidopropioyhaceintilelexpedientesancionadorquequedaprefiguradoporelpliegodecargos,
puespartedelerrneoprincipiodequeelcargodeterminadoporelfuncionariotieneunapresunciniuriset
deiureyquealfinyalcabonoadmitepruebaencontrario(STC9/2003de20deenero).Peroencualquier
casoesalinstructoralquelecorrespondesentarlasbasesparaunaadecuadayobjetivadecisindela
ComisinDisciplinaria.
Slo pueden declararse improcedentes aquellas pruebas que no puedan alterar la resolucin final del
procedimientooqueseandeimposiblerealizacin(art.244.3RP),peroestohayquejustificarlo.Eneste
sentido,sisedeclarenimprocedentesoinnecesariasalgunadelaspruebasseharconstarexpresamentepor
elInstructorenacuerdomotivado(SSTC2/1987,195/1995,181/1999,157/2000:recogenelderechoala
utilizacindelosmediospertinentesdepruebaparaladefensa;elderechoaladefensaresultavulnerado
cuandoelrechazodelapruebapropuestacarezcademotivacinoestaseaarbitrariaoirrazonable.eahque
lanegativaarealizaralgnmediodepruebasolicitadodebaquedardebidamentejustificada(vid SSTC
94/1992,179/1993,35/1997).
Hayquesaberqumotivossonlosqueelinstructorhatenidoencuentaparanorealizarlaspruebas,porque

sinohaquedadojustificadohayquehacerloconstarenunrecursodealzadaydespusdereformaalJuezde
Vigilancia,afindequesepractiquen.SielJuzgadodeVigilancianocontestaexpresamentealapeticinde
realizarlaspruebasquefuerondenegadasporlacrcel,olohaceconunareferenciagenricaalacuerdo
administrativo (instructor del expediente) en el que se exponga, hurfano de todo razonamiento y
argumentacin: "se deniegan las pruebas por considerar que su realizacin no aporta datos nuevos al
esclarecimientodeloshechos",sevulneraelderechoautilizarlosmediosdepruebaensudefensa(STC
81/2000de27demarzode2000).Inclusoenlaresolucinfinaldelprocedimiento
Hademantenerseunaactituddeclaraexigenciaenestamateria,ydemodoespecialenlorelativoala
prcticadepruebasdentrodelprocedimientosancionador,puesenestosmomentos,elgradodeexigencia
probatorio alcanzado en el proceso penal no se corresponde, ni con mucho, al que se observa en el
procedimiento disciplinario. En los expedientes disciplinarios es comn encontrar valoraciones sobre
elementosquenohansidomnimamenteexaminados(as,siseleocupaauninternounasustanciaouna
pastillaquesedicetxica,yportantoprohibida,noseprocede,enningncaso,noyaalanlisisdela
misma,queseraloadecuado,sinoquenisiquieraseincorporauninformemdicodelacrcelqueseale
qutipodesustanciaes,culessusefectosenelorganismo,osielinternoestabaautorizadoasuposesin).
Enmateriadepruebasonabsolutamenteaplicableslasexigenciasdequestaseaobtenidaregularmente,es
decir,quesuaportacinalprocesosehayaproducidodemaneralegalyconrespetodelosprincipiosy
garantasestablecidos.Quesetratedeunaautnticaprueba,esdecir,quesupongalaexistenciadeundato
objetivo,valorable,obtenidoporrganoencargadodesuvaloracinpormediodeunaactividadqueleha
puestoencontactoinmediatoconl.Lapruebadelacargadelapruebanopuedetrasladarsealpresoen
ningncaso(SSTC86/1995,175/2000queestablecenentrelasgarantasaplicablesexart.24.2CEen
procedimientosancionadoresenelmbitopenitenciarioseencuentraelderechoalapresuncindeinocencia
quesuponenosololanecesidaddequelacargadelapruebadeloshechosconstitutivosdelainfraccin
recaigasobrelaadministracin,sinolaabsolutaprohibicindeutilizaryvalorarpruebasobtenidasmediando
lalesindeunderechofundamental.

31. Cundo se realiza el pliego de descargo?


Unavezpracticadaslaspruebasadmitidasseconcederunplazode10dashbilesparaquelapersona
presa,aquienhabrquecomunicartodoloactuado,puedaalegarloquequieraporescritooverbalmente
anteelinstructor.Paraello,elpresotienederechoatenertodoslosdocumentosdelexpedientesancionador,
locualnosesolucionaconlasimpleindicacindeloqueenlsecontiene,comosealalacircular21/96de
InstitucionesPenitenciarias,sinoquehadepermitirunadecuadoexamendeloquelointegra,talycomoha
precisadoelTribunalConstitucionalalsealarqueelconocimientodeladenunciahadefacilitarsealinterno
cuandosepretendausarcomoelementodeincriminacin.Hayquepedircopiadetodoslosdocumentosdel
expedientesancionador.Sisedeniega,hayquerecurriralJuezdeVigilanciapenitenciaria,enesemomento,
ocuandosedictelaresolucinporindefensinsolicitandolanulidaddetodoloactuado.
Setendrporrealizadoeltrmitedeaudienciasiantesdelvencimientodelplazoelpenadomanifiestasu
decisindenoefectuaralegacionesniaportarnuevosdocumentosojustificaciones(art.244.4RP).Sinose
ponedemanifiestoesteplazoalreclusolasactuacionessonnulas(AutoJVPdesevillade4denoviembrede
1997).
Cuandolapersonarecluidahayaformuladoelpliegodedescargosohayatranscurridoelplazoreglamentario
establecidoalefectosinsupresentacin,ycuandosehayanpracticadolaspruebaspertinentes,elinstructor
darporconcluidoelexpediente.Formularpropuestaderesolucinyloelevar,juntoconelexpediente,a
laComisindeDisciplinaparaquestaacuerdeloqueproceda.Sedeberentregarcopiadelapropuestaala
personapresaconindicacindesuderechoaalegarverbalmenteantelaComisin(art.245RP).
Ennuestraopinin,afindesalvaguardarelderechoadefensadelartculo24C.E.,sedeberaindicartambin
alpresoquepodraserasistidodeletradoparalaaudiencia.

32. Cmo rige el principio de presuncin de inocencia?


ElTribunalConstitucionalsehapronunciadoenmultituddeocasionessobreella,yhadejadosentadasunas
conclusionesquesonaplicablesatodoslosmbitos,nosloalpenal(STC13/1982,1deabril),yquepuede
resumirlosiguiente:
a)Esunautnticoderechoynounmeroprincipioinformador(STC13/1981,28dejulio;103/1985,4de
octubre;195/1986,21dejulio;1097/1986,24deseptiembre).
b)Comportalassiguientesexigencias:1)todacondenadebeirsiempreprecedidadeunaactividadprobatoria,
impidiendolacondenasinpruebas;2)laspruebastenidasencuentaparafundarladecisindecondenahande
merecertalconceptojurdico,yserconstitucionalmentelegtimas;y3)lacargadelapruebapesasobrelos
acusadores,noexistiendonuncacargadelacusadosobrelapruebadesuinocenciaonoparticipacindeloshechos
(SSTC66/1984,6dejunio;109/1986,24septiembre;124/1990,2dejulio;127/1990,5julio;161/1990,19de
octubre;165/1990,29deoctubre).

Especficamentereferidoalprocedimientosancionador,elTribunalConstitucionalhacontinuadoprecisando
laexigenciadeesamismagarantaenl.As,enlarecientesentencia83/1997,de22deabril,sesealaque
lasgarantasdelart.24.2sontrasladablesalprocedimientoadministrativosancionador,conlasmatizaciones
desupropianaturaleza.

33. Cmo se desarrolla la fase de resolucin?


La Comisin Disciplinaria, en la primera sesin ordinaria que se celebre o en sesin extraordinaria
convocadaalefecto,escucharlasalegacionesverbalesque,ensucaso,pudieraformularlapersonapresa.
Seguidamente adoptar el acuerdo de sobreseer el expediente o imponer motivadamente la sancin
correspondientealoshechosdeclaradosprobados.Elacuerdodeberdictarseenelplazomximodetres
mesesdesdelainiciacindelprocedimientodisciplinario(art.246.2RP).Siapartirdeesteplazo,nose
dictaseresolucinenlostreintadassiguientes,elprocedimientoseentendercaducadoyseprocederal
archivodelasactuacionessiemprequelademoranofueseimputablealinteresado(art.246.2.RP).
AntesdedictarresolucinlaComisinDisciplinariapodrdecidirlarealizacinporelinstructordelasactuaciones
ypruebascomplementariasindispensablespararesolverelprocedimiento.Enestecaso,antesdeelevardenuevoel
expedientealaComisinDisciplinaria,elinstructordeberponerenconocimientodelapersonapresaloactuadoy
leentregarcopiadelanuevapropuesta.
Ni el instructor, ni los miembros de la Comisin que han participado en los hechos o en actuaciones
determinantesparalainiciacindelexpediente,podrnparticiparenlasvotacionessobrelaresolucinde
expedientes(art.246.3RP).Esdealabaresteintentodebsquedadelaimparcialidadperoenocasioneslas
muestrasdecorporativismosontanevidentesquelaparcialidadpuedeserlatnicadominante.

34. Qu debe contener el acuerdo sancionador?


Elacuerdosancionadordebercontener:
a)Ellugarylafechadelacuerdo.
b)Elrganoqueloadopta.
c)Elnmerodeexpedientedisciplinarioybreveresumendelosactosprocedimientalesbsicosquelas
hayanprecedido.Debenhacerseconstaraqulaspruebaspracticadas,talescomo:testigosinterrogadosy
declaracindelosmismos,conespecialreferenciaalomanifestadoporelinternoexpedientado,yaseaen
pliegodedescargooenlacomparecencia.Nobastanfrmulasgenricasdeltipofrenteadichopliego
constestdeformaverbal...sinqueserecojansusmanifestaciones(AutodelJVPdeOviedode21demarzo
de 1994), pues en ese caso se sustrae al rgano jurisdiccional a quo la versin del inculpado, con
conculcacindelprincipiodecontradiccindenuestraConstitucinrecogidoensuart.24(AutodelJVPde
Oviedode11dejuniode1994).Enelcasodequesehayadesestimadolaprcticadealgunapruebadeber
expresarselamotivacinformuladaporelinstructorensumomento.Sinoexisteningunadiligenciade
pruebaquemerezcatalcalificacinej.labasedelasancinsereduceaunanotaopartesinfirmalesiona
elderechoalapresuncindeincoocenenciainocencia(STC97/1995de20dejunio).Demaneraqueenesta
materialapresuncindeinocenciagarantizaelderechoanosufrirsancinquenotengafundamentoenuna
previaactividadprobatoriasobrelacualelrganocompetentepuedafundamentarunjuiciorazonablede
culpabilidad(SSTC76/1990,138/1990,297/1993).
d) Relacin circunstanciada de los hechos imputados al interno, que no podrn ser distintos de los
consignadosenelpliegodecargosformuladoporelinstructor,conindependenciadequepuedavariarsu
calificacinjurdica.SilaComisinDisciplinariaconstatasequesehacalificadoerrneamentelaconducta
delpresuntoinfractoryelloimplicaselaimposicindeunasancinporfaltamsgravequelaquesehubiese
imputadoenelpliegodecargos,ordenaralinstructorlaformulacindeunnuevopliegodecargos.
e)Artculodelreglamentoyapartadodondeseestimacomprendidalafaltacometida.
f)Lasancinimpuestayelartculodelreglamentoquelacontemplaysilamismaesdeejecucin
inmediata.
g)Indicacindesilaejecucindelasancindeaislamientohasidoaplazadapormotivosmdicososeha
suspendidosuefectividad.
h)Indicacindesielacuerdosehatomadoporunanimidadopormayoraindicandoenestecasosiha
habidoonovotosparticulares.
i)Mencindelrecursoquepuedeinterponerse.
j)LafirmadelsecretariodelaComisindeDisciplinaconelvistobuenodelDirector.

35. Cundo y de qu forma ha de notificarse el acuerdo sancionador?


Lanotificacinalapersonasancionadadelacuerdosancionadordeberrealizarseenelmismodaoal
siguientedeseradoptado.Seledarlecturantegradeaqulyseleentregarcopiaquecontendrlos
siguientesextremos:
a)Textontegrodelacuerdo.

b)IndicacinquecontraelmismopuedeinterponerserecursoanteelJuezdeVigilancia,verbalmenteen
el mismo acto de la notificacin o por escrito dentro de los cinco das hbiles siguientes a la misma,
reproduciendo,ensucaso,elrecurrentelaproposicindeaquellaspruebascuyaprcticalehubiesesido
denegada.
c)Fechadelanotificacinyentregaalapersonapresa(art.248.c)RP).

36. Qu se puede hacer cuando la persona sancionada no est conforme con


la resolucin?
HabrquerecurriralJuezdeVigilancia.Sepedirlarealizacindelaspruebasquenoseadmitieron,se
alegarnlosmotivosporlosqueseestendesacuerdoconlaresolucinyaquellainfraccindelasnormas
procesalesquevienenestablecidasenelReglamento.Enesteltimocaso,elJuezdeVigilanciaenvade
recursodeberdeterminarlanulidaddelasactuacionesyelexpedientedeberserretrotradoallugaryal
tiempoenquesecometilainfraccin(vermodelonmero44).

37. Las sanciones recurridas al Juez de Vigilancia Penitenciaria se pueden


ejecutar antes de que aqul resuelva?
Cuandosehayaresueltoelprocedimientodisciplinarioyseacuerdelaimposicindeunasancin,statiene
queejecutarsedeformainmediataunavezquehayapasadoelplazodecincodashbilesparainterponer
recurso,salvoquehayainterpuestorecurso,oquesetratedesancionesdeaislamientodemsdecatorcedas.
Pero,apesardehaberrecurridoalJuzgadodeVigilancia,algunassancionespuedenejecutarsedirectamente
sinesperarqueelJuzgadoresuelvaelrecurso.EnestesentidoS.elartculo44.3LOGPestablecequela
interposicindeunrecursosuspenderlaefectividaddelasancin,salvocuandoportratarsedeunactode
indisciplinagravelacorreccinnopuedademorarse.LosJuecesdeVigilanciaensuscriteriosdeactuacin
(65 reunin enero 2003) recomiendan a la Administracin Penitenciaria que slo se ejecuten
excepcionalmente(art.252.2RPsupuestosdeindisciplinagrave)paragarantizarlaefectividaddelrecurso
yevitarlasconsecuenciasnegativasqueparaelinternosuponeelcumplimientodelasancindeforma
inmediata.Paraelloseaconsejaquelosrecursossepresentenensobreabiertooensucaso,indicandoquese
tratadelrecursocontralasancindisciplinaria.
ElReglamentoestablecequeseconsiderarnactosdeindisciplinagravealosefectosdelartculo44.3
LOGPlosseisprimerossupuestosdelartculo108delReglamentoPenitenciarioaprobadoporRealDecreto
1201/1981.
Quelacorreccinnopuedademorarseesunaterminologaquedejatotalarbitrariedadalaadministracin.
Laseguridadjurdicaquedavulnerada.Sedeberanjustificarlosmotivosporlosquelasancinseejecutasin
esperaraqueelJuzgadodeVigilanciaresuelvaelrecurso.Incluso,tendraqueserautorizadaporste.
Enelcasodelasancinseadeaislamientosuperiora14das,stanoseejecutar,enningncasohastaque
seaaprobadaporelJuezdeVigilanciaPenitenciaria.Estosignificaquelassancionessuperioresa14das
debenseraprobadasensutotalidad,ynoelexcesode14.Hastaquenoseproducelaaprobacinjudicial,la
sancinnoexistedesdeunpuntodevistajurdico(I19/96.)

38. Si se decreta la ejecucin inmediata de la sancin, se puede interponer


algn recurso?
S.UnodeQuejaanteelJuezdeVigilancia,conindependenciadelatramitacindelrecursointerpuesto.La
tramitacindeestosrecursostendrntramitacinpreferentecuandolasancindeejecucininmediataseala
deaislamientoencelda,encuyocasoseprocederasunotificacininmediataalJuezdeVigilancia(art.
252.3RP).
Hayqueexigirquesemotivelaurgenciaenlaaplicacindelasancin.

39. Qu normas procesales rigen en la tramitacin del recurso en el Juzgado


de Vigilancia?
LatramitacindelrecursoenelJuzgadodeVigilancianoseacogeaningunanormaprocesal.Existenunas
prevencionesdelTribunalSupremodirigidasalosJuecesdeVigilanciatraslaentradaenfuncionamientode
estosJuzgados.
Enellas,seplasmancomoprincipiosbsicoslasumariedad,laproporcionalidaddelostrmites,elrespetoa
las garantas procesales bsicas e inherentes a toda actividad procesal, proscripcin de la indefensin,
derechoaladefensayasistencialetradayaserinformadodelgravamenquesuponeparaelreclusola
medida fiscalizada, publicidad adecuada, no dilaciones indebidas y, adopcin de medios de prueba
pertinentes. Se garantizarnlos principios de contradiccin e inmediacin. La audiencia al interno y el
informedelaadministracinsontrmitesimprescindibles.

Ahorabien,elrecursoanteelJuezdeVigilanciaesunverdaderoprocesojudicial.Eldesenvolvimiento
probatorioycognoscitivodelprocesoespleno,nodebiendoquedarlimitadoalaspruebascuyaprctica
hubiesesidodenegadaenelprocedimientoadministrativo(criterio69reuninJVPenero2003).

40. Las resoluciones judiciales tienen que estar fundamentadas?


Enocasiones,algunosJuzgadosdeVigilanciaresuelvenlosrecursoscontralasresolucionesdisciplinariasde
lacrcelpormediodeimpresospreviamenteconfeccionadosconunaargumentacingenrica:desestimar
losrecursospornodesvirtuarseloshechosimputadosalinternoopornohabersearticuladopruebaalguna
que motive la modificacin de la resolucin recurrida. El carcter impreso y estereotipado de las
resolucionesjudiciales,sinestaraconsejado,noimplicaunafaltaoinsuficienciadelamotivacin,pues
peticionesidnticaspuederecibirrespuestasidnticas,sinquelareiteracinenlafundamentacinsuponga
ausenciadesta.Hayqueestudiarcasoporcaso;deformaqueloesencialesqueseaposibleconocercules
hansidoloscriteriosjurdicosesencialesdeladecisin(SSTC196/1996,39/1997,67/2000,128/2003de30
dejunio).EnestaltimasentenciaseotorgaelamparoporquelaresolucindelJuzgadodeVigilancia
respondi con dos autos estereotipados, siendo dos meros impresos que no responden a las complejas
cuestiones suscitadas por el demandante en sus escritos, ni resuelven las alegaciones sustanciales del
recurrente.
Seexigequedelconjuntodelosrazonamientoscontenidosenlaresolucinpuedadeducirserazonablemente
nosloqueelrganojudicialhavaloradolapretensindeducidasinoademslosmotivosfundamentadotes
delarespuestatcita.Delocontrarioseincurreenelincongruenciaomisivaquegeneralavulneracindel
derechoalatutelajudicialefectiva(SSTC20/1982,175/1990,83/1998,74/1999,672000y53/2001,26/1997:
En todo caso la resolucin tiene que ser expresa, pues todo motivo de recurso atinente a un derecho
fundamentalrequiereunarespuestaexpresa,locualseacentaenelcasodesancionesapresosyaque
cualquiersancinsuponeunarestriccinalayarestringidalibertadyademsporqueunesencialdeber
incumbealosJVPenlasalvaguardadelosderechosdelosinternos(SSTC34/1997,39/1997,153/1998,
74/1985,83/1997,181/1999,53/2001,143/1997,69/1998,9/2003de20deenero).
CuandonoexistaresolucinexpresadelJuez,onoestperfectamentemotivada,onosevalorenlaspruebas,ono
respondasobrelascuestionesplanteadasenelrecurso estoocurra,hayquerecurrirenreformaanteelpropio
Juzgado,o,sisedesestimaenamparoalTribunalConstitucionalporvulneracindelderechoalatutelajudicial
efectiva. Las resoluciones judiciales tienen que justificar las razones jurdicas apreciadas para rechazar las
alegacionesdelrecurrenteysudistintaversindeloshechos(STC69/1998,de30demarzo).

41. Cul es el proceso a seguir para el enjuiciamiento de las faltas leves?


Sehaestablecidounprocedimientoabreviadoquedeberresolverseenelplazomximodeunmesdesde
queseinici,conarregloalassiguientesnormas:
a)Elpartedelfuncionario,queoperarcomopliegodecargos,secomunicaraljefedeserviciosy,
simultneamentesenotificaralpresuntoinfractor.
b)Enelplazodediezdas,apartirdelacomunicacinynotificacindelpliegodecargos,elJefede
Serviciosyelinternoefectuarnlaaportacindecuantasalegaciones,documentoseinformacionesestimen
convenientesy,ensucaso,laproposicinyprcticadelaprueba.
c)Transcurridodichoplazo,elDirectordictarresolucin,conelcontenidoexpresadoenelartculo247,
imponiendo,ensucaso,lasancinqueproceda(art.251RP).
Elacuerdoalqueserefiereelartculoanteriorsenotificaralosinteresadosparaqueenelplazodecinco
dashbilesaleguenyproponganpruebassiloestimanconveniente.

42. En qu casos se puede conceder una recompensa y qu tipos existen?


ElsistemaderecompensasseregulaenlaInstruccin8/99yenelReglamentoPenitenciario(arts202a206)
y tiene como fundamento ms importante la desaparicin de la redencin de penas por el trabajo, la
incorporacindeladelantamientodelalibertadcondicionalalas2/3partesdelacondena,laposibilidadde
restaralas2/3partestresmesesporaoefectivamentecumplidoapartirdelamitaddelacondena(ver
captulo de la libertad condicional), la posibilidad de que la Junta de tratamiento solicite del Juez de
Vigilancialatramitacindeunindultoparticular,enlacuantaqueaconsejenlascircunstancias,paraquelos
penadosenlosqueconcurran,demodocontinuadoduranteuntiempomnimodedosaosyenungrado
que se pueda calificar de extraordinario: buena conducta, desempeo de actividades laborales y de
reeducacinsocial(art.203RP).

Lasrecompensasseconcedenporactosquepongandemanifiestobuenaconducta,espritudetrabajoy
sentidodelaresponsabilidadenelcomportamientodelaspersonaspresas,ascomolaparticipacinpositiva
enlasactividadesasociativasreglamentariasodeotrotipoqueseorganicenenlacrcel.Lasrecompensas
pueden ser: comunicaciones especiales y extraordinarias; becas de estudio, donacin de libros y otros
instrumentos de participacin en las actividades culturales y recreativas del Centro; prioridad en la
participacin de salidas programadas para la realizacin de actividades culturales; reducciones de las
sancionesimpuestas;premiosenmetlico;notasmeritorias;cualquierotrarecompensadecarcteranlogoa
lasanterioresquenoresulteincompatibleconlospreceptosreglamentarios(art.263RP)..
Seestableceelcrditocomounidadhomologadaparavalorarlaparticipacinyrendimientodelosinternos
encadaunadelasactividades.Laequivalenciatericaesdeuncrditoporcadacuarentahorasdeactividad,
incluyendohorasdededicacinyestudio,laidoneidaddelaactividadparalareinsercinsocial,conjuntode
la oferta disponible encada momento, la penosidad o especial dificultad de latarea, su inters para el
beneficio comn del establecimiento. No se recogern valores inferiores a un ao. Se pueden valorar
diferentesactividadesconvalorinferiorauncrditoparapoderllegarasuobtencin.Conelfindedara
conoceralosinternoslaofertadeactividades(formativas,culturales,deportivas,laborales,teraputicas)se
harnpblicosencadaunodelosmdulosodepartamentosdelacrcellosaspectosdeintersdelas
actividades.Cuandoacabecadaactividadocadatresmeseslosprofesionalesdirectosdecadaactividad
presentarnlas correspondientesrelaciones enlas queseacreditalaparticipacinen cada actividad.El
Equipo tcnico elaborar la propuesta de aprobacin de los crditos y se lo propondr a la Junta de
Tratamientoparasuaprobacin.Elnmerodecrditosotorgablescadatrimestrenopuedesersuperiora
doceyloquesobrenosepuedenreservarparaotrotrimestre.Sialgncrditonohallegadoalas40horasy
portantonosevalorecomotal,puedesercomplementadoenelsiguientetrimestreconotrasactividades.Si
haytrasladoaotraprisinseguarda.
PorltimolaJuntadeTratamientoalavistadeloscrditoscertificadosporlosinternosyteniendoencuenta
suscaractersticas,condicioneseinteresespersonalesformularalaComisinDisciplinariaunapropuestade
recompensas.Cadarecompensaexigiralmenostrescrditos,aunquelacomisindisciplinariavalorarlas
sancioneseneltrimestreporsiesprecisonoconcederlasrecompensas.Unavezaprobadasseaprobarnen
elexpediente.Demaneraqueapesardequeexistanrealmenteloscrditosobtenidosnoessuficientepara
quelaComisinDisciplinariaadjudiquealgunasdelasrecompensasprevistasenelart.263RPsinoque
exigeunavaloracinposteriorenfuncindelassancionesquehayatenido(AutoAPAlbacetede4.2.2002).

Captulo 9

REDENCIN DE PENAS POR EL TRABAJO

(CONLAENTRADAENVIGORDELCDIGOPENALDE1995TODALAREGULACINLEGALSOBRELA
REDENCINQUEDDEROGADA;Y,COMOENELNUEVOCDIGOHADESAPARECIDOLAFIGURADE
LA REDENCIN, TODAS LAS PERSONAS QUE SEAN JUZGADAS CON ARREGLO A LA ACTUAL
LEGISLACIN PENAL NO TENDRN DERECHO A REDIMIR. NO OBSTANTE, TODAS AQUELLAS
PERSONAS QUE HAYAN SIDO CONDENADAS POR EL CDIGO ANTERIOR PODRN ACOGERSE AL
DERECHOAOBTENER REDENCINSALVOENLOS CASOS ENLOS QUE SUS SENTENCIAS SEAN O
HAYANSIDOREVISADASYADAPTADASALNUEVOCDIGOPENAL).

1. Qu es la redencin de penas por el trabajo?


Setratadeunderechodelapersonapresaconsistenteenlareduccindeltiempodelacondenasiempreque
secumplanlosrequisitosestablecidosenlaley.Cuandolapersonalosrena,laJuntadeRgimendelCentro
Penitenciario deber elevar la correspondiente propuesta al Juez de Vigilancia Penitenciaria para su
aprobacin.

2. Dnde viene regulada la redencin de penas por el trabajo?


Laredencindepenasseencuentrareguladaenelartculo100delCdigoPenalderogadoyenlosartculos
65a73delReglamentodelosServiciosdePrisionesde2defebrerode1956(modificadosporRealDecreto
de 29 de julio de 1977 y declarados vigentes por la disposicin transitoria segunda del Reglamento
Penitenciariode8demayode1981).Estasnormashanquedadoderogadas,perosondeaplicacinalas
personasquehayansidocondenadasporelCdigoPenalde1973.

3. Qu requisitos hacen falta para la concesin de la redencin de penas?


a)Lapersonapresadebeestarcumpliendounapenadeprivacindelibertadporrazndedelito(reclusin,
prisinoarrestomayordelartculo100,CP1973).Elartculo67delReglamentode1956consideratambin
incluidaslaspenasqueresultenreducidascomoconsecuenciadelaconcesindeunindulto.SegnlaOrden
Ministerialde6defebrerode1956laredencinafectaenlamismaproporcinalaspenasaccesorias.
b)Queestrealizandounaactividadlaboral.

4. Con qu clases de trabajos se puede redimir?


Conformealartculo68delReglamentode1956,aefectosderedencin,eltrabajodelospenadospodrser
retribuidoogratuito,intelectualomanualdentrodelosestablecimientosofueradeellosperoentodocaso
habrdeserdenaturalezatil.
Laadministracinpenitenciarianopuedeproporcionaratodoslospresosuntrabajotil.Porellohaoptado,
afindeevitarunperjuicioaaquellosquequisierantrabajaryredimir,porconsiderartrabajoaefectosde
redencinaunaseriedeactividadesnolaborablesynoproductivas.As,porejemplo:actividadesculturales
ointelectuales,eldesempeodedestinososerviciosdecarcterauxiliaroeventual,ascomoactividadesde
contribucinalbuenorden,limpiezaehigienedelestablecimientoqueconstituyanprestacionespersonales
detodaslospresos.Enalgunasprisiones,porelhechoderealizarlostrabajosdelimpiezaseaplicala
redencinordinaria(AutoJVPCastillaLen1de25dejuliode1996;AutoAP62/98APLugode5de
febrerode1998).Enotraselcriterioeselcontrario.
La redencin de penas por esfuerzo intelectual puede obtenerse por cursar y aprobar las enseanzas
religiosasyculturalesestablecidasyorganizadasporelCentroDirectivo;porperteneceralasagrupaciones
artsticas,literariasocientficasdelestablecimientopenitenciario;pordesempeardestinosintelectuales,y
porlarealizacindeproduccinoriginal,artstica,literariaocientfica(art.72RSP).Estasactividades
puedendarlugaralasredencionesextraordinarias(AutoJVPBadajozde11dejuliode1997).

5. Qu clases de redencin existen?


Laordinariaylaextraordinaria.

6. En qu consiste la redencin ordinaria?


Eslaredencinqueseotorgaporrazndetrabajo.Elartculo100CP1973estableceunmdulofijodeun
daderedencinporcadadosdetrabajo.Lgicamente,eldadetrabajonocomprendelas24horas,sino
queserefierealajornadalaboral.Conlaaplicacindeestaredencinlacondenade365daspuede
obtenerunaredencinde182das.
Lashorasextraordinariasylasactividadesquenoserigenporunajornadafija,comosonlasactividadesde
destinoylostrabajosdecarctereventualyauxiliarsecomputarnaefectosderedencin,porelnmerode
horasquelajornadalegaldeltrabajoconstituya(art.71.1RSP1956)
Lacrcelnopuededardestinoatodoslosquequisieran.Porello,laredencinordinariaseconcede,en
principio,atodoslospresos.Esladenominada,entrminoscarcelarios,redencindepatio.Lasolicitala
Junta de Rgimen al Juez de Vigilancia Penitenciaria. En caso de dilacin, el preso la puede pedir
directamente(modelonmero47.ay48).

7. En qu consiste la redencin extraordinaria?


El artculo 71.3 del Reglamento de los Servicios de Prisiones de 1956 considera redenciones
extraordinarias, compatibles con la regulada en el Cdigo Penal de 1973, a las que se otorguen
discrecionalmenteporraznalascircunstanciasespecialesdelaboriosidad,disciplinayrendimientoenel
trabajoqueapropuestadelaJuntadeRgimenpuedanconcederse.Sedebeaplicaraunqueelpenadotenga
uncomportamientoirregulareneltrabajoquedesempea.Entodocasodeberaquedarjustificadoporparte
delaadministracinpenitenciariaenqueconsisteesecomportamientoirregular(Auto1190/98APMadrid
seccin5de19deoctubrede1998).Encualquiercaso,laadministracinpenitenciariaoeljuzgadode
vigilancia, en caso de recurso, deben valorar, tras las comprobaciones oportunas, las circunstancias de
laboriosidad,disciplinayrendimiento;nopudiendonegarselasredencionesextraordinariasconafirmaciones
genricas, sin objetivacin, de la no concurrencia de aquellas caractersticas (Auto AP 5 Madrid de
22.10.2001).Comoestasredencionescarecendecoberturalegalesnecesarioquesevalorenindividualmente
conarregloaloscriteriosexpresadosanteriormentesinquepuedallegarahacerseporCircularesdelaDGIP,
pues estas no son vinculantes para el Poder Judicial, salvo que se entiendan nicamente como mera
orientacinalajuntasdeTratamiento,sinningntipodeautomatismo(AutoAPHuescade29.3.2001).
LosJuecesdeVigilanciaentiendenquelaaplicacindelasredencionesextraordinariasexigenlosmismos
requisitosquelasredencionesordinariasysontambinaplicablesapresospreventivos.Elcontroldela
concesinodenegacindelasredencionesextraordinarias,cuandodenoteabusodederechoodesviacinde
poder,competealosJuecesdeVigilancia(criterionmero46,JVP).
Lavaloracindelosmritosextraordinariosendasabonableses,comohemosdicho,discrecional,conel
lmitedeunoporcadadadetrabajoy175dasporcadaaodecumplimientoefectivodelapena(artculo
71.3RSP).Sinembargo,porrazonesmuyexcepcionales,sepuedenconcedermsdas(hasta75alao)por
lascausasestablecidasenelartculo71.2RSP.

8. Existe el derecho a las redenciones extraordinarias aprobadas por


resolucin firme aunque sea posterior al 25 de mayo de 1996?
S.Ellmiteparalaconcesinderedenciones(hastael25demayode1996) establecidoporelTribunal
Supremonopuedeoperarcuandolasredencioneshansidoaprobadasconcarcterdefinitivoporresolucin
judicialfirme.
Porestecarcterlasredencionesaprobadasseintegranenelllamado"patrimoniopenitenciario"delinterno
debiendoproducirelconsiguienteefectodereducirlapenatotal.Cuestindistintaserasiesasredenciones
nohubieransidoaprobadasosilaaprobacinhubiesequedadocondicionadaalanoaplicacindelCPde
1995(Auto1469/98APMadridde11dediciembrede1998).Siaunapersonaleapruebanredenciones
extraordinariasapartirdel25demayode1996,seledebenrespetarporqueformanpartedelpatrimonio
penitenciariodelpreso(Auto94/99APMadridseccin5de28deenerode1999).
En ocasiones se puede llegar a plantear por parte del centro penitenciario que para la concesin de
redenciones extraordinarias habra que completar el perodo mnimo de 15 das de desempeo de los
destinos.Estonoeslegal,porquenoexisteningunanormaqueestablezcauntiempomnimodedesempeo
deltrabajoparaquesepuedanaplicarlasredenciones.Entodocaso,lacrcelpuedeponerunperodode
pruebahastaasignardefinitivamenteeldestino,perosiconcurrenlascondicionesdelaboriosidad,disciplina
y rendimiento en el trabajo, aunque el desempeo sea inferior a 15 das, se tienen que abonar las
correspondientesredencionesextraordinarias(Auto911/99APMadridseccin5de20dejuniode1999).

-Se pueden anular una redenciones ya aprobadas por el Juzgado de vigilancia


penitenciaria?
No.siunJuzgadohaaprobadounnmeroconcretoderedenciones,aunqueluegosedemuestrequeenesos
perodosestabaimposibilitadopararedimir,yanosepuedenanular.Lasresolucionesjudicialesadquierenfirmeza
denointerponersecontraellasrecursoalgunoentiempoyformaporpartedelossujetoslegitimados.Ellosignifica
queunautodeunJuezdeVigilanciaPenitenciariaenelquesehayaabonadoundeterminadobeneficioaunpreso,
sinorecurridoentiempoyformaporelfiscaloelpropioletrado,seconvierteenfirmeeinvariable(AutodeAP2
Cdizde12.10.2000).Dichodeotraforma,enarasalrespetoalprincipiodeseguridadjurdicaylainterdiccinde
laarbitrariedad,noesposibleque,enelsenodelasrelacionesdesujecinespecial,laadministracinpenitenciaria
reconozcaunosderechospenitenciarios,logrequeestosseanautorizadosporelJuezdeVigilancia,pasandoasa
formarparte"delpatrimoniopenitenciario"delpenado,yluegoantesoalmismotiempopretendanegarlos
alegandoquesuconcesineradefectuosa(AutoAPCdizde21.3.2002).

-Ante que Juzgado de Vigilancia Penitenciaria hay que reclamar el abono de


redenciones ordinarias o extraordinarias atrasadas?
ElJuezdeVigilanciadellugarenquesehalleelCentroPenitenciarioenqueserealizaronlostrabajos,estudioso
actividadesenqueelinteresadobasasureclamacinynodellugardelcentroenqueseencuentrecuandoelevela
queja(Criterio2reuninJVPenero2003),porqueaqulesmsadecuadoporrazonesdeinmediacin,objetividad
ymejorconocimientodeloscriteriosparalaconcesindelasredencionesextraordinariasaplicadasenlacrcelen
quepermanecielinternoqueinterponelaquejaenelperodoenquepresumiblementesegeneraronredenciones
reclamadas.

9. Pueden redimir los presos preventivos?


S.Aesterespectoelart.100CP1973establecequelaredencinesaplicable,aefectosdeliquidacinde
condena,alosreclusosquehayanestadoenprisinpreventiva.Paraello,unavezqueseafirmelasentencia
condenatoria,laredencinobtenidadurantelaprisinpreventiva,puedeserabonadasidurantelamismase
hubiesenreunidolosrequisitosnecesarios(modelonmero47.b).

10. Se puede redimir durante el cumplimiento de los arrestos sustitutorios por


impago de multa?
S.Elarrestosustitutorioencasodeimpagodemulta,alparticipardelanaturalezadelaspenasprivativasde
libertad(art.35CP1995)tambinpuedeserobjetoderedencin(criteriodeactuacindelosJuecesde
Vigilancianmero58).

11. Se puede redimir con independencia del grado en el que se est


clasificado?
S. Pueden redimir todas las personas presas independientemente del grado de tratamiento en que se
encuentrenclasificadas.

12. Tiene derecho a redencin ordinaria/extraordinaria quien est destinado


en un centro de rgimen abierto?
SibienelReglamentodelosServiciosdePrisionesexigequeeltrabajorealizadofueradelaprisinpueda
ser desarrollado en destacamentos penitenciarios, tanto la Ley Orgnica General Penitenciaria como el
Reglamento Penitenciario, normas posteriores al Reglamento de los Servicios de Prisiones y de rango
superioraste,permiten(art.188RP)laposibilidaddequelosinternosenrgimenabiertorealicentrabajos
porsistemadecontratacinordinariaenempresaslibres.Asimismo,losartculos27.1LOGPy185.1RP
1981 prevn que los internos realicen su trabajo dentro o fuera de los establecimientos; finalmente, los
artculos210y105RP81posibilitanlaconcesinderecompensasporelrendimientoeneltrabajo(artculo
105a)RP1981),entrelasquecabeconcederbeneficiospenitenciarios.
Enconsecuencia,lasnormaspenitenciariassealadas(LOGPyRP)nocontienenningunareferenciaala
necesidaddequelostrabajosseprestenendestacamentospenitenciarios,loqueimplicalaposibilidaddeque
laactividadlaboralserealiceporelsistemadecontratacinordinariaconempresaslibres.Porlotanto,las
normasdelaLOGPyRPdebenprevalecersobreelReglamentodePrisionesalosefectosderedencin.

Deestamaneraseposibilitalaaplicacinderedencin(tantolaordinariacomoextraordinaria)poreltrabajo
prestadoendichasempresas.Enconclusin,locaractersticodelarelacinlaboralpenitenciariasederiva
msquedellugardecumplimiento,delaespecialrelacinquetieneelinternoconelempleadoryladeaqul
con la administracin penitenciaria Entre la prestacin intra y extrapenitenciaria no median diferencias
sustancialesqueimpidanelreconocimientodelosefectosextralegemquesederivandelaredencinde
penas,ydelosquesonacreedoresenrgimendeigualdadlostitularesdeambassituacionesjurdicas(Auto
JVPTenerifede4.09.00).
EstaredencinhayquesolicitarlaalaJuntadeRgimen,aportandotodoslosdatosdelaempresayrelacin
laboral.SirechazalapeticinhayqueinterponerunrecursodeQuejaanteelJuezdeVigilancia.Siste
tampocoaccedealosolicitadohayqueinterponerunRecursodeReformaanteelJuzgadodeVigilanciay
posteriormente,sisevuelveadenegarlosolicitado,hayqueformalizarunRecursodeApelacinantela
AudienciaProvincial(modelosnmeros49y50).

13. Se puede redimir en libertad condicional?


Entendemosquesporlossiguientesmotivos:
a)Lalibertadcondicionalestemporalmentelaltimafasedelaejecucinpenal.Noexistediscusin,ni
doctrinalnilegalacercadequelalibertadcondicionalesunafasedecumplimientodelacondena.Aesterespecto,
el artculo 74 LOGP establece que las penas privativas de libertad se ejecutarn segn el sistema de
individualizacincientfica,separadoengrados,elltimodeloscualessereldelibertadcondicionalsegn
determinaelCdigoPenal.Porello,ladoctrinanohadudadoenllamaralalibertadcondicionalcuartogrado
porloque,habiendoalcanzadoste,hayqueentenderqueelpenadotendrlosmismosderechosquelasdems
personascondenadasqueseencuentrenenlosrestantesgradosdecumplimientodelapena.
b)Elart.100delCP1973recogenicamentedoscasosenlosquenosepodrredimirpenaporeltrabajo,
ningunodeloscualeseso,serefiere,alasituacindelibertadcondicional.
c)Simediantelaprestacindetrabajodentrodeprisinsepretendequelapersonapresapuedareducirla
duracin del cumplimiento de la condena (redencin de penas), no cabe restringir este beneficio
exclusivamentealaposibilidaddepoderadelantarlalibertadcondicional,extinguindoseenesemomentoel
derechoquerecogeelart.100CP1973,sinoquelafinalidaddelmismosehadeextenderacualquierventaja
quepuedaobtenerelpenadoenordenaunefectivocumplimientoanticipadodelacondena,puesdeotro
modo se encontrara en peor situacin respecto de aquellos otros presos a quienes, por cualquier
circunstancia,noleshayasidoconcedidolaposibilidaddecumplirenlibertadlaltimafasedelapena(Auto
AP5Madrid361/1997de2deabrilde1997).
d) Dentro de nuestro sistema penitenciario el trabajo es considerado un elemento fundamental del
tratamiento(art.26LOGP).Porello,eltrabajoquesedesarrolladuranteelcumplimientodelalibertad
condicional(fasedeejecucindelacondenaennuestrosistemaprogresivodeindividualizacincientfica),
debeserconsideradocomopenitenciario.
e)Otracuestinesladiscusinsobresieltrabajorealizadofueradeprisinesonopenitenciario.Ya
hemos explicado anteriormente que el Reglamento de Servicios de Prisiones exige para que el trabajo
realizadofueradelaprisinseaconsideradopenitenciarioquestedebaserdesarrolladoendestacamentos
penitenciarios.Noobstante,tantolaLeyGeneralPenitenciariacomoelReglamentoPenitenciario,normas
posterioresambasalReglamentodelosServiciosdePrisionesyderangosuperioraste,reconocenenlos
artculos27.1LOGPy185RPde1981,laposibilidaddequelosinternosrealicentrabajoporsistemade
contratacinordinariadeempresaslibres,tantodentrocomofueradelosestablecimientospenitenciarios.
Asimismo,losartculos210y105RPposibilitanlaconcesinderecompensasporelrendimientoenel
trabajoentrelosqueseencuentra(art.105a)RP)laconcesindebeneficiospenitenciarios.Porello,nohay
ningnobstculolegalparaquelaredencinordinariayextraordinariapuedaseraplicadaduranteelperodo
delibertadcondicional(AutoAP5Madrid,de2deabrilde1997).
f)Algunadiscusinofrecelacuestinqueserefierealtrminoreclusos,entendindoseporstos,
solamentelosqueseencuentranenlacrcel,ynolosliberados;perodesdeunaperspectivaamplia,recluso
esquiensehayacondenadoapenasprivativasdelibertad,raznporlaqueelpropiocdigonecesitaba
individualizarquenoatodosellossinosloalosquelofueranapenasdereclusin,prisinoarrestomayor
(AutodeAP5de16dejuliode1998y5demayode1998).
g)Lacircular2/1992delaDireccindeServiciosPenitenciariosdelaGeneralidaddeCataluaestablece
laposibilidadderedencindurantelalibertadcondicional.
h) La concesinde redencinpara quien trabaja durante la libertad condicional supone dar un trato
diferenciadopositivorespectodequiennotrabaja,debidoaqueenningncasoelnotrabajarsuponela
revocacin(Auto495/98APMadridde5demayode1998).
HayquesolicitarlaredencinalJuezdeVigilanciaPenitenciariaaportandocopiadelcontratodetrabajoy
de todas las nminas que acrediten la actividad laboral. Si se deniega, hay que interponer Recurso de
ReformaySubsidiariodeApelacin;posteriormentealTribunalConstitucional(modelosnmeros51y52).

14. Se puede redimir cuando la pena se cumpla en un centro de rehabilitacin


de drogodependencias?
S.Sielpenadoestcumpliendopenasprivativasdelibertadenunacomunidadteraputicatienederechoaquese
leapliquenlasredenciones.Noestrascendenteaestosefectosquedichopreceptohabledereclusos.Decualquier
modo,elpenadoseencuentrarecluidoenuncentroextrapenitenciario.Paralaconcesinelcentrodebeinformar
sobrelaconducta,lastareasysumotivacinalrespecto(AutoJVPdeCiudadRealde8deoctubrede1994).Es
ms, se ha llegado a plantear que no es necesario que se acredite el trabajo efectivo dentro del Centro de
rehabilitacin.Essuficienteconquenoexistaconstanciadequeelpenadohubieserechazadounapropuestadeese
tipoenaqullugar(AutoAP2deAlbacetede9demayode1995)(Modelonmero55).

15. Sobre qu pena se establece la redencin cuando se fija el lmite de


cumplimiento en treinta aos o cuando se aplica el artculo 76.1 CP 1995
(art. 70.2 CP 1973) para fijar el triple de la pena mxima?
Enloscasosdeconcursorealdedelitos(tantoshechoscomodelitossumadepenasimpuestas),lapena
quetienequeservirdepuntodereferenciaparalaaplicacindelosbeneficiospenitenciarioseslaresultante
deloscriteriosdeacumulacinqueseestablecenenlosartculos76CP1995(tripledelamayoro20,25
30aos).
Porejemplo,siaunapersonalacondenana7delitosde5aoscadauno,setienequeaplicarellmitede
cumplimientode20aossegnloestablecidoenelart.76.1CP1995.Laredencinseestablecesobrelos
veinteaos,ynosobrecadapenaenconcreto.

16. Puede redimir un penado que se encuentra internado en un


establecimiento psiquitrico en cumplimiento de una medida de seguridad?
S,cuandounapersonadespusdecumplidalamedidadeseguridadenunpsiquitricodebieracontinuar
cumpliendouna pena privativa de libertad en una crcel, se debe abonar el tiempo pasado en aquellos
establecimientosaefectosderedencindepenasporeltrabajocomosisetrataradeunaprisinpreventiva.
Todoellosedesprendedeunainterpretacinanalgicayextensivadelospreceptoscorrespondientes.

17. Cundo se suspende la redencin de penas por el trabajo?


Sesuspenderlaredencindepenassilapersonapresaseniegavoluntariamenteatrabajarosiseleimpone
unasancin.Noobstante,porimperativoreglamentario,laredencinnosesuspenderaunqueseinterrumpa
laactividadlaboralenlossiguientescasos:accidentedetrabajo,enfermedadlaboral,reclusasenperodode
gestacin, das festivos y das perdidos por fuerza mayor, destino a otro establecimiento o enfermedad
suficientementeacreditada(art.70RSP).
Porotrolado,elaislamientoenceldanointerrumpenecesariamenteelbeneficiodelaredencindepenaspor
eltrabajo,entantopersistanlascausasdeterminantesdesuconcesin(criterio48RJVP).
Lasuspensindurartantotiempocomosemantenganlassituacionesindicadas.Noesnecesario,encasode
sancindisciplinaria,esperaralarehabilitacindelamismaparavolveraredimir.Solamentesesuspenderdurante
elcumplimientoefectivo.

18. Cundo se pierde la redencin de penas por el trabajo?


Elderechoaredimirsepierdecuandoelpenadorealiceunintentodeevasin,consigaonosupropsito,y
cuandoreiteradamenteobservemalaconductaduranteelcumplimientodelacondena.Seentendermala
conductasielpenadocometieranuevafaltagraveomuygravesinhaberobtenidolainvalidacindelas
anteriores,conformealartculo116RSPde2defebrerode1986.Peronoessuficientequeenelacuerdode
bajaderedencinsealudaa"lasmltiplessancionesgravesymuygraves",sinoquedebeconstarlaentidad
delasfaltas,hechosquelasmotivaron,lasfechasenquefueroncometidas,sihansidoonocanceladasy
cuando, si los acuerdos sancionadores fueron recurridos y la resolucin final de stos (Autos 1282/98,
133/99,229/99y396/00APMadridseccin5).
Enelprimercaso,lapersonaquedarinhabilitadapararedimireltiempoquelequedeporcumplirdela
causaquehubiesequebrantado;enelsegundo,podrserrehabilitadounavezquelehayasidoinvalidadade
suexpedientelaanotacindelafalta(art.73RSP).
Ahorabien,enelcasodequebrantamiento,losJuecesdeVigilanciahanaadidodosprecisionesensus
criteriosdeactuacin:
a)Seexigeladeclaracindeestenuevodelitoensentenciafirme(criterio49RJVP).
b) La incapacidad para redimir o la prdida de redencin de penas deber referirse nicamente a la
condenaquebrantadaconindependenciadequeenlamismacausaosumariosehayanimpuestoalpenado
otrascondenas.

Enstasspodrserrehabilitadopararedimirunavezextinguidalacondenaquebrantadaoporaplicacin
delartculo118delCdigoPenal(criterio50RJVP).

19.Puede darse de baja en redencin a una persona cuando no se le


notific el acuerdo de baja?
Labajaenredencionesdebeserpropuestarazonadamenteporelcentropenitenciarioyacordada,tambin
razonadamente,porelJuezdeVigilancia,enbasealdebergeneraldemotivarlasresolucionesjudiciales(art.
120.3CE)yalmandatolegalalJuezdeVigilanciadehacercumplirlapenaimpuestaconlasmodificaciones
quepuedaexperimentaryaprobarlaspropuestasquepuedansuponerunacortamientodelacondena,adems
esa resolucin debe hacerse al interno para que pueda recurrir en apelacin (AUTO AP 5 Madrid de
29.6.2001).Porello,silaresolucinjudicialdebajanofuenotificadaalapersonapresa(noconsta),sele
deben abonar esos das, porque se gener una situacin de indefensin proscrita en el art. 24 de la
Constitucindebidoaquelaresolucinjudicialdebajaenredencinesrestrictivadederechos(AutoJVP1
deMadridde22dejulioy7deseptiembrede1998,Autos1075/99,229/99APMadridseccin5,AutoJVP
CastillaLende17denoviembrede1998)(AutoJVPSevillade13demarzode1998).
Sepuedepedirquevuelvanaconcederlasredencionesretiradassisedemuestraquenosenotificlabajaen
redencin.Paraellohayquepediralaoficinadergimenlosperodosquealolargodelacondenaseha
estado con la redencin cortada; y posteriormente hacer una queja al juez de vigilancia solicitando
informacinacercasisehaemitidoresolucinjudicialdebajaystahasidonotificada.Lanotificacinexige
queelinternolahayafirmadoyquesehayanotificado,puespuedeocurrirquelaresolucindebajano
exista,oqueexistaperoquenosehayanotificado,encuyocasopuedenotificarseyapartirdeesemomento
seabreelplazodeimpugnacindelamisma,sinperjuiciodelosefectosqueeltranscursodeltiempohaya
podidoproducirenordenalaconstatacindelaexistenciadelasfaltas,eincluso,enordenalainvalidacin
delassanciones(AutoAP5Madridde29.6.2001).Noimportaquehayanpasadovariosaos;sepuedepedir
cuandosequiera.
Noessuficienteconquesehayanotificadoelacuerdosancionador,sino,eljudicialdebajaenredencin
(AutoJVPNavarrade7deoctubrede1998,19defebreroy4demarzode1999yAutoJVPBurgosa9de
diciembrede1998).(Modelonmero47.c).

20.Puede denegarse la redencin a pesar de haber realizado una trabajo


porque falta la propuesta de destino?
No. Si una persona ha estado trabajando, por ejemplo en el economato, y as se puede probar por la
declaracindeotrospresosydelospropiosfuncionariosquelopermitieron,noselepuedeprivardel
derechoaredimirporunerror,sinoqueseletienepremiarconlosbeneficiosdeltrabajorealizado(Auto
1130/98APMadridSeccin5de10denoviembrede1998).

21. Puede perderse el derecho a obtener redenciones por haber intentado la


fuga cuando se estaba en prisin provisional?
No.ElCdigoPenalde1973,recogelossupuestosalosqueseaplicalaredencinytambinlossupuestosenlos
quesepierde.Asenelprrafo2delart.100CP1973seestablecequenopodrnredimirpenaporeltrabajo
quienesquebrantencondenaointentasenquebrantarlaaunquenolograsensupropsito.EsclaroqueelCdigo
Penalestablecaquelosbeneficiariospodansertantoloscondenadoscomolospreventivos,perolosqueperdanel
beneficiosloeranlosquequebrantasenlacondena.Elconceptodecondenaesjurdicamenteinseparabledelde
sentenciacondenatoriafirme.Demaneraque,aquiennoselehayacondenadoporsentenciafirme,noselepuede
privardelaredencinaunquesefugueestandoenprisinpreventiva.
Delamismamanera,elCdigoPenalde1973sealadentrodelLibroIIelrtulodelquebrantamientode
condenaydelaevasindepresos,y,porsinofuerasuficienteclaraladistincin,establecaacontinuacin
lossentenciadosopresosquequebrantaransucondena,prisin,conduccinocustodiaserncastigados
a...loqueremarcabaqueestedelitopodacometerseporpresossentenciados,porpresosnosentenciados,y
hastapordetenidos.CuandoelCdigoPenalensuartculo100haqueridodecirquelaprdidadelbeneficio
deredencinlasufriranlosquequebrantasenlacondena,esesoloquehadichosinextenderelsupuestode
prdidaalospresospreventivos.
AigualconclusinsellegaenelanlisisdelRSPque,entodocaso,seranuloporelprincipiodejerarqua
normativasiseopusieraenestamateriaaunaleycomoelCdigoPenal.Sibienelartculo73serefiere
genricamentealosquerealicenintentodeevasin(loquepodaincluiralospresospreventivos),esclaro
queeseartculoseencuentraenlaseccinterceradelcaptulosptimoqueseiniciaenelart.65conuna
declaracin de conformidad con el art. 100 del entonces vigente Cdigo Penal, y que se refiere
sistemticamenteaquepuedenredimirloscondenadosdesdequeseafirmesusentencia(art.65.1)odesde
suresolucinfirme(art.65.2)yqueanticipndosealart.73RSPestablecequenopodrnredimir(art.65.3
A)quienesquebrantarencondenaointentasenquebrantarla.

Refirindosecontinuamentealospenadosynoalospreventivosenlosarts.67,68,70,71,72.Enotras
palabrastampocoelcitadoReglamentoprevlaposibilidaddequelospresospreventivospierdanelderecho
aredencinparalapenaquemstardeseleimpongaenunacausa.
De todoello se deduce que el intentode evasin tiene siempre consecuencias penales, lo protagonicen
penadosopresospreventivos.Ahorabien,slotieneconsecuenciaspenitenciariassiloprotagonizanlos
penados(Auto214/1998AP5Madrid214/1998de24defebrero,664/1998de29demayoy657/98de28de
mayode1998).

22. Supone el quebrantamiento de condena la prdida retroactiva de la


redencin obtenida durante la condena que se est cumpliendo?
Elproblemaresideensabersisepuedenrevocarlosdasderedencinyaconcedidosporeltiempoquese
llevecumpliendounacondenaqueposteriormentesequebranta.
Entendemosqueno.Elartculo73delRSPdicetextualmente:cuandorealiceintentodeevasin,consigao
nosupropsito.Enestecasoquedarinhabilitadopararedimirenlosucesivo.Laletradeesteartculo
constituyeunaprevisindefuturoynounasancindeprdidadedasredimidos(AutoJVPAlicante26de
octubrede1994).Enestemismosentido,elAutodelJuzgadodeVigilanciadeCastillaLende8deoctubre
de1991hasealadoquenosedeberdardebajaenredencinporquebrantamientodecondenahastaqueno
existaunasentenciafirmequeaslodeclare.Apartirdeesemomentosepodrdardebajadesdeeldaen
quesequebrantlacondena.
Igualmente,laSentenciadelTribunalConstitucionalde30deoctubrede1989sealaquelaprdidade
redencinnopuedetenerefectoretroactivodesdeelprincipiodelacondenaquebrantada,sinodesdeelda
enqueseproduceelquebrantamientoporquelaredencinconstituyecumplimientodecondenayste,como
formadeextincindelaresponsabilidadcriminal,noescondicionadosinoabsolutoy,porello,irreversiblea
menosqueconcurralarenunciaexpresadelbeneficiario.

23. Qu ocurre si el penado quebranta una condena que est refundida con
otras?
Enestoscasoslosjueceshacenunadistincin.

a)Porunladosisetratadeunalimitacindepenasdelart.76.1CP1995lajurisprudenciaestdividida.
Vamosaofrecerlasdosposicionesmantenidas:
Cuandoseaplicaelart.76CP1995(70.2CP1973)seestablecequeelmximodecumplimiento
delacondenanoexcedadeltriplodelamayorode20,25,30aos,declarandoextinguidaslasque
procedandesdelasqueyaimpuestascubrandichomximo.
Laaplicacindeestepreceptonogeneraunanuevacondena,sinoqueestablecesimplementeunmximode
cumplimiento de las penas impuestas manteniendo stas su individualidad a excepcin de aquella pena
durantelacualsealcanzaesetopelegalylassiguientes;setratadeuncumplimientosucesivohastaunlmite
(20,2530aos)llegadoelcual,lasnocumplidasquesonlasrestantes,quedanextinguidas.Porello,sise
produceunquebrantamientodelapenaquesehallabacumpliendoenelmomentodelaevasin,yquese
halleintegradaenestelmitemximodebeentendersequelaprdidadelaredencinseproduceenlapena
quesehallabacumpliendo,ynoenlaresultantedelaaplicacindellmitedel76,puesentalcasopodra
suponerunperjuicioparaelcondenado,loqueestpensadoensubeneficio(AutoJVPdeBilbaode31de
diciembrede1987).Paralocualhayquedeterminarqupenaestabacumplindose;unavezcumplidala
mismasinredencin,sevuelvealcumplimientodelasrestantesnuevamenterefundidasconbaseenlos
criteriosart.76CP.
Paraotrapartedeladoctrina,lacondenaresultantedelaaplicacindelart.76.1CP1995(20aosotriplede
lamxima)esunanicacondena,enlaquelasdemspierdensuautonoma,y,porello,siaquellase
quebranta,yanosepodrredimirduranteeltiempoquequedeporcumplirhastalos20,2530aos.
Noobstante,paraestoscasos,sepuedeplantearunasolucin:sielcmputodelacondenaquerestede
cumplimiento(apulso,sinredencin)esmsperjudicialqueelcumplimientoindividualdelascondenas
sinlalimitacindelart.76.2CPhabraquesolicitaralJuzgadooTribunalquerealizlalimitacindepenas
delart.76.2CPquedicteAutoporelquesedeshagalarefundicinysevuelvaalasituacinanterior,para
quedeestamanerasepuedaredimirentodaslascausasaexcepcindelaquebrantada.
Tambin podra solicitarse una nueva limitacin del art. 76.2. CP en la que no se incluya la causa
quebrantada(situacinsimilarseresolvienelAutodeJVPdeSevillade21dejuliode1987enelquese
excluyelacondenaquebrantadadelaacumulacin(art.76.2CP)realizadaporlaAPdeGranadaparapoder
determinarlapenaquetienequecumplirconredencin).
En conclusin, como ya hemos justificado anteriormente ni la letra ni el espritu del artculo 76.1 CP
permitenafirmarqueseestanteunanuevapena,distintaporlotanto,ynoanteunlmitemximodetiempo
deprivacindelibertad.
Siestamosanteunanormaquetiendeafavoreceralpenadolimitandoelcumplimientodelacondenano

puedeprovocarefectoscontraste.Bastapensarquesilaprdidadelasredencionesalcanzaraatodoel
tiempodeprivacindelibertadannotranscurridopenaanpendientepodraocurrirquelaaplicacindel
art.76.1CPleperjudicara(AutoAP5Madrid147/1998de12defebrero).
b)Cuandosetratadecondenasrefundidas(enlazadas)aefectosdelibertadcondicional(art.193.2RP),es
obligacindelaprisinrealizarlosclculosnecesariosparadeterminarenquemomentodelcumplimientodela
condenaseprodujoelquebrantamientoointentodelamisma.
Unavezdelimitadalacondenayparadeterminarlafechahastalacualnosepuedevolveraredimir,seutiliza
lahiptesisdequeelpenadopuedeconseguirlalibertadcondicionalenesacondena.Esdecir,losclculos
paradeterminareltiempoduranteelquenosepuederedimirseefectansobrelastrescuartaspartesdela
condena quebrantada que estaba cumpliendo. Una vez alcanzada las tres cuartas partes de esa condena
quebrantada hay que volver a proponer la aplicacin del beneficio en el cumplimiento del resto de las
condenas.

24. Se puede redimir de forma extraordinaria estando dado de baja en forma


ordinaria?
Larespuestaaesteproblemanoespacfica.Labajaenredencionesordinariasporcausasdisciplinariasopor
quebrantamientodecondenanollevaautomticamentealadesaparicindelasredencionesextraordinarias.
Ambasredencionestienedistintanaturaleza(Auto295/99APMadridseccin5de4demarzode1999;
AutoJVPCastillaLamanchanum1de5deoctubrede1998).
Laordinariaseconcedepormotivodetrabajo.Laextraordinariaseasimilamsalafiguradelarecompensa
delosartculos46LOGP,105y106RPde1981.Parafundamentarestaafirmacinnosbasamosenlos
siguientesargumentos:
a) Acudiendo a criterios de interpretacin gramatical, los trminos utilizados en la definicin de
recompensa(artculo46LOGP)yderedencinextraordinaria(artculo71.3LOGP)sonanlogos.Aeste
respecto,elartculo46establece:losactosqueponganderelievebuenaconducta,espritudetrabajoy
sentidodelaresponsabilidadenelcomportamientopersonal...serestimuladoporalgunadelassiguientes
recompensas:....Porotraparte,elartculo71.3estableceque:lasredencionesextraordinariasseconcedern
enrazndecircunstanciasespecialesdelaboriosidad,disciplinayrendimientoeneltrabajo.
b) La condicin de recompensa se ajusta ms al principio de individualizacin cientfica, porque se
puedenconcederdependiendodesuinters,colaboracineneltratamiento(eltrabajoespartedel),la
laboriosidad,labuenaconducta,etc.
c)Lanicaformadesalvarlainfraccindelprincipiodejerarquanormativa(art.9.3CE)queseorigina
conlaexistenciaderedencionesextraordinariasalquedarmodificadoporvadeReglamentolodispuestoen
elartculo100delCdigoPenal1973,esotorgndoleslanaturalezaderecompensas.
Porello,sisehaproducidounaprdidaderedencinordinaria,nohayimpedimentolegalalgunoparaquese
pueda continuar aplicando la redencin extraordinaria. En este mismo sentido, el Auto del Juzgado de
VigilanciaPenitenciariadeCastillaLennm.1de2dejuniode1992yelAutoAP5Madrid322/1997de
20demarzo(modelosnmeros53y54).NoobstantesonpocoslosJuzgadosdeVigilanciaPenitenciariaque
loentiendenas.
Apesardelodicho,siexistemalaconductareiteradalasrecompensas(redencionesextraordinarias)pueden
noconcederseporquevanencontradelsentidolegaldelarecompensa(Auto295/99APMadridseccin5
de4demarzode1999).
En caso de fuga, consumada o intentada, no se pierde el derecho a la redencin extraordinaria (Autos
1493/98,169/99,456/99deAPMadridseccin5).

25. Se pueden denegar las redenciones extraordinarias por la realizacin de


actividades en base a la gravedad del delito cometido?
No.Enalgunasprisionesadeterminadospresosleshandenegadolasredencionesextraordinariasporqueel
delitoporelquefueroncondenadoseramuygrave.Pero,aunenestoscasos,siserealizaunaactividad
dentrodeprisinqueparalageneralidaddelosreclusoslespermitelaobtencindedasderedencin
extraordinaria,enningncasoselespuededenegaraunospresosdeterminadosenbasealdelitocometido.
Silainfraccindeldeberdetrabajarpuedellevaraparejadaunasancin,elejerciciodelderechoaltrabajoy
elcumplimientodeldeberhandetenerlarecompensaquelegalmenteseestablece.Losestmulosexternos
paraeldesempeoduranteuntiempobreveolargodedichotrabajonopuedenserexclusivamentenegativos
sancinporincumplimientosinotambin,yprimordialmentepositivosrecompensaporcumplimiento
(Autos428/1998,de23deabril;422/1998,de17deabrily726/1998de10dejunio,deAPMadridseccin
5).

26.Se puede conceder redencin a las personas que hayan estado en


prisin preventiva en otros pases?
S,siemprequeseacrediteconuninformedelcentropenitenciarioextranjeroenelqueestuvoingresadoque
realizdestinosotrabajos.Paraquesepuedanconcederlasredencionesextraordinariasdelastareasquese
presentensedebedesprenderdelasmismasqueserealizaronencondicionesdelaboriosidad,disciplinay
rendimiento.HayquesolicitarlaredencinatravsdeunescritodirigidoalaJuntadeTratamientoparaque
lasapruebeelJuezdevigilanciapenitenciaria(AutodeBadajozde19dejuliode1999,14deseptiembrede
1998,23dejuliode1999).
AlavistadelConvenioEuropeosobretrasladodepersonascondenadasde1993noparecequeexista
inconvenientedequeseapruebenlasredencionesmencionadas:a)enelartculo9.3sesealaqueel
cumplimientodelacondenaseregirporlaLeydelEstadodecumplimiento;esdecir,laespaolaque
reconocalasredencionesenelCPde1973ylalegislacinpenitenciaria;b)Enelart.12delConvenio
sedicequecadaPartepodrconcederamnista,indultoyannocontemplandolaredencin,comoes
lgicoalserunainstitucinpeculiarespaola,lociertoesquepuedeestablecerseunaciertaanaloga
con el indulto pues si bien no son equiparables por su naturaleza jurdica, formalidades, rgano
competente,tienelaconsecuenciaidnticadeacortarpena(AutoJVPACoruade9demayode
1997);c)Ellugardondesepresteeltrabajoesindiferentepuesseestreconociendoelderechoa
redimiralosinternadosencentrospsiquitricoscuandoterminanelcumplimientodelapenaeinician
elcumplimientosubsiguientedelapena,comosisetratasedeprisinpreventiva.Delamismaforma
seentiendeparalospenadosqueseencuentranprestandotrabajosenelexterior(rgimenabiertoo
libertadcondicionalCircular2/1992delaGeneralitatdeCatalua).Deloquesededucequeellugar
deprestacindeltrabajoaefectosderedencinesindiferente,llegandoalaconclusindequeel
trabajorealizadoenprisionesextranjerastambinpuedesercomputadoaefectosderedencin(Autos
JVPMlagade30deoctubrede1996y18deabrilde1997).Noobstanteexistenotrasresoluciones
judicialesquerechazanestaposibilidad.Otras,queelreclusoacreditequetieneredencionesobtenidas
durantelaprisinpreventiva,oquepropongalosmediosdepruebaparaello,puesdeacreditarsesu
cmputoparalaextincindelapenanoescontrarioalcumplimientodelrestodelamismaconformea
lalegislacinespaolaysignificarasimplementequeelrestoesdemenorextensin(AutoAPMadrid
de2.06.00)

Captulo 10

CACHEOS PERSONALES Y REGISTROS EN LAS CELDAS

1. Qu es un cacheo personal?
Es unacto destinado a descubrir sila persona presa oculta en su cuerpo o, entre sus ropas, sustancias
prohibidasuobjetospeligrosos.

2. Pueden realizarse cacheos personales?


S,siempreycuandosecumplanunosrequisitosmnimosalpracticarlosyexistaunajustificacinclarapara
hacerlos.Loscacheossonunmedioparadescubriralgnobjetoprohibidoquelleveelpreso,perosuprctica
nuncapuedeconsistirenunasancinencubierta.

3.Qu derechos fundamentales puede quedar afectados por un cacheo?


Elderechoalaintimidadpersonalconsagradoenel18.1.Sevinculaalapersonalidadydelsederivael
derechoaladignidadqueelart.10CEreconoce.Laintimidadpersonalentraaconstitucionalmentela
existencia de un mbito propio y reservado frente a la accin y el conocimiento de los dems que es
necesario para mantener una calidad de vida mnima en la vida humana (SSTC 231/1988; 179/1991;
20/1992). De la intimidad personal forma parte, segn tiene declarado el Tribunal Constitucional, la
intimidad corporal, de principio inmune en las relaciones jurdicopblicas, frente a toda indagacin o
pesquisaquesobreelpropiocuerpoquisieraimponersecontralavoluntaddelapersona.Deestaforma
queda protegido por el ordenamiento jurdico el sentimiento de pudor personal, en tanto responda a
estimacionesycriteriosarraigadosenlaculturadelapropiacomunidad(STC37/1989,120/1990,137/1990).
ElTribunalConstitucionaltambinhapuestoderelievequelasconsecuenciasmsdolorosasdelaprdidade
lalibertadeslareduccindelaintimidaddelosquesufrenprivacindelibertad,puesquedanexpuestasal
pblicomuchasactuacionesqueseconsideran ntimasoprivadas.Noimpidequesepuedanconsiderar
ilegtimasaquellasmedidasquereduzcanmsalldeloquelaordenadavidaenprisinrequiere(STC
89/1987).

4. En qu casos pueden realizarse los cacheos?


Legalmente, los cacheos slo estn justificados cuando concurran motivos de seguridad concretos y
especficos,ycuandoexistanrazonesindividualesycontrastadasquehaganpensarquelapersonapresa
ocultaensucuerpoalgnobjetopeligrosooalgunasustanciaquepuedacausardaoalasaludoala
integridad fsica de las personas, o que sea capaz de alterar el buen orden/convivencia del Centro
Penitenciario(art.68.2RP).
Delanormareglamentariasededuceclaramentelosiguiente:
a)Ladecisindepracticaruncacheonopuedetomarsedeunamaneraarbitraria,caprichosa,nideforma
sistemtica.Debehacerseconmotivacinsuficienteyurgentenecesidad(AutoJVPdeMlagade13de
enerode1994,4denoviembrede1993y7defebrerode1994).Adems,entodocaso,esnecesariohacer
unavaloracinentrelagravedadquesuponeelataquealaintimidaddelapersonapresa,ysielcacheoes
imprescindibleparaasegurarladefensadelinterspblicoqueinteresaproteger(AutoJVPdeCastillaylen
de29dejuliode1997).Aesterespecto,elAutomencionadosealaque:"loscacheoscondesnudointegral
podrnrealizarseenlasentradasysalidasalexteriordelaprisin,peronocuandosetratedesalidaso
entradasdentrodelmdulodentrodeotrosdepartamentosdelcentropenitenciariocomoelpatio,locutorios,
oficinasetc.Tampocopodrnrealizarseestetipodecacheoscuandolafinalidaddelmismoseaencontrar
instrumentosmetlicosporquesesospechequeseposeanporunosinternosoporladesaparicinentalleres
encuyocaso,seutilizarnarcosyraquetas".
b)Elmotivodelcacheodebejustificarseanteeldirector(tambindeberaexigirseanteJuezdeVigilancia
Penitenciaria)encadacasoconcreto,ascomosuformaderealizacin,(STC57/1994,de28febrero,Autos
delJVPdeSoriade15demayode1994ydelJVPdeCiudadRealde30demayode1994).
As,porejemplo,nopodrconsiderarsejustificacinsuficienteparalarealizacindeuncacheolasimple
alegacindequeenlageneralidaddelasprisioneslascomunicacionesntimassonelmediohabitualpara

quelosinternosrecibandesdeelexteriorobjetospeligrososoestupefacientes,yaquetalafirmacintieneun
carcterpuramentegenrico(STC57/1994).Esajustificacintienequequedarclaraenelescritoquerealice
elfuncionarioaldirector.Sinoserecogenlosmotivosconcretoseindividualesquemotivaronlaprcticadel
cacheo,stesernulo(autoJVPCastillaLaManchade11demarzode1997).Enestemismosentido,el
AutodelJVPdeMadridnm.1de29deabrilde1994querecogeestacuestinalsealarque:...enmateria
delimitacionesaunderechofundamentallainterpretacinhadehacersesiempreconcarcterrestrictivo.En
elcasodeloscacheosexigequeexistanindiciososospechasdequeelinternopuedaesconderalgnobjeto
prohibidoensuspartesntimas;sloenestecasopodrnautorizarseestetipodecacheosintegrales,perono
comoformahabitualdadoelsentidorestrictivoindicadoporelTribunalSupremo....
Aestosefectos, segnelart.68.5RPlosfuncionariosquerealizaronelcacheodeberndirigirunparte
escritoalJefedeServicios,especificandoloscacheoscondesnudointegralefectuados.
RespectodelanecesidaddequeloscacheoscondesnudointegralsejustifiquenymotivenlasSSTC218/02
de25.11/2002y204/2000,de24dejuliosonmuyclarificadoras.Loshechosqueanalizansonlossiguientes:
Alsalirsenegaterminardeefectuarelcacheoyquitarseloscalzoncillosanoserpresenciadeljefede
servicios,apesardequestenosepersonenellugar,elinternoacabaccediendoaloqueseordenaba.La
ordendecacheocarecadetodamotivacin.Elinternorealizsusalegacionesendescargoysolicitcomo
pruebauncareoconelfuncionarioactuante.Sinpracticarlaprueba,laComisinDisciplinarialesancion
conprivacindepaseosdehasta15das.Elinternorecurri,yelJVPnum.2solicitlanormadergimen
interior en virtud de la cual se fundamentaba el cacheo integral tras el vis a vis. Tras sucesivos
requerimientos,elCPaportactadelasesincelebradaporsuconsejodedireccinde24.3.97,enlaquese
recoga entre otros acuerdos,elde sometera los internos acacheo con desnudo integral despusde la
celebracindecomunicacionesntimasyfamiliares.ElJVP2estimelacuerdocomofundamentodela
medida,aadiendoquenovulnerelderechoaladefensaalnegarlemotivadamentelapruebapropuesta.
Enestecasoesciertoquelamedidafueadoptadaenelmarcodelarelacindesujecinespecialquevincula
alsolicitantedeamparoconaladministracinpenitenciariayquestahadevelarporelordenylaseguridad
del centro penitenciario. Pero, pese a la naturaleza de la relaciones jurdicas que se establecen con la
Administracin,losinternosconservantodoslosderechosreconocidosalosciudadanosporlasnormasde
nuestroordenamiento,conexcepcin,obviamente,deaquellosincompatiblesconelobjetodeladetencin,o
elcumplimientodelacondena;yquelaactuacinpenitenciariasedeberllevaracaborespetandoentodo
caso,lapersonalidadhumanadelosrecluidosylosderechoseinteresesdelosmismosnoafectadosporla
condena(art.3LOGP),entrelosquelalegislacinpenitenciariagarantizaeldelaintimidadpersonaldelos
internos.Deotraparteesindudablequeunamedidaderegistropersonaldelosreclusospuedeconstituiren
determinadas situaciones un medio necesario para la proteccin de la seguridad y el orden de un
establecimientopenitenciario.Yentalessituacionessehallaciertamentelasamenazasdelordeninternoyla
seguridaddelCP,comohareconocidolaComisinEuropeadeDerechosHumanos(decisinde15demayo
de1990,casoMcFeelyotros),aldeclararproporcionadaalafinalidadperseguidaunamedidaderegistro
similaralaaquimpugnada.
Ahorabiennoessuficientealegarlaproteccindeinteresespblicos,sinoqueesprecisoponerlaenrelacin
conelderechoalaintimidad.Exigeponderaradecuadayequilibradamentelagravedaddelaintromisinen
laintimidadysilamedidaesimprescindibleparaasegurarladefensadelinterspblicoquesepretende
proteger. Ellorequiere la fundamentacinde la medida por parte de la Administracin penitenciaria y
posteriormentequelosrganosjudicialespuedancontrolarlaraznquelojustifique,ajuiciodelaautoridad
penitenciariayatendidaslascircunstanciasdelcaso,elsacrificiodelderechofundamental.
Hayqueaadirqueelart.71.1RPprescribequelasmedidasdeseguridadseregirnporlosprincipiosde
necesidadyproporcionalidadysellevarnacaboconelrespetodebidoaladignidadyalosderechos
fundamentales, especialmente las que se practiquen directamente sobre las personas. Ante la opcin de
utilizarmediosdeigualeficaciasedarpreferenciaalosdecarcterelectrnicoconcretandoelart.68por
motivosdeseguridadconcretosyespecficos,cuandoexistanrazonesindividualizadasycontrastadasque
haganpensarqueelinternoocultaensucuerpoalgnobjetopeligrosososustanciasusceptibledecausar
daoalasaludointegridadfsicadelaspersonasodealterarlaseguridadoconvivenciaordenadadel
establecimiento,sepodrrealizarcacheocondesnudointegralconautorizacindeljefedeservicios.Yen
estecaso,faltatodamencindeseguridad.NosehaalegadoporelcentropenitenciarioMadridIVuna
situacinqueporssolaentraaseunaamenazaparasubuenordenquehicieranecesarialamedidaaqu
discutida,nitampocoqueelcomportamientodelahorademandantedeamparopudieragenerarlafundada
sospechaoindiciosseriosdequesetratasedeintroducirenelcentropenitenciarioobjetososustanciasque
pudieranponerenpeligrolaseguridadolaconvivenciaordenadaenelestablecimientoyserdeaadirque

enelexpedientepersonaldelactornoconstabalaexistenciadesancionesfirmesporinfraccionesgraveso
muygraves. NocabelaexpresindelJuzgadodevigilanciaenelsentidode quepuedeconsiderarse
justificacin suficiente de la medida la simple alegacin de que en la generalidad de las prisiones las
comunicaciones ntimas son el medio habitual para que los internos reciban desde el exterior objetos
peligrososoestupefacientes;yaquesinentraracuestionarlacertezadetalafirmacinbastarepararqueslo
poseeuncarctergenrico, cuandolorelevantesera alos fines dejustificar unamedidaquelimita el
derechoconstitucionalreconocidoenelart.18.1CEes,porelcontrario,quesehubieraconstatadoporla
administracin. penitenciaria que tal medida era necesaria para velar por el orden y la seguridad del
establecimiento,enatencinalaconcretasituacindesteoelpreviocomportamientodelrecluso(STC
57/1994,de28defebrero).
c)Debenexistirsospechasfundadasyconcretasdequesevaaintroducirunasustanciaprohibida,pero
nunca se puede hacer por razones de prevencin general (sobre determinados grupos como medio de
disuasindedeterminadasconductas)AutodelJVPGranadade31dejuliode1995.
d)Loscacheossepodrnpracticarcuandonoquedeotravaderegistroysehayanutilizadopreviamente
todoslosmediosalternativosposibles,talescomoelarcoolaraquetadetectorademetales,losrayosX
siempreycuandosuusonoperjudiquelasaludyconcontrolmdico(AutodelJVPdeBadajoz,28de
septiembrede1989).TantolosRayosXcomolaecografaserealizarnbajolasupervisindelEquipo
Mdico, abstenindose de hacerlas por la fuerza y contra la voluntad del interno. Para su prctica es
necesariamotivacinsuficienteynecesidadurgente,ascomoautorizacinjudicialpreviayconsentimiento
delresponsablesanitario,entregandoalinternounresguardodehaberserealizadounaplaca(STC35/96,de
11demarzo,AutosdelJVPdeMlagade4denoviembrede1993;13deenerode1994y7defebrerode
1994).
Laecografaesunmtodototalmenteinocuoparalapersonapresa(AutodelJVPdeMadridde29dde
noviembrede1989).Sinembargodebemosplantearnos,comolohaceelJVPnm.1deMadridensuAuto
de13dejuniode1991,siunasituacindeterminadatienelagravedadsuficientecomoparapermitirla
utilizacindeestetipoderegistrosqueconstituyenunatentadocontralaintimidaddelaspersonas.
Ahorabien,loquenosejustificaeslaobligacindeacudiralcacheocondesnudointegralporquelos
aparatosmecnicosestnaveriados.Ladoctrinasealaque,enningncaso,habrajustificacinaquelos
reclusosviesenrestringidossusderechosacausadedeficienciasmaterialesdelestablecimientoenquese
encuentraningresados.Enelmismosentido,elAutodelJVPdeMlagade15demarzode1994sealaque
esresponsabilidaddelaAdministracinPenitenciariaqueambosinstrumentos(eldetectorylaraqueta)se
encuentrenenperfectoestadodefuncionamiento.

5. Quin puede ordenar los cacheos?


Paralaprcticadeuncacheoesnecesarioqueexistalaautorizacindeljefedeservicios(art.68.2RP).Sin
embargo,enloscacheoscondesnudointegraldeberasernecesarialaautorizacindelaautoridadjudicial
porqueloqueestenjuegoeslavulneracindederechosgarantizadosporlaConstitucin:laintimidadyla
dignidad.
EnestesentidosemanifiestaelautodelJVPdeCastillaLennm.1de21defebrerode1990:slopor
decisinjudicial,quehabrquepreverquesuejecucinsearespetuosaconladignidaddelapersonayno
constitutivadetratodegradante,podrdisponersetalafectacindelaintimidadcorporal.Aesterespecto,si
se efecta la bsqueda de un objeto determinado que puede hallarse en las axilas, muslos, antebrazos,
genitalescabrauncacheointegral,siempreconelconsentimientodelapersonapresayautorizacinjudicial
(aunqueesterequisitoenlaprcticanosetieneencuentaporpartedelosfuncionarios).
Los Jueces de Vigilancia Penitenciaria han establecido en sus criterios de actuacin que se "inste a la
DireccinGeneralaaunquepormediodeunaInstruccinserequieraalasdireccindelasprisionespara
queseprocedaadarcuentaalosJuecesdeVigilanciapenitenciariadeloscacheoscondesnudointegral
practicadosalosinternos(Criterio59),conelobjetodetutelarlosderechosfundamentalesyrealizarel
controldelalegalidadenlaactividadpenitenciaria.DeestaformaelJuzgadodeVigilanciapodrexaminar
lospresupuestosdenecesidad,idoneidadyproporcionalidaddelamedidaacordada.

6. Quin puede practicar los cacheos?


Un nmero mnimo de funcionarios del mismo sexo que la persona cacheada, preservando, en todo lo
posible,laintimidad(art.68.3RP).

7. Quines pueden ser sometidos a cacheos?


Cualquierpersonapresa,yaquenilaLeynielReglamentohacenreferenciaaposiblesexcepciones.Sin
embargonosotrospensamosquetalesexcepcionesdebenexistir.Talseraelcasodemujeresgestantesoque
acabendetenerunbeb,ascomocuandoelpresoseencuentregravementeenfermo.

8. En qu lugar deben practicarse?


Enunahabitacincerradayseparadaoenunlugarapartadodelavistadeterceraspersonas(art.68.3RP).
Sedebehabilitar,portanto,unahabitacinaestosefectos(AutodelJVPnm.2deMadridde29deenerode
1991).Elmotivodeestaprivacidadesqueeldesnudointegralantepersonasdesconocidas,ascuandonose
realiceenunlugarpblico,creaenlapersonaquelosufreunasensacindeenvilecimientoquebienpodra
serconsideradocomotratohumillanteovejatorio(AutodelJVPdeSevillade20defebrerode1990).

9. De qu forma deben realizarse?


Segnel art.23LOGPloscacheos...se efectuarn en los casos, conlas garantas yperiodicidad que
reglamentariamente se determine y dentro del respeto a la dignidad de la persona, y nunca con
menosprecioparalaestimaque,encuantoserhumano,merecelapersona(STC120/1990,F.J.4,de27de
junio).
Debernrealizarsedelaformamenosgravosayvejatoriaparaelpreso,respetandosiempresuintimidaden
esa situacin concreta puesto que no existen reglas generales. En los cacheos debern tenerse en
consideracinlassiguientespautas:
a)Nuncapodrnrealizarseporlafuerza.ElTribunalConstitucionalestajanteensuST37/1989de15de
febreroalestablecerquecualquierintentodellevaracabounamedidacomolapropuesta,contralavoluntaddel
sujetopasivoymedianteelempleodelafuerzafsicaseradegradanteycontrapuestoalart.15delaConstitucin.
b)Loscacheosnodebenimplicardesnudezintegral.Porelloseofreceralpreso(enelsupuestode
quenohayasidoofrecidopreviamente)unaprenda,bata,manta,osimilarparaquelecubra(vid.entreotros
AutodelJVPnm.3deMadridde27dediciembrede1993yJVPMlaga13deenerode1994).Esel
propiopresoquientienequedesnudarseparaqueelcacheonoafecteasudignidad(AutodelJVPnm.3de
Madridde29denoviembrede1989).Comohemosdichoanteriormente,estamedidasepracticarenuna
habitacinytraselcacheodelaceldaentrarelinternoysaldrelfuncionariocerrandolapuerta.Enel
interior,elinternosedesnudarysepondrlabata,traslocualentrarelfuncionarioycachearlaropa;a
continuacinsaldrelfuncionariocerrandolapuertaparaqueelinternosevista(AutodelJVPnm.2de
Madridde29deenerode1991).Deahquelaprcticadeloscacheosyregistrosenmodoalgunopueden
suponeralinternountratovejatorio,denigranteycontrarioalaintimidadpersonal,comoesordenarleque
sedesnudetotalmenteyobligarlearealizarflexionesdemodoreiterado(STC57/1994).
c)Nocabelaposibilidadderealizarelcacheoporpalpacinnianconlabatapuesta.Asserecoge
enelAutodelJVPdeOcaade1defebrerode1995yaquepuedeafectaraladignidaddelaspersonasaun
cuandonollegueaconstituiruntratoinhumanoodegradante.
Laobligacindepracticarvariasflexionesacrecientalaquiebradelaintimidadcorporalquelamisma
situacindedesnudezprovoca,alexhibiroexponerelcuerpoenmovimiento.ElAutodelJVPdeMlagade
13deenerode1994requierealosfuncionariosqueseabstengandeexigirflexionesconlaspiernasalos
internos.Encualquiercaso,yconlabatapuesta,elnmerodeflexionesdebesermnimoenelsupuestode
quefuera necesarioytotalmente imprescindible(STC57/1994). Ensentido contrario, ycon unamayor
sensibilidadporelrespetoalosderechosfundamentalessemuestraelTribunalSupremo,queenlasentencia
de17defebrerode1999haestablecidoqueunaprueba(pequeacantidaddedroga)obtenidamedianteel
procedimientodeordenaralaacusada,detenidaenunadependenciajudicial,quesedesnudarayefectuase
flexiones,abriendoycerrandolaspiernas,hastaquecayalsuelounpequeoenvoltorioconteniendodos
gramos de herona que guardaba en su vagina, es nula de pleno derecho porque dicho procedimiento
constituyeuntratodegradanteconstitucionalmenteprohibido(art.15.1CE)STSde11demayode1996y26
dejuniode1998.Porotraparte,elart.11LOPJdisponeque:"entodotipodeprocedimientosnosurtirn
efectoslaspruebasobtenidas,directaoindirectamenteviolandolosderechosolibertadesfundamentales.La
prohibicindelapruebaconstitucionalmenteilcitaydesuefectoreflejopretendeotorgarelmximode
proteccinalosderechosfundamentalesconstitucionalmentegarantizadosy,almismotiempo,ejercerun
efectodisuasordeconductasanticonstitucionalesenlosagentesencargadosdelainvestigacincriminal.
Es evidente que si esta prctica en la realizacin de cacheos est constitucionalmente prohibida por el
ordenamientojurdicoespaol,nopuedeadquirirelcarcterdeconstitucionalporelhechodequelapersona
cacheadaseencuentreenuncentropenitenciario,pueselloequivaldraasealarquelarelacindesujecin
especialconcedealaadministracincarcelariaelprivilegioderealizarprcticasinconstitucionales.
AesterespectoelTribunalConstitucionalsealaque"lasituacindesujecinespecialdelinternoenun
establecimientopenitenciarionopuedeimplicarlaeliminacindesusderechosfundamentaleseimpedirque
lajusticiasedetengaenlapuertadelasprisiones(STC143/1995de3deoctubreySTC39/1997de27de

febrero).
Si los cacheos con desnudo integral no se realizan con las cautelas anteriormente reseadas hay que
interponerunaQuejaalJuezdeVigilanciapenitenciaria(modelosnmero56.ay66).Unavezquesedeclare
nuloporelJuzgadodeVigilanciaPenitenciariahayquesolicitarunaindemnizacinalMinisteriodelInterior
pordaosmoralesenelplazodeunao(modelonmero56.b).SielMinisteriolodenegasehayquepedir
abogadoyprocuradordeturnodeoficioparainterponerrecursocontenciosoadministrativoenlaAudiencia
Nacional.

10. Qu ocurre cuando el preso incumple la orden de desnudarse?


Cuandoseobligueaunapersonapresaadesnudarsentegramenteencontradesuvoluntadexpresa,seest
afectandoalmbitoreservadodesuintimidadydignidadpersonal(arts.10y18delaConstitucin),porloqueel
incumplimientodelasrdenesdadasalrespectoporlosfuncionariosnopuedecalificarsecomodesobediencia
disciplinaria(AutodelJVPdeZaragozade11deseptiembrede1990;AutodelJVPdePamplonade26deabrilde
1994).Asimismo,elAutodelJVPdeZaragozade18deenerode1994...establecequeexisteunacausade
justificacinqueexoneraderesponsabilidadpordesobedienciacuandoesasrdenesnofueronacompaadasde
medidasqueevitaranlavulneracindelosderechosfundamentalesantesmencionados(derechoalaintimidad
entreotros),comohubierasidodotardeunabataalinternoparapreservarsuintimidad,noobservndoseporotra
partequelaresistenciafueraactiva.

11. Pueden realizarse registros en las celdas?


S,siempreycuandoexistaunajustificacinclaraysecumplanunosrequisitosmnimosalpracticarlosdela
mismaformaquehemosdescritoenloscacheos.

12. Cundo pueden practicarse?


Cuando concurran motivos de seguridad en el establecimiento penitenciario ponderando siempre la
proporcionalidaddelaintimidaddelapersonafrentealinterspblicoquesepretendeproteger.

13. Quines pueden ser sometidos a los registros en celdas?


Todoslospresosconindependenciadelgradodeclasificacinenqueseencuentren.

14. En qu casos pueden practicarse?


Deformaexcepcional.Aquresultaaplicabletodolodichoparaloscacheospersonales.

15. Cmo deben practicarse?


Laceldadebeserconsideradacomodomiciliohabitualdelciudadanopreso,porloquedebertenertodala
proteccinquesedispensaaldomiciliodelaspersonaslibres.Porello,losregistrosenceldasdeberan
hacerseconlasmismasgarantasquelospracticadosalosdomicilios(autorizacinjudicial,prcticaanteel
secretariopodraseranteeldirectordelacrcelydostestigos).Delocontrario,sevulneraelderecho
fundamental a la intimidaddel domicilio. La sentencia de 19 de enero de 1995 analiza el concepto de
domicilioenelmarcodelderechofundamentalalaintimidadpersonal(art.18.1CE)yallibredesarrollode
lapersonalidad(art.10.1CE)Estederechoseconcretaenlaposibilidaddequecadaciudadanopuedacrear
mbitosprivadosquequedenexcluidosdelaobservacindelosdemsydelasautoridadesdelEstado.El
domicilioesaefectosdeproteccincualquierlugarcerradoenelquetranscurrelavidaprivadaindividualy
familiar,sirviendocomoresidenciaestableotransitoria(STS31deenerode1995).Talderechoderiva
directamentedelderechoallibredesarrollodelapersonalidad(art.10.1CE).Deellosededucequeel
domicilio,enelsentidoConstitucional,noessloellugardondesepernoctahabitualmente,odondese
realizan otras actividades cotidianas habituales, sino tambin el mbito erigido por una persona para
desarrollarenlalgunaactividad.EnestesentidosehasealadoporlaSTC22/1984queelderechoala
inviolabilidaddel domicilioconstituye unautntico derecho fundamental de la persona establecido para
garantizarelmbitodeprivacidaddesta.
Porello,losregistrosenlasceldasdebenguardarlassiguientesgarantas:Debenpracticarseenpresenciadel
preso.NilaLeyGeneralPenitenciaria,nielReglamentoestablecendeformaimperativalapresenciadel
presoensuceldacuandosepracticaunregistro.Tampocolaexcluyen.Hayqueentender,enconsonanciacon
laconsideracindedomicilioquesedebeotorgaralacelda,queelpresodebeestarpresenteenelregistro
parapoderapreciartodoloqueocurreduranteeldesarrollodelmismo.Tambinseletendraquedaruna
justificacindelresultadodelregistroascomolapertinenteacta.
Sinembargo,yporfaltadeespaciofsico,enlamayoradelasocasioneslapersonapresatanslopuede

permanecerenlapuertadelaceldaobservandoelregistro.ComorecogeelAutodelJVPdeCiudadRealde
21deenerode1991lapresenciadelinternoduranteelcacheodelaceldasuponeunreforzamientodela
garantadequeestadiligenciaserealizarenlaformadebidaysobretodo,conocerdeinmediatoqu
objetoslesonretiradoseinclusolasrazonesdeestarequisa,evitandolaindefensinaltiempoquese
favoreceelprincipiodecontradiccinyfavorecealainstitucinentantoquegarantizaelprincipiosde
legalidad evitando quejas, conflictos o posibles reclamaciones, as como proporciona garantas para un
probableexpedientesancionador(AutoJVPMadrid3de17.12.99).Enelmismosentidosemanifiestael
AutoJVPMlaga4denoviembrede1991ylosJuecesdeVigilanciapenitenciariaqueenlareunindeenero
2003 han manifestad que: Los jueces de vigilancia penitenciaria han establecido que salvo supuestos
excepcionales,quedebernjustificarse,lapresenciadelinternohadeserlanormaenlosregistrosquese
realicenensucelda,puesaunquenoseconsideredomicilio,sieselmayorreductodeintimidaddel
interno; intimidad que tutelan las normas penitenciarias (Art 4.2 b, 15.6 RP). La presencia del interno
refuerzaelrespetoasudignidad(art.23LOGP),permiteunamnimacontradiccinencasodehallazgosque
puedantenerconsecuenciaspenalesodisciplinarasycontribuyealaevitacindeconflictosydedenuncias
infundadascontralosfuncionarios(Criterio58).
Porello,losfuncionariosquefuesenapracticarelregistroenunaceldadebencomunicaralapersonaquela
habitetaldiligencia,ascomoofrecerlelaposibilidaddeestarpresente.Delocontrarioseatentacontrael
derechoalaintimidadydignidad(AutoJVPnm.1deCastillaLaMancha23deabrilde1992,17demayo
de 1992, 23 de mayo de 1995 y 16 de mayo de 1995). Si no se realiza en presencia del preso debe
interponerse una queja al Juez de Vigilancia y utilizar los recursos (reforma, apelacin y amparo) que
permitenlasleyes(modelonmero56.c).
Lopodrnhacerdosfuncionarios.Aunquedeberaserrealizadotambinantedostestigosyanteeldirector
delacrcelquepodrahacerlasfuncionesquedesempeaelsecretariojudicialenunregistrodedomicilio.
DeberapracticarseconautorizacindelJuezdeVigilanciaPenitenciariasuficientementemotivada.

16. Es obligatoria la entrega del acta de registro?


Debe levantarse una sucinta acta, en sentido negativo o positivo, de lo encontrado, as como de la
incidencias;notificndosedicharesolucinalinterno,devolviendocopiafirmada.(AutodeJVPdeBadajoz
de25demarzode1992).SinoseentregaelactaderegistrohayqueinterponerunaquejaalJuzgadode
Vigilancia;ascomoutilizartodoslosrecursos(reforma,apelacinyamparo)quepermitenlasleyes.

16. Se pueden intervenir dinero, alhajas u otros objetos?


S,sepuedenintervenirdinero,objetosvalor(alhajas),objetosprohibidos(cuchillos),prohibidos(drogaso
alcohol),ylosdeilcitaprocedencia(art.70RP).Enesteltimocasopuededarsesituacionesinjustasdebido
alaarbitrariedadquesepuedegenerarporintervenirobjetosdeilcitaprocedencia,todavezquedebera
acreditarsequeefectivamentelosobjetospertenecientesaunterceroyhansidosustrados,uobtenidospor
unmedioilegalqueconstituyadelitoofalta.Siseintervieneunobjetoynoexistesentenciapenalfirmeo
resolucinadministrativaenlaquesedeclarelailcitaprocedenciadeunbien,setienequerecurriralJuez
deVigilanciapenitenciariaparaquesedevuelva.
En estos casos se retendrn y custodiarn hasta la excarcelacin del penado, salvo que se remitan a la
autoridadjudicialporquepuedanserconsideradoscomoinstrumentosuobjetosdelacomisindeundelito
(art.70.2RP).Seraimportantequeentodaslasprisionesestuvieranprohibidoslosmismosobjetosafinde
evitarlaincertidumbrequeseproducenenlostrasladossobrelosobjetospermitidosoprohibidosencada
crcel(Criterio61,reuninJVP,enero2003)
Se puede tener un receptor de televisin, de tamao no superior a 14 pulgadas, as como radio y/o
reproductor.Asmismosepuededisponer,enloslocalesadecuadosalefecto,deordenadorespersonalesde
supropiedad,porrazonesdecarctereducativoycultural,previoautorizacindelConsejodeDireccin.
CuandosetratedeinternosincluidosenloscolectivosBandasArmadasyNarcotraficantes,(FIES2y3),se
recabarinformesobrelaconvenienciadelaautorizacindeCoordinacindeSeguridad.Enamboscasos,la
adquisicindeestematerialaudiovisualeinformticodeberrealizarseatravsdeleconomatoodelServicio
dedemandadura.Encasodetrasladodeprisinnopodrllevarlosconsigo,pudiendoserleenviadosatravs
deagenciadetransporte,siendoasucargolosgastosdelmismo,oentregadoasusfamiliaresopersonasque
designe(I21/96DGIP).

Captulo 11

MEDIOS COERCITIVOS Y RECUENTOS


1.- Qu medios coercitivos existen legalmente?
Elaislamientoprovisionalencelda,lafuerzafsicapersonal,lasdefensasdegoma,losaerosolesdeaccin
adecuada o sprays y las esposas (arts. 45.1 LOGP y 72.1 RP). Estos medios coercitivos se encuentran
depositadosnormalmenteenlasjefaturasdeservicios,yparasucontrolseutilizaunlibroregistroquedebe
contenervariasanotaciones(Instruccin21/96,de16dediciembre):fechadeinicioycese,tipodemedio
coercitivoaplicado,sucintoinformedehechos,otrasmedidasadoptadas.
Seprohbealosfuncionariosdeinstitucionespenitenciariaselusodearmasdefuegoeneldesempeodesus
funciones.TanslolaFuerzasdeSeguridaddeguardiaenlacrcel,enloscasosdegravesalteracionesdelorden
conpeligroinminenteparalaspersonasoparalasinstalaciones,podrnutilizararmasdefuegoconlaslimitaciones
queestablecelaLegislacindeFuerzasyCuerposdeSeguridaddeEstadosisonllamadosporeldirectordela
crcel(art.72.5RP).

2. En qu medida se pueden utilizar los medios coercitivos?


Segnlalegalidadpenitenciaria,elusodeestosmediosestdirigidoexclusivamentealrestablecimientode
lanormalidad.Debeserproporcionalalfinpretendido,ynuncapuedenusarsecomosancinencubierta.Su
aplicacindurareltiempoestrictamentenecesario,yseutilizarncuandonoexistaotramaneramenos
gravosaparaconseguirlafinalidadpretendida(art.45.3LOGPy72.1RP).Ellosuponequesepueden
utilizar:
a)Paraimpediractosdeevasinodeviolenciadelosinternos,paraevitardaosdelosinternosas
mismos,oaotraspersonasocosas,yparavencerlaresistenciaactivaopasivadelosinternosalasrdenes
delpersonalpenitenciarioenelejerciciodesucargo(art.45.1LOGP).
b)Debeexistirunasituacincrticayurgente,ylapruebadesuexcepcionalidadeslafijacinensus
normasreguladorasdelmitesclarosyprecisosmedianteunaminuciosapormenorizacindesumbitode
actuacin(AutoJVPSevillade7deoctubrede1991).EnestemismosentidosemanifiestaelTribunal
Constitucionalalsealarquelasmedidascoercitivasprevistasenlalegislacinpenitenciaria...tienenun
carcterexcepcionalparasupuestosdeespecialurgencia,segnsedesprendedelart.45LOGP,nopudiendo
emplearsecomoinstrumentosancionadoraguisadeprevencingeneral(AutoTCde15dediciembrede
1994)
c)Nosepuedeaplicarparafuncionesdeaveriguacindedelitos.Lafinalidaddelpreceptonoesla
atribucindeestasfunciones,sinoladeactuacinantesituacionesanormalesydeurgenciaquelorequieran
(AutoJVPSevillade6dejuniode1990,enelmismosentidoAutodelJVPdePuertodeSantaMarade7de
diciembrede1994).
d)Lautilizacinarbitrariaysinlasexigenciasexpuestasanteriormente,puededarlugaraundelitode
torturasocontralaintegridadmoral(arts.173a175CP)ocontralasgarantasconstitucionales(art.533CP).

3. Cul es el procedimiento para su adopcin?


Siexistenmotivosdeurgenciaparahacerusodetalesmediossecomunicardirectamentealdirector,quien
pondrinmediatamente enconocimientodelJuezde VigilanciaPenitenciaria la adopciny cese delos
medioscoercitivos,conexpresindetalladadeloshechosquehubiesendadolugaradichautilizacinyde
lascircunstanciasquepudieseaconsejarsumantenimiento(art.72.3RP).Tambinseaportaruninforme
mdicoparapoderaplicarlamedida,constanciadesilamedidahasidoautorizadaporelDirectorosislo
selehacomunicado;duracinsiyahacesadoysiloshechoshanmotivadoonoiniciodeexpediente
disciplinario.DeestamaneraelJuezsedaporenterado.Comunicaralacrcelsuconformidad,obien,si
consideraqueesdesproporcionado,ordenarquesedejesinefectolautilizacindelosmedioscoercitivos
empleados.LafinalidadeselcontroldelaejecucindelapenadeprisinporpartedelPoderJudicial,al
estarrecogidoestemandatoenelart.117.3delaConstitucin(AutoJVPSevillade6dejuniode1990).
Quedaclaro,portanto,queestasmedidassoncontrolablesjudicialmente,tantodelosmediosconcretos
utilizadoscomoenladuracin(inicioycese)AutoJVPSevillade7deoctubrede1991.
Enelsupuestodequenoseproduzcarealmenteunaalteracindelordenenlacrcelyseutilizasenmedios
coercitivoscontralosreclusosseburlaraelcontenidodelreiteradoart.45LOGP.Adems,denoencontrar
apoyolegalalguno,constituirafraudedeLey,yporendeimpediraelcontroljurisdiccionaldetalesactosde
laAdministracinPenitenciaria,ademsdevulnerarelderechodelosinternosanosufrirmsrestricciones
ensulibertadquelasprecisas,necesariasylegales(AutoJVPSevillade17dediciembrede1991).

Enlaprctica,lautilizacindemedioscoercitivosdalugaraabusosyexcesosfrecuentesqueconsistenen
golpescuandolapersonayahasidoreducida.Estosactosconstituyenundelitodetorturas.Pero,debidoala
dificultaddeconseguirpruebas,estasaccionesdemalostratosquedanimpunesenlaprctica.Cuandolas
medidasadoptadassoninjustificadasnosloensuadopcinsinotambinensuduracin,sedeberemitir
testimoniodeloactuadoalJuzgadodeInstruccinporsihubieralugaralaaperturadediligenciaspenales
(AutodelJVPdePuertodeSantaMarade7dediciembrede1994).SituacionescomoladescritaenelAuto
delJVPdeGranadasonfrecuentes:improcedenciadelusodelasdefensasdegomaconunpresoaisladoen
unaceldaysinningntipodepeligroparanadie.Setratdeunaimprudenciadelosfuncionariosalabrirla
celdaantelaviolenciaverbalyagresividadquemanifestabaelpreso(AutodelJVPdeGranadade18de
noviembrede1994).EnestoscasoshayquepresentarunquejaalJuezdeVigilanciayunadenunciaalJuez
deGuardiayDefensordelPueblo(modelosnmeros66,67ay67b).
Veamosotroejemploquepuedeorientarnossobreeltema:(AutodelJVPdeACoruade3dediciembrede
1999).Enlseestudianlosescritosyquejasverbalespresentadospordosinternoscomoconsecuenciadela
aplicacindemedioscoercitivosconsistentesenlasujecinmecnicamedianteesposasdurantecuatrodas
yelaislamientoprovisionalenceldadurantecinco.Lafinalidaddelasmedidassegnlapropiacrcelera
ladeevitarlaviolenciadelosinternosyladevencersuresistenciaactivaasercacheados.Enelmomento
delaaplicacindedichosmedioslosinternospresentabanheridasqueprecisabandeposteriorobservacin
mdica.Adoptadaslasmedidas,enlosdassiguientesseconsidernecesariosumantenimientoparaevitar
laautoyheteroagresindelosinternosdebidoasuestadodeagresividad.
Hastaaqu,ypesealasconsideracionesquedetipoprocesalcabrahacerpuesexistengravesdefectosen
elprocedimientodeadopcinycesedelasmedidas(nosecomunicalJuezdevigilancia,ynofueron
tomadasporeldirector),hemosdeexaminarsilaaplicacindelosmedioscoercitivoseraprocedente.
Teniendoen cuenta los incidentes que provocaron dicha aplicacin (por los que se siguen actuaciones
penales)ysufinalidadinicial,conlaleyenlamanopodraserlcitalasujecinmecnicaconesposas,
siemprequesuduracinfueralaestrictamentenecesariaparalograrelfinbuscado.Ahorabien,noparece
pertinente,dadoelestadofsicodelosinternosconheridasqueprecisabanobservacinfacultativaysu
aparenteagresividad,quedichamedidaseprolongasedurantecuatrodasyque,ademslesfueseaplicada
la medida de aislamiento provisional por el plazo de cinco das cuatro de los cuales permanecieron
esposados.Parecemslgicoquesehubieranadoptadomedidasmdicasparacomprobarlaevolucinde
suslesionesycalmarsuestadodeagresividad(trasladoaenfermera,medicacin),puesesdifcilpensar
queelaislamientoabsolutodeunapersonaesposadaqueseencuentraherida,vayaacontribuiradisminuir
suagresividadoevitarelriesgodeautolesin.Yashemosderescatarloqueantesapuntbamos:aunque
unaconcretamedidanopuedaconsiderarseconstitutivadetratoinhumanoodegradanteenrazndel
objetivo que persigue, ello no impide que se le pueda considerar como tal en razn de los medios
utilizados(SSTC120/1990y137/1990).Porotrolado,sealaelautoqueloquenuncadebahaberhecho
eraentrarenlaceldaporcuantoalestaraisladoelinterno,nohabapeligroparanadie,locontrario
significa una mala aplicacin del principio de oportunidad en la intervencin funcionarial, con
consecuenciasprevisiblementelesivasparalosintervinientes:internoyfuncionarios.

4. Cules y en qu casos se pueden aplicar los medios coercitivos?


Laadopcindetalesmedidasdeberserindividualynuncacolectiva.Laaplicacinnopuedehacersepara
situacionesabstractas,sinoconcretadaalascircunstanciasdecadacaso(AutoJVPSevillade7deoctubrede
1991).Losmedioscoercitivossonlossiguientes:
Elaislamientoprovisionaldebeaplicarse:
a)Porlosmotivostasadosenelart.45.1LOGP
b) Con el nico fin de restablecer la normalidad y por el tiempo estrictamente necesario,
entendindoserecomendablequenoduremsalldelahorauhorasestrictamentenecesarias,evitandoas
adems el deterioro fsico y psquico del interno cuyo responsable es el mdico que haya firmado
favorablementeelaislamiento,aquienlecorrespondeelinicialycontinuadocontroldelaaplicacindela
medida(art.72.2infineRP)
c)LautilizacindelamedidadebecomunicarsealJuezdeVigilanciainmediatamente(art.45.2
LOGPy72.3RP)(enunplazonuncasuperiora24horassegnelAutoquetranscribimos,sinembargo24
horasnoequivaleainmediatamente)explicando:elsupuestoquelohayamotivado,larelacincircunstancial
deloshechos,dayhoradelaadopcindelamedida,elinformemdico,silamedidahasidoautorizadapor
el director o si slo se le ha comunicado, duracin si ya ha cesado; y si se ha incoado un expediente
disciplinarioporloshechos
d) Nocabe la utilizacinde esta medidacomounasancin anticipada;e)En sucaso cabrala
interposicindelcorrespondienterecursodealzadacontralamedida/sancinindebidamenteaplicada.(Auto
JVPMlagade23deenerode1992)(modelonmero58).

Salvoenloscasosanteriormentemencionados,nosepuedellevaresposadoaunapersonapresaaunqueest
enrgimencerrado.Enocasiones,alospresosenprimergradooalosclasificadosenelFIESselesaplica
estamedidaparalostrasladosdentrodelacrcel.Altratarsedeunmediocoercitivonopuedenserobjetode
colocacinindiscriminadatodavezquelamedidavienedeterminadaparacadacasoindividualyconcreto.
Esobvioquelostrasladosalpatioolasconduccionesdelmduloaotrasdependenciasnosuponenuna
alteracinens misma de la vida regimental. Enestoscasossiseessometido auna contencin fsica
medianteelusodeesposas,hayquepresentarunrecursodeQuejaanteelJuezdeVigilanciaPenitenciaria
(Modelonmero57).Slosedeberecurriralempleodeestemediocoercitivocuandolaconductadela
personapresa,encadacaso,aslojustifique,enlossupuestosespecficos,actualesyconcretosprevistosen
elart.45LOGP(AutoJVPValladolidde31deagostode1993yAutoJVPOviedode20deoctubrede
1993).Ciertamentelaclasificacinenprimergradodeuninternonopuedejustificarporssolalaadopcin
demedidasqueatentencontralosderechosfundamentalesoquemenoscabenladignidaddelapersona...y,
ensucaso,lasmedidasadoptadasnodebenresultardesproporcionadasoarbitrarias(AutoJVPMurciade5
demayode1994).

5. Los medios coercitivos se pueden aplicar sobre cualquier persona?


No.Nosepuedenaplicaralasmujerespresasgestantes,nihastaseismesesdespusdelaterminacindel
embarazooalasmujereslactantes,nialasquetuvieranhijosconsigo.
Tampoco se puedenaplicar a los enfermos convalecientes de enfermedad grave, salvo en los que de la
actuacindeaqullospudieraderivarseuninminentepeligroparasuintegridadfsicaoparaladeotras
personas(art.72.2RP).

6. Qu finalidad tienen los recuentos?


Lafinalidaddelrecuentoesdoble:
a)comprobarelnmerodepresos,supresenciaysuestado(AutosJVPdeCiudadRealde31demarzode
1992yde18demayode1993yAutodeldeSevillade21demarzode1991)
b)porrazonesdecontrol,vigilanciayseguridadinteriordelosEstablecimientos(AutosdelJVPde
Zaragozade16denoviembrede1990y16dediciembrede1991).

7. Qu tipos de recuentos existen?


Ordinariosyextraordinarios(art.67RP).
Losordinarios,segnelReglamento,seutilizanparaelcontroldelapoblacinreclusa.Serealizanenlos
relevosdelpersonaldevigilancia,enunhorarioaprobadoporelConsejodeDireccindelCentro(art.67.1
RP).Enlosrecuentosordinariosenceldahayquedistinguira)elprimerodelamaanaenelqueser
necesarioqueelpresoseincorporemomentneamente(noimplicaeltenerqueponersedepie),sinquesea
necesarioqueadopteunaposturaderelativamarcialidad,b)elltimodeldaquerespondealosmismos
objetivosqueelprimero(permanenciadelinterno).Normalmentetambinsehaceunoalmedioda.
Losextraordinariossernordenadosporeljefedeservicios,puedenserparcialesparaconocerlaestadoreal
deun departamentoconcreto.Secomunicarnaldirector,teniendoencuentaelcomportamientodela
personapresaylasituacinexistenteeneldepartamentoconcreto.Estosrecuentosserealizandeforma
inmediata (ejemplos: situaciones de riesgo porque ha fallado algn sistema de seguridad; o porque ha
existidounmovimientoimportantedepresosporasistenciaaundeterminadoeventocultural,etc...

8. Cmo y dnde se practicarn?


Serealizarnconeldebidorespetoaladignidaddelapersona(AutodelJVPnm.2deMadridde27de
febrerode1990;enelmismosentidoAutodelJVPdeBadajozde20demarzode1990)yconlasgarantasy
periodicidadquereglamentariamenteseestablezcan(art.23LOGP).
Seharndeformaquegaranticesurapidezyfiabilidad,reflejndosesusresultadosenunparteescritopor
losfuncionariosquelohubieseefectuadoydirigidoalJefedeServicios(art.67.3RP).
Losrecuentossepracticarntantodentrocomofueradelasceldas.Losquesepractiquenendependencias
colectivas,fueradelasceldas,handeverificarseenformacinafindeconseguirlarapidezyveracidaddel
resultado. Por el contrario aquellos que se practiquen en el interior de las mismas no debern revestir
formalidad alguna, no siendo exigible que los internos se siten de pie, siendo suficiente con que su
presenciaseavisible(AutodelJVPdeZaragozade16dediciembrede1991;enelmismosentidoAutodel
JVPdeSevillade21demarzode1991yAutodelJVPdeLasPalmasde18dejuniode1994)

9. Es necesario ponerse de pie en los recuentos dentro de las celdas?


No,nienlaLeynienelReglamentoexigenparaelrecuentoenceldalaadopcindeposturasdeterminadas.
Lonicoexigibleesquenosefrustrelafinalidaddelrecuentoniseadoptenposturasquesuponganunafalta
derespetoalfuncionarioquerealiceladiligencia(AutodelJVPdeCiudadRealde29denoviembrede1990
yde16deagostode1990;AutosdelJVPdeLasPalmasde18dejuniode1994yde1deagostode1994).
Noesnecesarioquelapersonapresapermanezcadepieparacomprobarlapresenciadelosinternosenel
interiordelasceldas.Bastaconqueestnalavista,dadoquedesdelapuertasedivisaperfectamentetodala
celdayquenohayespaciofsiconoobservabledesdelamisma(AutoJVPdeValladolidde10deenerode
1990,AutoJVPdeZaragozade18deseptiembrede1990).Asimismo,elAutodelJVPnm.2deMadridde
27defebrerode1990reconocequebastaelqueestnincorporadosenlacama,sentadososimplemente
visiblesparaquelosfuncionariosquerealizanelrecuentopuedancomprobarfcilmentelapresenciayel
estadodesaluddetodosellos...lasnormas...penitenciariashandeconvencermsquehacerobedecersin
conviccin.Elhechodeobligaraestardepieenposicindefirmes,cuandoelobjetivoquesepretende(elde
vigilanciayelseguridad),puedequedargarantizadodeotraforma....
ElAutodelJVPdeSevillade21demarzode1991establecequelafinalidaddelrecuentosecumpleconla
meravisindelpresoconindependenciadelaposturaqueadopte:...cuandosetratadeuninternoquevaa
permanecerenlaceldaelrestodeldacarecedesentidoydelgicaexigirastequeselevanteQuse
pretendeconqueelinternoestlevantado?Porquseleexigequecumplaelhorarioparalevantarsesiel
restodelmismorelativoadeportes,ducha,ocio,trabajo,etc.,noselevaaexigir?Quefectonegativopara
elrgimentienequeuninternomientrasestenlaceldapermanezcaacostado?Lacontestacindeestas
preguntasmehaceconcluirenlafaltadesentidodelaprohibicindepermaneceracostadoenlaceldadela
quenopuedesalir,queporsusreducidasdimensioneshacenaconsejablepermitiralinternoquealolargo
deldaadoptelasposturasquedeseesiempreycuandopermanezcavisiblealahoradelosrecuentos...enlo
sucesivo se autoriza a los internos a noadoptar posturas determinadas en los recuentos. En la misma
direccinelAutodelJVPdeTenerifede12.dejuliode1991concluyequelaexigenciadeponerseenpieno
cabededucirlaenmodoalgunodelospreceptosreglamentariosyquedarsupeditadaaaquelloscasosenque
elfuncionario,alefectuarelrecuento,tuvieraalgunaraznespecialparaexigirlo,existiendocircunstancias
objetivasquemotivaranlapuestaenpiedelapersonapresa.

10. Existen recuentos nocturnos rutinarios en los departamentos de


aislamiento para presos clasificados en primer grado?
Enlosmdulosdeaislamientodeloscentrospenitenciariossevienenrealizandocadanoche/madrugada
recuentosconsistentesengolpearlosbarrotesoventanas,despertaralapersonapresayposteriormente
meterlaluzdeunalinternaeiluminarlacelda.Puestosencontactoconvariaspersonasquesufrenesta
situacinrefierenunasensacindeansiedadenlaesperaaqueseproduzcaelrecuentoquepuedeserentre
lasdosylascuatrodelamadrugada.Refieren,adems,angustia,humillacin,dificultadparaconciliarel
sueo.Estasituacinnobeneficiaanadie,solamentegeneramsviolenciaymsconflicto.Esadems,
superfluoeineficaz,porqueencasosdeseguridadconcretoselart.67.1RPestablecelaposibilidadde
recuentosextraordinarios.

11. Por qu motivos estos recuentos son ilegales?


La LOGP en su art. 23 establece que los recuentos se efectuarn en los casos, con las garantas y
periodicidadquereglamentariamentesedeterminenydentrodelrespetoaladignidaddelapersona".LaLey
establece dos lmites claros que impiden la actuacin arbitraria de la administracin haciendo uso del
recuentonocturnocomomediodecastigoodesometimiento.
Porunladoelreglamentoestablecequelautilizacindeestemedioregimentaltienecomofinalidadel
controldelapoblacinreclusa.Este"control"hasidodesarrolladoporlajurisprudenciadelosJuzgadosde
VigilanciaPenitenciariaenundoblesentido:"comprobarelnmerodepresos,supresenciayestado(autos
JVPdeCiudadRealde31demarzode1992,yde18demayode1993);yporrazonesdecontrol,vigilancia
yseguridadinternadelosestablecimientos(autosJVPdeZaragozade16denoviembrede1990y16de
diciembrede1991).
Desdeunainterpretacinteleolgicadelanorma,ydentrodeloslmitesmarcadosporlapropiaLOGP
sealizados por el respetoala dignidadde la persona, la prcticade unrecuento debehacerseparael

conocimientodelnmerodelaspersonaspresasconlafinalidaddeevitaroimpediroconstatarevasioneso
fugas.Parecelgicoyrazonablequesepractiqueunrecuentoalamaana,otroalmediodayotroalanoche.
Esms,paraquienesseencuentranenmdulosdeaislamientoenelquesesalealpatiotreshorasaldacon
otro preso, se posibilita un nuevo recuento, es decir, una nueva constatacin de que las personas se
encuentranenelcentropenitenciario.
Laexistenciadeunnuevorecuentodiario,cadamadrugada,notieneningunafinalidaddecontrolporquees
absolutamentesuperfluoeineficaz.Entodocasosepodrahacerusodelaposibilidadqueestableceel
ReglamentoPenitenciarioconsistenteenlarealizacinderecuentosextraordinarios,ordenadosporeljefede
servicios ydando cuenta al director. Entendemos que el uso de estos recuentos debe hacerse de forma
extraordinaria,excepcionalmentedebidoalasnumerosasmedidasdecontrolqueestaspersonaspadecen
(registrosenlasceldascada,cacheosconysindesnudointegralcadasemana,paseoensolitario,observacin
continua por parte de los funcionarios). En caso de que existan razones de urgencia, de seguridad,
suficientementecontrastadasyjustificadassepodraacudiralrecuentoextraordinario(art.67.1RP),pero
enningncasoestenuevorecuentonocturno(demadrugada)puedeconvertirse,comodehecholoes,en
recuentoordinario.Estamedidaexcededelorazonablequederivaenilegalpordesbordarloslmitesdel
tratodigno,reducindonosmselescasolmitedeautonomaquesepermiteestergimendevida.
Estehechosuponeunatentadocontraladignidad,conceptodefinidoporelTribunalConstitucionalcomo:
"valorespiritualymoralinherentealapersonaquesemanifiestasingularmenteenlaautodeterminacin
conscienteyresponsabledelapropiavidayquellevaconsigolapretensinalrespetoporpartedelos
dems"(STC53/85de11deabril).Todavezquelaesferadeautonomapersonalquelalegislacinyel
reglamento permiten es prcticamente nula, la utilizacin de ms medios regimentales de control, con
incidencia directa en la persona (despertarles cada noche con golpes en la ventana) y desbordando
ampliamenteelcontenidodelaLOGPyelRP,suponeunataquedirectoaladignidad.Nadahabraquedecir
siporrazonesconcretasserealizaunrecuentoextraordinarioanteexistenciaexcepcionaldealgunasituacin
deinseguridaddelcentropenitenciario.
Asuvezconstituyeuntratodegradanteyvejatorio,todavezqueestamedidadesbordaabiertamenteellmite
delalegalidad,yquenotieneningunarazndeserdesdeelpuntodevistadelaseguridad.Pareceutilizada
exclusivamenteparatratardeformavejatoriayhumillante,haciendoquelaspersonassedespiertencada
noche,causandounperjuiciofsicoypsquicocuyoalcanceyrealidadnoselepuedeescaparaningnser
humanoqueseaconscientedeloquesuponeserdespertadodesusueo,sinmotivolegalalguno.Segnla
jurisprudenciadelTEDHrecogidaenlaSTC120/1990.FJ9,paraencuadrarunapenaotratoenalgunade
lascategorasdelart.3delConveniodeRomade1950hadeatendersealaintensidaddelossufrimientos
infligidosaunapersona;habiendodeclaradoelTribunalConstitucionaldeconformidadconesadoctrinaque
lastresnocionestambinrecogidasenelart.15CE(torturas,penas,otratosinhumanosodegradantes)son,
ensusignificadojurdico,"nocionesgraduadasdeunamismaescala"queentodossustramosentraan,sean
cualesfuerenlosfines,"padecimientosfsicosopsquicoseinfligidosdemodovejatorioparaquienlos
sufre...),esms,aunquelamedidanopuedaconsiderarseconstitutivadetratoinhumanoodegradante"en
razndelobjetivoquepersigue",ellonoimpidequeselepuedaconsiderarcomotal"enrazndelosmedios
utilizados"(STC120/1990y137/1990).Estamedidavulneraportantoelderechofundamentalalaintegridad
moral,ensuvertientedeinterdiccindetratosinhumanosodegradantes,consagradoenelart.15CE.
Por ltimo, esta medida supone un ataque frontal a la intimidad, garantizada como derecho
fundamentalenelart.18.1CE.Estederechoestavinculadodirectamentealapropiapersonalidady
deriva,sinduda,deladignidaddelapersonahumanaqueenelart.10.1CEreconoce.Laintimidad
personalgarantizalaexistenciadeunmbitopropioyreservadofrentealaaccinyelconocimiento
delosdems,necesarioparamantenerunacalidadmnimadevidahumana(STC231/1988,179/199).
Esciertoquenoesunderechoabsolutoypuedecederantedeterminadassituacionesdeseguridad
gravesydebidamentejustificadas.Peroestacesin/limitacinpormuyintensaqueseanopuedeser
absoluta,ynuncarealizadaensituacionesnoprevistasniautorizadasporlalegalidadordinariao,en
todocaso,porelreglamento.Vuelvoareiterarqueelrecuentonocturnocadadanotienecabidaenla
LOGPnienelRP,pudiendoaplicarsenicamenteelrecuentoextraordinario.

Captulo 12

EL TRABAJO REMUNERADO EN LA PRISIN

1. QU CARACTERSTICAS TIENE EL TRABAJO PENITENCIARIO?


Eltrabajopenitenciarioseconsideraunderechoyundeberdecadapersonapresa.Estdestinadoala
resocializacindelpreso.Porello,laLeyGeneralPenitenciariasealaqueeltrabajopenitenciariotieneque
serformativo,creadoroconservadordehbitoslaborales,productivo,yconlafinalidaddeprepararel
accesoalmercadolaboralalasalidadeprisin(art.26.c)LOGP.Larelacinqueunealtrabajadorinterno
con la empresaadministracin penitenciaria (Organismo Autnomo de Trabajo y Prestaciones
Penitenciarias)tienenaturalezaderelacinlaboralpuesrenelascaractersticasquesedescribenenelart.
1.1delEstatutodelosTrabajadores:personal,ajeneidad,voluntariedad,dependenciayretribucin..Aslo
establecelaLeyderelacionesLaborales,elEstatutodelosTrabajadores,elReglamentoPenitenciario,laLey
55/1999yelRealDecreto782/2001.
Dentrodelasdiferentesclasesdetrabajoexisteelquesedenominatrabajoremuneradoodirectamente
productivo,entendidocomounaprestacinlaboralporcuentaajena.Vienereguladoenelart.27.e)LOGPy
enelart.132yssRPRD782/2001,porelquesederogaelDecreto573/1967,de16demarzoylosarts.134a
152delRPde1996).
Dadalaescasezdepuestosdetrabajoenlasprisiones,eltrabajopenitenciarioseconvierteenlamayorade
lascrcelesmsqueenunderecho/deber,enunaposibilidadparamuypocos.Hayquesolicitarloaldirector
(modelonmero59.a).ElTribunalConstitucionalllevadiciendoenreiteradadoctrinadesdehacemsde
quinceaos(Sentencias25/1981,82/1986,163/1986,2/1987,13demarzode1989y19deoctubrede1989)
queelderechoaltrabajoremuneradoenlaprisin,quereconoceelart.25.2delaConstitucin,esde
aplicacin progresiva. La Direccin General de Instituciones Penitenciarias carga con el mandato
constitucionaldeorganizarlasprestacioneslaboralesremuneradasenelsenodelascrceles,atravsde
llamadoOrganismoAutnomodeTrabajoyPrestacionesPenitenciarias(OATPP),sinembargo,elritmo
delacreacindepuestosdetrabajoesmenorqueeldeseado.Alavistadeesteestancamiento,entendemos
quedebemosirabriendocaminosdesolucinaestasituacinpenitenciariaconlosmediosqueactualmente
disponemos,yhaciendoquelaAdministracinylosTribunalessepronunciensobre,nosloelderechoaun
puestodetrabajoenlaprisin,sinoalascondicioneslaboralesyeconmicasqueconllevalarelacinlaboral
especialpenitenciaria.

2. Existe normativa internacional respecto del derecho a un trabajo digno?


Elart.6delPactoInternacionaldeDerechoseconmicos,socialesyculturales,firmadoen1996yratificado
porEspaaen1997,obligaalosEstadosatomarmedidasparagarantizarelderechoaltrabajodetoda
persona.Elart.7dedichoPactoestableceelderechodetodosalgocedecondicionesdetrabajoequitativasy
satisfactorias,salariodignoeigualportrabajodeigualvalor,seguridadehigieneeneltrabajo,promocinen
lospuestosdetrabajo,descansos...LaCartaSocialEuropeade1961,ratificadaporEspaaen1980,se
expresaenelmismosentidoensusarts.1,2,y3.

3. Qu actividades quedan excluidas de esta relacin laboral?


Elart.1.3RD782/2001establecequequedarnexcluidasdeestaregulacinlamodalidadesdeocupacinno
productivaquesedesarrollenenlosestablecimientospenitenciarios,talescomoformacinprofesionalocupacional,
el estudio y la formacin acadmica, las ocupaciones que formen parte de un tratamiento, las prestaciones
personalesenserviciosauxiliarescomunesdelestablecimiento,lasartesanales,intelectualesyartsticas,yen
general, todas aquellas ocupaciones que no tengan naturaleza productiva. De igual forma, tambin quedarn
excluidalarelacinlaboraldelosinternosenrgimenabiertoqueseencuentrensometidosaunsistemade
contratacinordinariaconempresarios.Enestossupuestos,larelacinlaboralserreguladaporlalegislacin
laboralcomn,sinperjuiciodelatutelaqueenlaejecucindeestoscontratospuedarealizarseporlaautoridad
penitenciaria(Art.1.2RD782/2001).

3. Existen diferencias entre el trabajo remunerado y los servicios auxiliares


comunes?
Si,lostrabajosproductivossediferenciandelosllamadosserviciosauxiliarescomunesenquestosson
obligatoriosparalospresosporelhechodeestarenprisin.Adems,notienenenteoraelcarcterde
productivosy,suincumplimientopuedetraerconsecuenciasdisciplinarias.Entreestosserviciosauxiliares
comuneslosmsfrecuentesson:economatos,enfermera,limpiezadezonascomunes,peluquera,cocinasen
algncaso,etc.
Enestelugarmepareceinteresantesealarque,porejemplo,lalimpiezadezonascomuneshasidoutilizada
porlascrceles,alamparodelosartculos19y5.2c)yf)delosrespectivosReglamentosPenitenciarios(el
derogadoyelvigente),paraestablecerunanormadeobligadocumplimientoparatodoslosreclusos.Esto
suponeunperjuicioparalospresosquequierenundestinopararedimirpena,puestoqueselespodra
adjudicarlalimpiezadeestaszonas.Encambio,sonlimpiadasporlatotalidaddelospresosdeacuerdoaun
cuadrantequeimponedichatareadeformarotatoria.Siunpresoseniegaessancionado.
Conrespectoalaposibilidaddeconcederestatareaapresoscomodestinopararedimirpodemosargumentar
lossiguientes:
Elartculo19RP1981yel5.2RP1996pretendenserundesarrollodelartculo29infinedelaLOGP,
queestablecequetodointernodebercontribuiralbuenorden,limpiezaehigienedelestablecimiento,
siendo reglamentariamente determinados los trabajos organizados a dichos fines. Por ello, los Centros
Penitenciarios(muchos?pocos?)contemplanensusnormasdergimeninternolaobligacindelinterno
deacometerlalimpiezadezonascomunes,talescomopasillos,patiosyotrasdependencias(comosalade
TV), siendo su negativa objeto de sancin como falta muy grave, e imponiendo hasta siete das de
aislamientopordichomotivo.
Noobstante,entendemosqueesacontribucinalbuenorden,limpiezaehigienedelestablecimientono
tieneporquereferirsealaszonascomunes.Serefierealmbitoestrictamentepersonaldelospresos,con
capacidaddeaplicacindeformaexclusivaaloqueseratantolaesferamsntimadelrecluso(sucuerpo,su
celda...as,art.5.2c:observarunaadecuadahigieneyaseopersonal),comosucomportamientofuerade
esaesfera(noensuciar,noestropear,noentorpecerlahigienegeneral...delamismaforma,elart.5.2e:
correccinenelvestiryacatarlasmedidashiginicasysanitariasestablecidas).
Delaformadeprocederconlaredaccindeesteartculo,as,comodelaactuacindelosCentros,
parecequeesmsimportanteladisciplinaqueeltratamiento,yquetalvezelsostenimientodedichanorma
comoobligatoriabuscaotrosfines,comoeldelasumisindecualquierinternoardenesconcretasen
cualquiermomento,enbuscadeuninnecesarioreforzamientodelprincipiodeautoridad.
Esteartculo29LOGPnopuedeserinterpretadofueradecontextodelasdireccionesdeestaLey,detal
formaquepuedalesionarelfinprimordialdelareeducacinylareinsercinsocial.Dehecho,supropia
ExposicindeMotivosmencionacomorasgosmssobresalientesdelaLey:lasumisingeneraldelrgimen
penitenciarioalasexigenciasdeltratamientocientficodelosinternos,yuntrabajoequiparadoaltrabajoen
libertad.DemaneraquelasnormasregimentalesnopuedencontravenirelespritudelaLOGP,yporellola
limpiezadelaszonascomunesdelCentronodebeserunfinensmismo,sinounmedio(art.71.1).Siel
rgimenestsupeditadoaltratamiento,ylasnicasrestriccionesquepuedenimponersealosderechosdelos
internosdeberanrecogersedeformaespecficaenlaLOGP,lasnormasreglamentariasestablecidasporel
Centroporserderangoinferiornopuedenrestringirfacultadesalosinternos,talescomoelaccesoal
trabajoyelxitodesutratamiento.
Sielartculo6LOPJobligaalosJuecesyTribunalesainaplicarlosReglamentoscontrariosalaCE,a
laleyoalprincipiodejerarquanormativa,cuandounreclusorecurrieraalJVPlasancinqueleimponeel
CentroPenitenciariopornegarsearealizarlaactividaddelimpiezadelaszonascomunes,envirtuddeuna
normadergimeninternoqueobligaahaceralgoquedesaprovechaparaeltratamiento,deberaestimarseel
recursoporqueelCentroPenitenciarionopuedepreferirlaimposicindeuntrabajoantesqueofrecerlopara
eltratamiento,sinvulnerarloestablecidoenelart.25.2CE.

4. Quines tienen el deber de trabajar?


Todas las personas penadas conforme a sus aptitudes fsicas y mentales incluidos, lgicamente, los
clasificadosenprimergrado,aunquesurgimendevidatengauntiempodejornadamsrestringido;otra
cuestinesqueenlarealidadnoexistaparaestospenados.Quedandispensadosdeestaobligacin,sin
perjuiciodepoderdisfrutardelosbeneficiospenitenciarios(art.133.2RP):
a)Lossometidosatratamientomdicoporcausadeaccidenteoenfermedad,hastaqueseandadosdealta.
b)Losquepadezcanincapacidadpermanenteparatodaclasedetrabajos.(AquseestrefiriendoelRPa
lasituacindeInvalidezoIncapacidadPermanenteenelgradodeAbsoluta,quesegnelTextodelaLey
GeneraldelaSeguridadSocial,imposibilitaeldesarrollodelaprofesinhabitualydecualquierotrotipode
trabajoinclusolosdecarctersedentario.
SetratadeunadeclaracinquepuedepartirtantodelpropioInstitutoNacionaldelaSeguridadSocial,como
deunasentenciafirmeenlavalaboral.Seentiendequepuedetratarsetantodesituacionesdeclaradascon

anterioridadalaentradaenlacrcelcomoconposterioridad).
c)Losmayoresdesesentaycincoaosdeedad.
d)Losquepercibanprestacindejubilacin.
e)Lasmujeresembarazadasporuntotalde16semanas(18encasodepartomltiple)quepuedenser
distribuidaslibrementeantesydespusdelalumbramiento,conlaobligacindedejaralmenosseissemanas
inmediatamenteposterioresalparto.
f) Los presos preventivos pueden trabajar de acuerdo con sus aptitudes, contando con las mismas
condiciones que los penados, con los incentivos, recompensas y beneficios. Cuando voluntariamente
realicen trabajos productivos encuadrados en la relacin laboral penitenciaria gozarn, en igualdad de
condicionesquelospenados,delasremuneracionesestablecidasparalosmismos.Asloindicael29.2de
laLOGP,el133.3delRPylaregla89delasNacionesUnidas.

5. Por qu normas se regula el trabajo penitenciario?


Elart.134.4delRPdicequeelEstatutodelosTrabajadores(queeslanormaqueregulanormalmentelas
relacionesentreunaempresayuntrabajador)seaplicarenlarelacinlaboralespecialpenitenciariasloen
loscasosenqueelReglamentoPenitenciarioolasnormasdedesarrolloseremitanexpresamenteal.Se
regulaporelRD782/2001.Elart.1.4deesteRealDecretoestablecequelasdemsnormasdelalegislacin
laboralcomn,incluidoeltextorefundidodelaLeydelEstatutodelostrabajadores,slosernaplicablesen
loscasosenqueseproduzcaunaremisinexpresadesdeesteRealDecretoolanormativadedesarrollo.
PerolociertoesquelosveintinartculosqueelReglamentoPenitenciariodestinaaregulareltrabajo
penitenciarionosonsuficientespararegularlatotalidaddesituacioneslaboralesquepuedendarse.Existen
multituddeespaciosvacosquenoestnprevistosenelReglamentoPenitenciarioRealDecreto,yquesin
dudahandeserresueltasconarregloalaleylaboralenvigorparacualquierrelacindetrabajoporcuenta
ajena,ascomoporlanormativainternacionalqueincideenlamaterialaboral.

6. Qu es el Organismo Autnomo de Trabajo y Prestaciones Penitenciarias?


Esteorganismocumplelasfuncionesdeempresa,respectodelaqueelpresoeseltrabajador.Larelacin
laboralpenitenciariavienecaracterizadaporelhechodequeelrganoquecontrataalreclusoessiempreel
OrganismoAutnomodeTrabajoPrestacionesPenitenciariasurganoautonmicoequivalente;setrata,por
tanto,delaempresa.AntiguamentepertenecaalMinisteriodeJusticia,peroenlaactualidadestadscritaal
Ministerio del Interior a travs de la Direccin General de Instituciones Penitenciarias (art. 7 del Real
Decreto de 2 de agosto de 1996). El OATPP es el encargado de la organizacin y control del trabajo
productivoenlostallerespenitenciarios.
El140.3RPhabladequeladireccindelostalleresvendratravsdelaspersonasencargadasdeeste
cometidoydeldirectordelEstablecimiento.Lasquejassobreorganizacindelaactividadproductivalas
podremoshaceranteeldirectordelacrcelque,enestecaso,cumplelafuncindegerente.
Este Organismotiene unnivelorgnicodeSubdireccin Generaly se estructura como una delas siete
unidadesadscritasalaDireccinGeneraldeInstitucionesPenitenciarias.

7. Puede ser que la empresa no sea el Organismo Autnomo de Prestaciones


Penitenciarias?
S.Existendosposibilidades.Laprimeraescuandonosencontramosconserviciosauxiliarescomunes
(cocina,panadera,biblioteca,economato...).Esfcildarsecuentacundoestamosanteunserviciodeeste
tipo(art.27.1.e)LOGP),cuandoquienlogestionesealapropiacrcelynoelOrganismoAutnomode
TrabajoyPrestacionesPenitenciarias.
Enloscasosdeserviciosauxiliarescomunes,nosecotizaporlaspersonaspresasduranteeltiempoque
desarrollenestosservicios,nipercibenremuneracinalgunacomoencualquiertrabajo,sinounasimple
gratificacindepocodineroquenormalmentenollegaalsalariomnimointerprofesional,yquesale,enla
mayoradeloscasos,delfondodereclusos.
En segundo lugar, es posible (art. 138.2 y 139 del RP) que encontremos la figura del empresario del
exteriorenlagestindealgunodelostalleres,perolaregulacindelarelacinlaboralserlamismaquela
queseestableceenelReglamentoPenitenciario.

7. Puede suponer la realizacin de servicios auxiliares comunes tener una


relacin laboral con la administracin penitenciaria?
Lajurisprudenciaentiendequeno;peropartedeladoctrinaafirmaqueesposibleesarelacinlaboralconla
administracinpenitenciariayloqueellosuponeencuantolaobtencindederechoslaboralescuandoel
presorealizaserviciosauxiliarescomunes.

Lasentenciade3defebrerode1997delTribunalSupremo,enunificacindedoctrina,vieneaconfirmar
quelosserviciosauxiliarescomunesnotienenelcarcterderelacinlaboralespecialy,porello,aunquela
personadesarrolledentrodelacrceluntrabajoconunacategoraprofesional,unhorariofijo,ytodoloque
caracterizaunpuestodetrabajo,notienederechoaacudiralosJuzgadosdeloSocialcomocualquier
trabajador, sino que tendra que realizar, en todo caso, las quejas y reclamaciones ante el Juzgado de
VigilanciaPenitenciaria.
Porelcontrario,elprofesordeDerechodelTrabajoydelaSeguridadSocialdelaUniversidaddelPas
Vasco,ANGEL ELAS ORTEGA,nosdatresbuenasrazones(ComentariopublicadoenlaRevistaActualidad
Aranzadide16deoctubrede1997)paradefenderlatesiscontraria,esdecir,quelaprestacindeservicios
auxiliarescomunestienecarcterlaboral:
a)LaConstitucinEspaolarecogeensuart.25.2elderechoaltrabajopenitenciarioremuneradoyel
derechoalosbeneficiosdelaSeguridadSocial.Nocabenrestriccionesalahoradedelimitarlosderechosde
untrabajadorrecluso,enrazndesisutrabajologestionalaAdministracinPenitenciaria.Eldiscriminarlos
derechosdeuntrabajadorenfuncindequiengestionesutrabajovulneraelart.25.2delaConstitucinyel
propioart.14delaConstitucinqueconsagralaigualdad.
b)Lanorma72.1delasNormasPenitenciariasEuropeas,queestenidaencuentaenlaLOGP(enla
ExposicindeMotivos)establecelanecesidaddeasimilareltrabajopenitenciarioallibre.
c)LaLOGPnopretendiexcluirlostrabajosenserviciosauxiliaresenelart.27.2delaproteccinde
SeguridadSocialydelanormativadeSeguridadeHigieneenelTrabajo.

8. Un preso que trabaje tiene derecho a la cobertura de la Seguridad Social,


como cualquier otro trabajador en libertad?
ElDecretode16demarzode1967,nm573/67delMinisteriodeTrabajo,determinasuinclusinobligatoria
en el Rgimen General de la Seguridad Social, siempre que la relacin laboral se establezca entre el
OrganismoAutnomodeTrabajoPenitenciarioyelpreso.Elart.19delRD782/2001,adiferenciadel
derogadoartculo134.7RP1996,yanoseremitealaaccinprotectoradelaSeguridadSocial,yomitela
inclusindelaprestacindeincapacidadtemporal,locualsignificalavulneracindelart.26.fdelaLOGP
que establece que en el desarrollo del trabajo los penados deben tener la proteccin dispensada por la
legislacinvigenteenmateriadeseguridadsocial.
Laactividadlaboralretribuidaconllevaelderechoaquedesdeelprimerdadetrabajolaempresaddealtaal
trabajadorenelSistemadeCotizacionesdelaSeguridadSocial.Enestesentido,elmencionadoRealDecreto
indicabaquelostrabajadorespresosquedesarrollasenlaborespenitenciariasremuneradastenantienenderechoala
coberturadelRgimenGeneraldelaSeguridadSocialyaque,aunquesuactividadserijaporlasnormasde
DerechoPenitenciario,concurrenenellaslascaractersticasnecesariasaesterespecto,comosonlasdeobteneruna
retribucinporsutrabajoyladellevarloacaboencondicionesanlogasalasdeltrabajolibreencuantoserefiere
elempleodemaquinaria,tiles,herramientas,yhorariodetrabajo.
Todoellopermiteaplicaralosreclusos,yasusfamiliaresquetenganlacondicindebeneficiarios,laaccin
protectoradelRgimenGeneraldelaSeguridadSocial,enaquellascontingenciasysituacionesqueresulten
adecuadasasuactualcondicin,almismotiempoquehaceposiblealosreclusosqueseincorporen,una
vez cumplida sucondena,a la realizacindetrabajospor cuentaajena, tener cubiertoslosperiodos de
cotizacinqueserequierenparacausardeterminadasprestaciones.Estovieneadeterminarlosderechos
claros: por un lado, el derecho a cotizar por parte de la Administracin Penitenciaria para cualquier
contingenciaquepuedacubrirlaSeguridadSocial,yporotrolado,elderechodelpresoapoderacumularlas
cotizacionesdelosperiodostrabajadosenprisinconloscotizadosfueradeprisinafindepoderobtener
prestacionesparalasqueseexijaunmnimodeaos(jubilacin,invalidezpermanente...).
Losinternostrabajadoressujetosalarelacinlaboralespecialpenitenciariaquedarnincluidosenelrgimen
generaldelaSeguridadSocialygozarndelaprestacindeasistenciasanitaria,ascomodelaaccin
protectoradelmismoenlassituacionesdematernidad,riesgoduranteelembarazo,incapacidadpermanente,
muerteysupervivenciaderivadasdelaenfermedadcomnyaccidentenolaboral,,jubilacinysituaciones
derivadasdelascontingenciasdeaccidentedetrabajoyenfermedadprofesional.Asimismo,sernprotegidos
porlacontingenciadedesempleocuandoseanliberadosdeprisin(art.19RD782/2001).Conestanueva
regulacinquevieneaderogarelDecreto573/1967,de16demarzo,serestringelaaccinprotectorarespecto
delaspersonaspresasquetrabajenentalleresformativosuocupacionales,ascomolanocoberturaante
situacionesdeincapacidadtemporalderivadadeaccidentenolaboralyenfermedadcomn.
ElOrganismoAutnomoTrabajoyPrestacionesPenitenciariasoelrganoautonmicoequivalentequesea
competenteasumir,respectodelostrabajadores,lasobligacionesdeafiliacin,alta,bajaycotizacin,que
lasnormasdeSeguridadSocialimponenalempresario(Art.20RD782/2001).Lacotizacinserealizar
conformealassiguientesnormas:
a.Eltipodecotizacinserelcorrespondientealassituacionesporcontingenciascomunesincluidasen
laaccinprotectoradeestosinternos.

b.Lacotizacinporlascontingenciasprofesionalesseefectuaraplicandolatarifadeprimasvigentealas
retribucionesefectivamentepercibidasenfuncindelashorastrabajadas,sinque,concarctergeneral,dicha
baseseainferioralasbasesmnimasdecotizacinporcontingenciasprofesionalesaplicablesaloscontratos
atiempoparcial.
c.Enlacotizacinporlacontingenciadedesempleoseaplicareltipodecotizacinestablecidoparala
contratacinindefinidavigenteencadamomento.
Laobligacindecotizarsemantendrmientrasdurelarelacinlaboral.Enloscasosdesuspensindela
relacinlaboralnicamentecontinuarlaobligacindecotizarenlassituacionesdematernidadyriesgo
duranteelembarazo(Art.21RD782/2001).

9. Qu requisitos se necesita tener para tener la cobertura protectora tiene la


Seguridad Social para los presos trabajadores y sus familias?
ParaestudiarestetemaesnecesarioacudiralinteresantsimotrabajodeloscompaerosdelaComisinde
AsesoramientoXurdicopenitenciariodelColegiodeAvogadosdeOurense(publicadoenloscuadernosde
derechopenitenciariodelColegiodeabogadosdeMadrid).Sihablamosdeprestacionescontributivashay
quedistinguirvariasposibilidades:
A) Sielderechoalaprestacindelaseguridadsocialsehaadquiridoconanterioridadalingresoenla
crcel,elpenadonotendraquetenerningnproblemapueslaLeyGeneralPenitenciariaestablecequese
"adoptarn las medidas necesarias para que los internos y sus familiares conserven sus derechos a las
prestacionesdeseguridadsocialadquiridosantesdesuingreso"(art.3.2LOGP).
B)Sielderechoalaprestacinseadquiereunavezqueseestcumpliendocondenaoseestenlibertad
condicional,puedenocurrirvariasposibilidades:
- Quelapersonapresaestoestuvierasujetaalarelacinlaboralespecialpenitenciariayquepor
tantodesdeelOATPPsehubierancubiertotodaslascotizaciones.Enestecasonotendranque
existirproblemas,perolospresossequejanporlatramitacindelassolicitudesdelas
prestacionesyporalgunosproblemasderivadosdelafaltadecotizacinoincorreccinenlas
mismasalnohabersehechoportodaslascontingencias.Paraestasquejassepuedesolicitar
abogadodeturnodeoficioenelcolegiodeabogadosdondeseencuentrelacrcel.
-

Quelapersonanoestuvierasujetaalarelacinlaboralespecialpenitenciariaporquenohaya
podidotrabajarenprisinentalleresproductivos.Pensemosenlasituacindetalleres
formativos,ocupacionalesodestinos.Enestoscasos,aunquenoestnprevistosenelRD
782/2001hayquesolicitarlotomandocomofundamentolassentenciasdelTribunalSupremo
queacontinuacinsedetallan.EnestoscasoselTribunalSupremosehamanifestadoen
sentenciadeUnificacindeDoctrinade12.11.1996,afirmandoquesiduranteelperodode
reclusinexistedisponibilidadparaeltrabajomediantelarealizacindeactividadespersonales,
noparececoncordeconelmandatoconstitucionalunainterpretacindelalegalidadquelesprive
delosbeneficiosdelaseguridadsocialporfaltadealtaosituacinasimilada,derivadasnoslo
delaprivacindelibertadqueleimpidesuparticipacinenlaproduccinosucomparecencia
enelmercadodetrabajo,sinotambindelainexistenciaenloscentrospenitenciariosdeuna
organizacin,constitucionalmenteexigibleaunquedeaplicacinprogresivaqueleshaya
permitidodesarrollaruntrabajodirectamenteproductivo.Estamuyespecialsituacindelinterno
guardaindudableanalogaconlaimposibilidaddetrabajarquecaracterizaeldesempleo,porlo
queutilizandoloscnoneshermenuticosdelainterpretacinconformealaConstitucinydela
interpretacinevolutiva,debeatribuirseelmismorgimenjurdicodeasimilacinalaltaquese
aplicaatalsituacindedesempleoenelart.2.4delaOM13defebrerode1967.Enidntico
sentidosemanifiestaelAutode22.09.1998delTribunalSupremoqueinadmiteelrecurso
interpuestoporlarepresentacindelINSS.EnelmismosentidosemanifiestalaSentenciadel
TribunalSuperiordeJusticiadeCataluade5defebrerode2002:resultaevidentequeel
causantequerealizabaserviciospersonalesenelcentropenitenciarioyqueportantoacreditaba
sudisponibilidadparalarealizacindetrabajosdirectamenteproductivos,alavezquenose
acreditasienelcentropenitenciariohabaorganizacindetrabajosdetalnaturalezaysisele
habaofrecidoalcausantelaposibilidaddetrabajarenlosmismos,seencontrabaaunasituacin
anlogaaldesempleo,porloquesusituacinenlaseguridadsocialhadeserconsideradacomo
asimiladaalaltaenelmomentodesufallecimiento.

Porotroladosenecesitanunostiemposmnimosdecotizacin. Estoperjudicaalosinternosquenohan
podidotrabajarlosuficienteporuntiempodeterminadoalosefectosdelrequisitodelacotizacin.Paraestos
casos,losTribunalesaplicanlateoradelparntesisqueconsisteenconsiderarlosperodostranscurridosen
situacionesqueimposibilitanlaprestacindecotizacionesnoimputablesalavoluntaddelbeneficiario.
Existendoscorrientesjurisprudenciales.Unaqueafirmaqueelingresoenprisinsuponeunperodode
parntesis(STSJdeCataluade23.10.98(ar.4217)yde28.06.1996(Ar.3396).Otraafirmaqueparapoder
aplicarelperododeparntesisesnecesarioqueelpenadohayatrabajadoenprisinaunqueestostrabajosno
impliquenlaexistenciadeunarelacinlaboralespecialpenitenciaria(STSJCastillayLende26.10.98(Ar.
3793).
LaaccinprotectoradelaSeguridadSocialcubriralosreclusosyalosfamiliaresquetenganlacondicin
debeneficiariosenlassiguientessituacionesycontingencias:
a)Asistenciasanitariaporenfermedadcomnoaccidentelaboral.
b)Incapacidadtemporalderivadadeenfermedadcomnoaccidentenolaboral(bajamdicacomn)(Ya
novigenteporRD782/2001).
c)Invalidezprovisionalderivadadeenfermedadcomnoaccidentenolaboral(hoyendaesetipode
invalidezhasidoeliminada).
d)Invalidezpermanente,muerteysupervivenciaderivadadeenfermedadcomnyvejez,asistenciasocial
yaccinformativa.
e)Vejeznivelmnimo(PrestacindeJubilacin).
f)Contingenciasysituacionesderivadasdeaccidentesdetrabajoyenfermedadesprofesionales.

10. Qu ocurre con las mujeres presas que estn trabajando y den a luz un
hijo?
Elart.151deRPestablecequelamaternidadpermiteunalicenciade1618semanas,conlocualse
convierteenmotivodesuspensindelarelacinlaboralalapardeloqueestableceenelart.45delEstatuto
delosTrabajadores.Ladistribucinserealizadeacuerdoconelart,133.2e)delRP,ydaplenalibertadensu
fijacin,conlanicasalvedaddequealmenos6semanasseanposterioresalparto.
El art. 9.1.c) RD 782/2001 establece que la maternidad y el riesgo durante el embarazo provocan la
suspensindelarelacinlaboraldurante16semanasininterrumpidas,ampliablesenelsupuestodeparto
mltipleendossemanasmsporcadahijoapartirdelsegundo,distribuidasantesodespusdelpartoa
opcindelainteresada,siempreque6semanasseaninmediatamenteposterioresalmismo.Puedeocurrir
quealnoexistirmdulosdemadresentodaslascrceles,alamujertrabajadoraseletrasladeaunacrcelen
la que existan estos mdulos, pero previamente se le extinga el contrato de trabajo por el mencionado
traslado.Porello,sinosetienelabajamaternalantesdeltraslado(son16semanas,delasque6tienenque
serinmediatamenteposterioresalparto),sepuedenencontraralsolicitarlaprestacinqueelorganismo
AutnomodePrestacionesPenitenciariascontestequenoestdadadealtaporhaberseextinguidosutrabajo.
Anteestasituacin,ademsdeacudiralosjuzgadosdelosocialconunademanda(sepuedepedirabogado
deoficio),hayquepedirlabajaantesdeltraslado.
La suspensin supone igualmente que la empresa no tiene obligacin de pagar salario mientras se
mantengalasituacindelicenciadematernidad.Sinembargo,laLeyGeneraldelaSeguridadSocial,sin
hacerdistinciones,dicequeserbeneficiariadelSubsidioporMaternidadaquellatrabajadoraqueestenalta
enelRgimenGeneraloensituacinasimiladaalaltaalsobrevenirlasituacinprotegidayque,adems,
tengaalmenos180dascotizadosdentrodeloscincoaosanterioresalparto.Ellosignificaque,sicumple
estascondiciones,podrasolicitarlaprestacincorrespondientealInstitutoNacionaldelaSeguridadSocial,
para lo cual hay impresos en las oficinas de ese organismo. (Posibilidad de obtenerlos a travs de la
AsistenciaSocialdelaPrisinomediantesolicitudalaDireccinProvincialdelInstitutoNacionaldela
SeguridadSocialdecadazona).
Encasodequetantolamadrecomoelpadretrabajen,lamadrepodroptarporqueelpadredisfrutedehasta
cuatrodelasltimassemanasdesuspensinsiemprequeseanininterrumpidasyalfinaldelcitadoperiodo,
salvoqueenelmomentodehacerseefectivaestaopcin,laincorporacindelamujeraltrabajosupongaun
peligroparasusalud(arts.48.4delETy133bisysiguientesdelaLeyGeneraldelaSeguridadSocial,RD
1251/2001de16denoviembre,BOE17.11.01).LaLeyhaqueridodarlaposibilidaddecompartirelperiodo
depermanenciaconelhijo,porlomenosencuantoasuspensindeltrabajoyderechoalaprestacin
econmica.HabraquesituarlacuestinencadaCentroPenitenciarioalahoradehacerrealidadelcontacto
depadreymadreconelhijoencasodequeambospadresestuvieranpresos,oinclusocuandoslounode
ellosestenprisin.

11. Cul es el procedimiento a seguir en las relaciones laborales?


Lascuestioneslitigiosasderivadasdelosconflictosindividualesquesepromuevanporlosinternostrabajadores
encuadradosenlarelacinlaboralespecialpenitenciariaseregirnporlaLeydeProcedimientoLaboral(RD
2/1995,de7deabril)(Art.1.5RD782/2001).
Todas las cuestiones litigiosas (conflictos/denuncias) que surjan en el trabajo remunerado dentro de la
prisin,sernresueltasconarregloalodispuestoenlaLeydeProcedimientoLaboral,yhadehacerseenlos
JuzgadosdeloSocial.
Esta remisin que realiza el art. 134.5 del RP nos abre un gran abanico de posibilidades. Por esta va
podemosreclamarsalariosnoabonados,diferenciassalariales,categoraprofesional,sancioneslaborales,
reconocimientosdederechoslaboralesprevistosenelRP,etc.
ParapoderdemandarhayquedarlossiguientespasosParaellohayquedarlossiguientespasos:
a)Reclamacinprevia.ElrequisitoparaacudiralosJuzgadosdeloSocialconlasdemandaslaborales,al
tratarselaempresadelaAdministracin(art.69delaLPL),consistireninterponerunaReclamacinPrevia
ante el Organismo Autnomo de Trabajo y Prestaciones Penitenciarias (Ministerio de Interior). Los
elementos bsicos que tiene que contener cualquier Reclamacin Previa son: rgano al que se dirige,
identificacindelinteresado,hechos,razonesypeticinqueserealiza,lasolicitud,lugar,fechayfirma,
(modelosnmero59.b.,60y62).
Los plazos para interponer la reclamacin previa desde quese produjo el hecho sern: de un ao para
reclamacionesdecantidad(salariosnoabonados,atrasos,etc.),20dasparareclamacinporsanciones,
despidos,etc.,y30dasparaelcasodeResolucionesdelaAdministracinengeneral.
b)Lademanda.SitranscurreunmessinrecibircontestacindelOATPPsobrelareclamacinpreviaque
hayarealizado,lapersonapresatienequeinterponerenlos30dassiguientesunademandalaboralantelos
JuzgadosdeloSocialdelazona,(modelosnmeros63,64y65).
Encasodequelareclamacinpreviaobtengacontestacindenegatoria,tenemosdosmesesparainterponer
demandaanteelJuzgadodeloSocial.
Lademandahadeiracompaadadelacopiadelaresolucindenegatoriao,encasodenohaberobtenido
respuesta,lacopiaselladadelapropiaReclamacinPrevia.Esmuyconvenientecontarconunabogado
(laboralistasifueraposible)quepreparelademandao,entodocaso,queasistaaljuicio,aunquetambinse
puedeacudirajuiciosinabogado.Siquierequesedesigneunodeoficiolotienequeespecificarenlaltima
parte de la demanda, y el Juzgado de lo Social tendr que realizar las gestiones necesarias para su
designacin.
c)ElJuzgadodeloSocial.EselJuzgadoalquesedirigelademanda.NoesnecesarioiralJuzgadode
VigilanciaPenitenciaria,porqueelcompetenteenmaterialaboraleselJuzgadodeloSocial.Unavezquela
demandaseaadmitidaatrmite(quequieredecirqueformalmenterenetodoslosrequisitos),lapersona
presarecibirunacitacinpormediodelAgenteJudicialoporcorreocertificadoconacusederecibo,con
emplazamientoparaundayunahoraparalacelebracindeljuicio.Silapersonasaledeprisinenlibertad
condicionalodefinitivayannolehallegadolacitacindelJuzgadodeloSocial,esnecesarioquese
acerquealDecanatodelJuzgadodeloSocialparapreguntarenquJuzgadodeloSocialcaysudemanda,
ademsdeindicarelcambiodedomicilio.
Enesteprocedimiento,elpresoeseldemandanteotambindenominadoactor,yeldemandadoesel
OrganismoAutnomodeTrabajoyPrestacionesPenitenciarias.
d) El juicio. El da sealado para el juicio tienen que trasladar al preso al Juzgado de lo Social
correspondiente,porloqueyadesdelamismademandaesconvenienteirindicandoalJuezdeloSocialque
oficiealDirectordelaPrisinmandamientoparaqueeldadeljuicioletrasladenhastaelJuzgado.El
procedimientoeselmismoquecuandosesaleaunjuiciopenalocuandoseesllamadocomotestigo.
e) Las pruebas. Los medios de prueba de los que intente valerse el preso en el juicio pueden ser
documentales,testificalesopericiales.Siquierequeotroscompaerosdetrabajovayanadeclararcomo
testigos(porejemplo,hadesarrolladotrabajosdeunadeterminadacategoraoenunhorarioconcreto)lo
tendrqueespecificarenlademandaparaqueelJuezpuedacitarles.Silostestigosnoseencuentranenla
prisinporcualquiermotivo,elpresodebeindicaralJuzgadoeldomicilioenelqueseencuentraaefectosde
notificacinyelJuzgadoseencargardetramitarlacitacin,silaacuerdaensucaso.

12. Qu derechos tienen las personas presas trabajadoras?


El Reglamento Penitenciario define los siguientes derechos con el carcter de bsicos en el art. 5 RD
782/2001):
a) Derecho a que el trabajo productivo que pudiera ofertar la Administracin Penitenciaria sea
remunerado, as como a la percepcin puntual de la remuneracin establecida por la legislacin
penitenciaria,aldescansosemanalyalasvacacionesanuales.
Aligualquecualquiertrabajador,elsalariovendrdadosegnelrendimiento,lacategoraprofesional,

horario,ynmerodehorasrealmentetrabajadas/contratadas,actividaddesempeada(art.33.1cLOGP);
peroelart.15RD782/2001notieneencuentalaclasedeactividaddesempeada,solamenteenfuncindel
rendimientoydelhorariodetrabajoefectivamentecumplido;porloqueseinfringeelprincipiodejerarqua
normativayeldeasimilacinaltrabajoenlibertad.ElReglamentoPenitenciarioRealDecreto782/2001
habladetomarcomoreferenciaelsalariomnimointerprofesional(SMI)quesefijaanualmenteporel
gobiernoparatodoslostrabajadores,afindecalcularelsalariodeacuerdoconlashorasefectivasdetrabajo.
Realmentesetratadequetodotrabajadorporcuentaajenatienederechoaquesujornadalaboralmantenga
unmnimoensuvaloracin.Porejemplo,enelao1997,elSMIfueparalosmayoresde18aosde66.630
pts/mes,calculadassobreuntotalde40horasalasemana.Enelao1998elSMIestfijadoen68.040ptas.
As,seestablecernormalmenteafinalesdecadaaoelsalariomnimodelaosiguiente.Esuncontenido
bsicodelderecholaboral.Laleyloprotegeyledacarcterinembargable.Lacantidadmnimaquesenos
abonedebeseralmenosproporcionalalSMIencuantoalnmerodehorassemanalesquerealiceelpreso.
Siempresonlegaleslasmejorasnuncalosrecortes.
Eloperariosuperiordeltallertienederechoapercibirun10%msdesalario.Estaspalabrejasvienena
definirlacategoradequienademsdedesempearlastareasnecesariasparaelfuncionamientodelos
talleresproductivos,colaboraensuorganizacinydesarrollo(art.143RP).
ElConsejodeAdministracindelOATPPeselquedeterminaanualmenteelmduloretributivo,osea,una
tabla salarial que determina la retribucin de los trabajadores presos productivos que, como hemos
comentado, tomar como referencia el SMI. Se incluir en este mdulo la parte proporcional de la
retribucindelosdasdedescansosemanalydevacacionesanualesretribuidas,ascomolasgratificaciones
extraordinarias(pagasextras).
Encuantoalospuestosdetrabajoquedesarrollenpresosypresas,laremuneracinhadeseridnticasilas
funcionesylascategorassonlasmismas(art.4.2c)ET,art.135.2.b)delRPyart.14CE).
Elpagodesalariosehacemensualmentealacuentadepeculio(Art.16.1RD782/2001).Elinterspormora
oretrasoenelpagodesalariospactadosoatrasosesdeun10%,loquedebemostenerencuentaparaaadir
alacantidadadeudadasitenemosqueiniciarunprocedimientodereclamacindesalariosalOrganismo
AutnomodeTrabajoyPrestaciones.
Puededarseelcasodequeelabonodesalariosehagaadestajo,osea,porproductooserviciorealizado.
Toda persona presa trabajadora tiene derecho al abono de al menos dos pagas extraordinarias al ao,
normalmenteenjunioojulioyendiciembre.Esaspagaspuedenestarincluidasenelsalariomensual.En
estecaso,lasumadelasdospagasdivididasentrelosdocemesesdelaonosresultalallamadaprorratade
pagasextrasquesevieneasumaralsalariomensual.Unejemplo:sisetrabaja4horasaldaycincodasa
lasemana,lajornadasemanalserde20horas.Comoelsalariomnimointerprofesionalen1998esde
68.040ptas.para40horassemanales,setendrderechoalmenosqueseabonenlamitad(34.020ptas.)al
mes.Sienelcontratosehadichoquelaspagassetienenprorrateadasenlanmina,significaqueenvezde
cobrarenjunioojulioydiciembreunacantidadde34.020respectivamentecomoextra,sevaapagarcada
mesunaparte.Asresultaque34.020x2pagasextras,divididoentrelosdocemesesdelao,dauna
cantidadde5.670ptas.queseaadencadamesalsalario.
Encuantoalostrabajosconsideradosnoproductivos,lostrabajadorestendrnderechoarecibirprimasala
produccinenfuncindelamejoradelacalidaddeltrabajo,delasuperacindedeterminadosnivelesde
produccinodecualquierotravariablequelodetermine(Art.15.5RD782/2001)loqueelReglamento
denomina incentivos, recompensas o beneficios (art.153.2). Aqu volvemos al problema de la
consideracinonodelarelacinlaboralenestoscasos.EnlosJuzgadosdeloSocialdeVitoriaseha
declaradoelcarcterderelacinlaboraldeestosserviciosconelconsiguientereconocimientodeunsalario
deconformidadalmnimointerprofesionaldecadaao.Peroestapostura,comohemoscomentado,sehalla
endebatearazdelaSentenciadelTribunalSupremode3defebrerode1997.
Parastosltimos,el153.3RPprevquelosbeneficioseconmicosquepudieranexistirporlaventadelos
productos elaborados en los talleres, se destinarn a la reposicin de materiales necesarios para la
elaboracindelosproductosyalpagodeincentivosalosinternos.
b) Derechoaquesevalore el trabajoproductivorealizadoy la laboriosidaddel interno en orden al
rgimen y tratamiento penitenciario, as como la concesin de beneficios penitenciarios si se dan los
requisitoslegales(Art.5.2RD782/2001).
c)Derechoaparticiparenlaorganizacinyplanificacindeltrabajoproductivoenlaformayconlas
condicionesestablecidasenlalegislacinpenitenciaria.Enelart.13RD782/2001sedetallantresposibles
vas,aunquelgicamentenovanaserlasnicas:
Aportacindeideasdemaneraindividualocolectivasobrelosplanesdetrabajo.
Participarenlaevaluacindelossistemasdeproduccinyformularpropuestasatravsdelas
comisiones sectoriales sobre los mdulos retributivos que anualmente ha de fijar el Consejo de
AdministracindelOrganismoAutnomodeTrabajoyPrestaciones.
Formarpartedelosequiposencargadosdelcontrolymantenimientodelossistemasdeseguridade
higieneeneltrabajo.

Asimismo,elRPdetermina,enconsonanciaconelEstatutodelosTrabajadores,queenlarealizacindel
trabajoproductivo,lostrabajadorestienenderecho:
a)Alapromocinyformacineneltrabajo(art.35.1deCE).Entreotrasvaslalegislacinlaboral
establecequeestederechocomprendelaposibilidaddedisfrutardepermisoseneltrabajoparapresentarsea
exmenes,as comola preferenciaaelegirturno de trabajo(si eneltaller existiesen turnos)cuandoel
trabajadorcurseconregularidadestudiosparalaobtencindettulosacadmicosoprofesionales.
Tambincomprendelaadaptacindelajornadaordinariadetrabajoparalaasistenciaacursosdeformacin
profesionaloalaconcesindelpermisooportunodeformacinoperfeccionamientoprofesionalconreserva
delpuestodetrabajo.
Enconcreto,elReglamentosealaqueeldesempeodeunpuestodetrabajoproductivonohadeimpedir
acudiralassesionesdetratamientoyasistiralasclavesdelosnivelesbsicosdeformacinqueestablezca
lalegislacineducativa.
b)Anoserdiscriminadosparaaccederalempleoo,unavezempleados,porrazonesdenacionalidad,
sexo, estado civil, edad dentro de los lmites marcados por la legislacin laboral y penitenciaria, raza,
condicinsocial,ideasreligiosasopolticas,ascomoelidioma.
ElEstatutodelosTrabajadoresloreflejaenelart.4.2.c)yenelart.17(nodiscriminacinenlasrelaciones
laborales).Seestableceencuantoalaccesoalpuestodetrabajo,alosascensosdecategora,alsistemade
clasificacinprofesional,salario,trato,despidodiscriminatorio,etc.TambinloreflejaelConvenio111dela
OrganizacinInternacionaldelTrabajo.

c)Alaintegridadfsicayaunaadecuadapolticadeseguridadehigieneeneltrabajo,deacuerdo
conlodispuestoenlalegislacinvigentesobredichamateria.
Elart.40delaLey31/1995,de8denoviembre,dePrevencindeRiesgosLaborales,habladequelos
propiostrabajadorespuedenrecurriralaInspeccindeTrabajoySeguridadSocialsiconsideranquelas
medidasadoptadasylosmediosutilizadosporelempresarionosonsuficientesparagarantizarlaseguridady
lasaludeneltrabajo.
EsobligacindelaInspeccindeTrabajoinformaraquiendenunciasobreelresultadodelavisitayla
indagacinrealizadasobreloshechosdenunciadosy,ensucaso,sobrelaimposicindelacorrespondiente
sancinalaempresaporelincumplimientodemedidasdeseguridadysaludlaboral.
Es,porejemplo,unainfraccincalificadacomograveelhechodequelaempresanorealicereconocimientos
mdicosperidicos,sobretodoenactividadesdeevidenteriesgoparalasalud,onoentreguelosresultados
alinteresado.Laleyprotegeigualmentelaconfidencialidaddelosdatossobrelasaluddelostrabajadores.
Pararealizarcualquierreconocimientomdicohademediarelconsentimientodeltrabajador.(art.22dela
LeydePrevencindeRiesgosLaborales).
Tambinesmotivodesancingraveparalaempresaelnollevaracaboevaluacinderiesgoycontrol
peridicodecondicionesdetrabajo,nodarcuentaalaautoridadlaboraldeaccidentesdetrabajoquese
produzcanydelasenfermedadesprofesionalesdeclaradas,nollevaracabounainvestigacincuandose
produzcan daos a la salud de algn trabajador, adscripcin de trabajadores a puestos de trabajo cuyas
condicionesfuesenincompatiblesconsuscaractersticaspersonales,oconsuscapacidadesprofesionalesen
materiadeseguridadysaludeneltrabajo(trabajarenlacocinasinelcarnetdemanipuladordealimentos),
etc.
Cuandolostrabajadorespercibenunevidenteriesgograveparalaseguridadfsicaylasalud,puedensolicitar
medianteescritodirigidoalaInspeccindeTrabajo,afindequestaordenealaempresalaparalizacin
inmediatadetodoslotrabajosytareas.Silasituacinesextrema,eltrabajadortendrderechoainterrumpir
suactividadyabandonarelpuestodetrabajocuandoconsiderequeestponiendoenpeligrosuintegridado
suvida.(art.21delaLeydePrevencindeRiesgosLaborales).
Encuantoalastrabajadorasqueestnensituacindematernidadoconpartoreciente,laempresadebe
evitarleslastareasqueporprocedimientoocondicionesdetrabajopuedaninfluirnegativamenteensusalud
oladelfetoo,ensucaso,sobrelalactancia.
La empresa debe garantizar que cada trabajador reciba una informacin terica suficiente en materia
preventiva.
d)Alapercepcinpuntualdelaremuneracinestablecidaenlalegislacinpenitenciaria,ascomoel
descansosemanalyalasvacacionesanualesestablecidasenelRP.
e)Alrespetodesuintimidad,conlaslimitacionesexigidasporlaordenadavidaenprisin,yala
consideracin debida de su dignidad, comprendida la proteccin frente a ofensas verbales o fsicas de
naturalezasexual.
EncuantoalaslimitacionesalderechoalaintimidadlaRecomendacinquerealizelDefensordelPueblo
en1994alaSecretaradeEstadodeAsuntosPenitenciariossobreelderechodeintimidadengeneraldelos
presos,puntualizaquemantenerlaseguridaddelcentronosirveporsslocomoraznquejustifiqueuna
medidaquevulnereelderechoalaintimidaddeunpreso.ConformehadeclaradoelTribunalConstitucional
STC37/1989,62/1982y13/1985lasmedidasdebensernecesariasparaconseguirelfinperseguido,
inclusoimprescindibles.Debenrealizarsecuandosedenenelcentropenitenciariosituacionesexcepcionales
que ponga en peligro su orden interno y su seguridad de modo que la limitacin del derecho sea
proporcionadaconlasituacindeaqulaquienseleimponen.

13. Tienen los presos trabajadores derecho a descansos y vacaciones?


S.ElConsejodeDireccindecadaprisinhadefijaranualmenteunCalendarioLaboral,conarregloala
jornadamximalegalvigenteencadamomento.(art.17RD782/2001)149.1RP).Actualmente,ellmitelo
fijaelart.34delEstatutodelosTrabajadoresencuarentahorassemanalesdetrabajoefectivodepromedioen
cmputoanual.Estosignificaque,realmente,puedenexistirsemanasenlasqueserealicenmsde40horas,
perohandesercompensadasconelrecortedejornadasenotrassemanas.Entreelfinaldeunajornadadiaria
yelcomienzodelasiguientehandemediaralmenos12horas.
El Reglamento indica que existen dos tipos de descanso: el semanal, de da y medio ininterrumpido
comprendiendolatardedelsbadoytodoeldomingo,yeldescansopordasfestivosdecadalocalidad(Art.
17.2RD782/2001).
Las vacaciones tienen una duracin de 30 das naturales por cada ao (Art. 17.5 RD 782/2001). El
Reglamentocondicionaelmomentodedisfrutealasorientacionesdetratamientoyalasnecesidadesde
trabajosegnlossectores.Salvoqueseestablezcaotracosaexpresamente,eldisfrutedelasvacacioneshade
realizarsedentrodelaonatural,deeneroadiciembre.Silarelacinlaboralcomienzaenelmesdejulio,el
derechoalasvacacionesserdisfrutar15dasentrejulioydiciembre.Aunquelareglageneralesquelas
vacacionesnosepagansinosedisfrutan,sielcontratofueseporpocosmeses,ylasvacacionesnose
hubierandisfrutado,enlaliquidacinfinalhadeincluirseendinerolaparteproporcionalarazndesalario
diarioporlosdasnodisfrutadosdevacaciones.
LaLeydeProcedimientoLaboralestableceunsistemaurgenteparareclamarlasvacacionesquelaempresa
nohayaconcedido,peroelrequisitoesquelademandaentreenelJuzgadodeloSocialantesdel31de
diciembre del ao en cuestin. Si una persona no ha disfrutado las vacaciones de 1998, no las puede
reclamar,almenosantelosJuzgadosdelosSocial,apartirdeenerodelao1999.Enestoscasosnoes
necesaria la interposicin de Reclamacin Previa Administrativa, sino directamente la demanda en el
JuzgadodeloSocial(art.70delaLeydeProcedimientoLaboral).

14. En qu casos un preso trabajador puede obtener permisos?


Eltrabajadorpodrausentarsedeltrabajo,previoavisoyjustificacin,encasodesalidasypermisosfuerade
prisin,situacionesenlasquesesuspendelarelacinlaboral,yque,adems,nosepuedencomputarcomo
vacaciones.Porellonosernretribuidas.Enconcretosetratadeltiempodedisfrutedepermisosordinariosy
extraordinarios,salidasprogramadasycualquierotrasalidaautorizada(Art18RD782/2001).

15. Qu ocurre con las horas extraordinarias?


Elart.149.4RPquehasidoderogadoporelRD782/2001estableceestablecaqueeldirectordelaprisin
puedepodaautorizarlas,contrasladoalConsejodeDireccin,parasurealizacinampliandoelcalendario
laboralprevistoyocupandodasdedescanso.Dosrequisitos:
a) Cuando sea necesario. No se trata de una medida que pueda adoptarse arbitrariamente y sin
justificacin,ymenosconcarctersancionador.
b)...Previaconformidaddelostrabajadores.Estaexpresinvieneaconfirmarloqueexponeelart.35
delEstatutodelosTrabajadoresencuantoalcarctervoluntariodelarealizacindehorasextras,salvoque
setratedesupuestosabsolutamenteexcepcionales.
PeroelRD782/2001nohabladeestashorasextraordinariasporloquehayqueacudiralEstatutodelos
Trabajadoresenelqueseestablecenquenopuedensermsde80horasanualesy,salvopactoalrespecto,
serncompensadasmediantedescansoenlos4mesessiguientesasurealizacin.

16. Qu deberes tienen los trabajadores?


Losdeberesquetieneuntrabajadorpresosonlossiguientes(art.6RD782/2001):
a)Cumplirconlasobligacionesdesupuestodetrabajoconarregloalasreglasdebuenafe,diligenciay
disciplina.
b)Observarlasmedidasdeseguridadehigieneeneltrabajoqueadoptelaempresa.
c)Cumplirlasrdeneseinstruccionesdelosfuncionarios,maestrosdetallerymonitoresenelejercicio
regularsusrespectivasfacultades.Ellmiteporsupuestoestenlacapacidadrealdeltrabajadoryenla
propiadignidadhumana,talycomoestableceelart.20delEstatutodeTrabajadores.
d)Contribuiraconseguirelcumplimientodelosfinesdeltrabajoy,ensucaso,delaproductividad.

17. Cmo se adjudican los puestos de trabajo?


LaJuntadeTratamientoadjudicarlospuestosdetrabajovacantesalosinternosenfuncindesuscarencias
ynecesidades.Elordendeprioridadeseselsiguiente:

a)Quienesprecisendeltrabajoproductivocomopartedesutratamientoindividualizado,deacuerdo
conunprogramaqueestablezcalaJunta.
b)Quienesseencuentrenpresosensituacindepenados,antesquelospreventivos.
c)Quienestenganobligacionesfamiliaresantesdequienescarezcandeellas.
c)Laaptitudlaboraldelinternoenrelacinconlascaractersticasdelpuestodetrabajo
d)Quienescuentenconmayortiempocumplidoenlaprisin.
d)Laconductapenitenciaria.
e)Lospreferentespormotivodecapacidadlaboraloconducta.
e)Eltiempodepermanenciaenelestablecimientopenitenciario.
g)Lascargasfamiliares.
h)Lasituacindelart.14.1RD:Conelfindepropiciarquelapreparacinparalainsercinlaboralnose
veainterrumpidaporuntrasladodecrcel,sielpenadohadesempeadodurantealmenosunaounaactividad
laboralvaloradapositivamenteporlacrceldeprocedencia,tendrprioridadalahoradeaccederapuestosde
trabajovacantesenlacrceldedestino(art.14RD782/2001).Encualquiercaso,sielinternoestrasladadosele
expedirunacertificacinacreditativadetodassuscircunstanciaslaborales(Art.14.2RD782/2001).

18. Qu ocurre con las categoras laborales y los ascensos?


El derecho a tener una categora concreta en el puesto de trabajo va ntimamente relacionado con la
necesidaddequecadatrabajadorconozcaconseguridadsusfuncionesdesdeeliniciodelarelacinlaboral.
Puedeserfijadaenelcontratodetrabajoovenirdeterminadaporlaconcretarealizacindetareasque
desempeeeltrabajadordiariamente.
ElEstatutodelosTrabajadores(TextoRefundidodelRealDecreto1/1995,de24demarzo)amplaelmargen
de la denominada movilidad funcional, esto es, la posibilidad de que el empresario pueda asignar al
trabajadortareasdiferentesalaspropiasdelacategoradeltrabajadoreincluso,excepcionalmente,podr
asignardiferentesdelgrupoprofesionalconcretoalquepertenezcasucategora.
Lamovilidadfuncionalseefectuarsegnelart.39.3delETsinmenoscabodeladignidaddeltrabajador
ysinperjuiciodesuformacinypromocinprofesional,teniendoderechoalaretribucincorrespondientea
lasfuncionesquerealice,salvoenloscasosenlosqueseencomiendafuncionesinferiores,enlosque
mantendrlaretribucindeorigen.,
LascategorasqueprevelReglamentoPenitenciarioelart.8delRD782/2001sonlasdeoperariosuperior
yoperariobase.Ladiferenciaentrelosprimerosylossegundosestenquelosprimeros,ademsde
desempear las tareas necesarias para el funcionamiento de los talleres productivos, colaboran en su
organizacinydesarrollo.Pero,comovemos,ladeterminacindecategorasquerealizaelReglamentoslo
serefierealrangoynoalasfuncionesenconcreto,porquestasvanadependerdeltipodetallerproductivo
enelqueseencuentrelapersona.
Elascensodeunacategoraalaotraseproducirporlaexistenciadeunavacanteenlacategorasuperior.Los
aspirantesdebernsuperarunapruebadeaptitudanteunrganocolegiadoenelqueestarnrepresentadoslos
internostrabajadoresdeltallerproductivoquesetrate.

19. Por qu causas se puede suspender la relacin laboral y qu efectos


genera?
Lascausasporlasquesepuedesuspenderlarelacinpenitenciariasonlassiguientes(Art.9RD782/2001):
a)Mutuoacuerdoentrelaspartes.
b) Incapacidad temporal de los trabajadores penitenciarios. (Esta situacin da derecho al percibo de
prestacinporincapacidadtemporal,queesunderechoquesegeneraaltiempoquesecotizaalaSeguridad
Social. Si la baja es Mdica que determina la incapacidad viene de accidente de trabajo o enfermedad
profesional,laprestacinseabonardesdeeldasiguientedelabajaeneltrabajo.
Siprovienedeenfermedadcomnoaccidentenolaboral,seabonardesdeeldacuartodespusdelabaja
enadelante.Duranteeltiempoenquesepermanezcaenbajamdicalaempresamantienelaobligacinde
continuarcotizandoporeltrabajador.
c)Maternidaddelamujertrabajadoraporuntiempode16semanasininterrumpidasampliablesporparto
mltiplehasta18semanas.Tambinsemantieneaqulaobligacindeseguircotizandoporlaempresa.
d)Fuerzamayortemporal
d)Suspensindeempleoysueldoporelcumplimientodesancionesdeaislamiento.
e)RazonesdetratamientoapreciadasporlaJuntadeTratamiento.
f)Portrasladosdelosinternossiemprequelaausencianoseasuperioradosmeses,ascomoduranteel
disfrutedelospermisososalidasautorizadas.
g)Razonesdedisciplinayseguridadpenitenciaria.

Encasodesuspensin,seinterrumpenlasobligacionesdetrabajarydeabonarsalario.Esbuenoquela
duracinycausadelasuspensinsereflejeporescrito,porquesucarctertemporaldaderechoalavueltaal
trabajounavezqueceselacausaquelamotiv(cuandounosecure,olevuelvanatrasladaraesacrcel,o
terminelasancindeaislamiento...),yafindequenoseconfundaendeterminadoscasosconunabaja
voluntariadeltrabajador.

20. Cundo se extingue la relacin laboral?


Elart.10RD782/2001establecequelarelacinlaboralpenitenciariapuedeextinguirse(finalizar)enlossiguientes
casos:
a)Pormutuoacuerdodelaspartes.
b)Porlaterminacinexpiracindeltiempoestablecidoolarealizacindelaobraoservicio.
c)Porineptituddelinternotrabajadorconocidaosobrevenidaconposterioridadaldesempeodelpuesto
detrabajoadjudicado.(Nocabequelaempresaseintenteacogeraestesupuestoenelcasoderealizacinde
funcionesdistintasalashabitualescomoconsecuenciadeunamovilidadfuncional,art.39.3delET).
d)Pormuerte,graninvalidez,oinvalidezpermanentetotaloabsolutadeltrabajadorpenitenciario.
Elpaseainvalidezpermanentetotal(laqueincapacitaparalarealizacindelastareasdelaprofesin
habitualdeltrabajador),oalainvalidezpermanenteabsoluta(incapacitaparacualquiertipodetrabajo)
extinguelarelacinlaboral.Sisetienenlascotizacionessuficientes,generaelderechoalcobrodeuna
prestacin por invalidez. La prestacin se calcula mediante un porcentaje determinado sobre la base
reguladoradelaprestacin(art.140delaLeyGeneraldelaSeguridadSocial,RealDecretoLegislativo
1/1994). Si la invalidez se califica como tal, el porcentaje es de un 55% sobre la base reguladora,
incrementada en un 20% si el trabajador tiene ms 55 aos. La invalidez absoluta da derecho a una
prestacinde100%delabasereguladora.
Lacalificacinyrevisinensucasodelainvalidezserealizaporlosequiposdevaloracindeincapacidades
y por las comisiones de evaluacin pertenecientes al Instituto Nacional de la Seguridad Social. El
procedimientoparaservaloradospordichostribunalesmdicospuedeseriniciadoporelpropiotrabajador
mediantesolicitud,oarazdelospropiosserviciosmdicosdelaAdministracin.
Normalmentelasituacindeinvalidezsederivadelasituacindeincapacidadtemporal.
Cuandolainvalidezseproduzcaarazdeaccidentelaboralonolaboral,oarazdeenfermedadprofesional,
nosernecesarioperodopreviodecotizacinalaSeguridadSocial.
Lainvalidezpermanentetotalpermiteprestarserviciosenpuestosdetrabajoalternativosalquesevena
desarrollando, cuyas funciones y tareas no tengan nada que ver con las que se venan realizando con
anterioridadalasituacindeinvalidez.Larelacinlaboralnotieneporquextinguirsesilaempresapuede
darocupacinaltrabajadorenotrotipodelaboresquenoincidanenlasdolenciasqueleprodujeronla
invalidez(esopcindelaempresa).Porejemploencasosdelumbalgiasqueocasionenunainvalideztotal,se
podremplearaltrabajadorentareasdetiposedentario.
Lagraninvalidezesaquellasituacinenlaqueeltrabajadornosloyanovaapodertrabajar,sinoque,
adems,necesitadeayudaparalarealizacindelasfuncionesvitalesbsicas.Aqu,laprestacinserdeun
150%sobrelabasereguladora,sisecumplenlascondicionesmnimasdecotizacin,salvoqueprovengade
accidentelaboralono,odeenfermedadprofesional,situacionesenlasquenoesnecesariocotizacinprevia.
Porsupuesto,siestandoenestassituacionesdeinvalidezabsolutaograninvalidez,seleconcedelalibertad
condicionalanticipadaporenfermedadgraveeincurable(arts.92CPy196RP),lasituacinencuantoala
prestacinporlainvalidezcontinua.
e)Porjubilacindelinternotrabajador.habercumplidoeltrabajador65aosdeedad.
Enestecasoeltrabajadortienederechoapensindejubilacinsisetieneunperiodomnimodecotizacina
laSeguridadSocialalmenos15aosentodasuvida,deloscualesalmenosdosdebernestarcomprendidos
dentrodelosquinceaosanterioresalos65aos(Ley24/1997,de15dejulio).
f)Porfuerzamayorqueimposibilitedefinitivamentelaprestacindetrabajo.
g)Porrenunciadelinternotrabajador.
h)Porlafaltadeadaptacindeltrabajadoralasmodificacionestcnicasoperadasensupuestodetrabajo,
siemprequehayantranscurrido,comomnimo,dosmesesdesdequeseintrodujolamodificacin.
g)Porexcarcelacindeltrabajadorpenitenciario.
h)Porcontratacinconempresasdelexteriorparalospenadosclasificadosentercergrado.
i)PorrazonesdetratamientoapreciadasporlaJuntadeTratamiento.
j)Portrasladodelinternotrabajadoraotroestablecimientopenitenciarioporunperiodosuperiorados
meses.
k)Porincumplimientodelosdebereslaboralesbsicosenlarelacinlaboralpenitenciaria.
k)Pordimisindelinternotrabajador,lallamadabajavoluntaria.
l)Porrazonesdedisciplinayseguridadpenitenciaria.
Enesteltimocaso,hemosdedestacarquealtratarsedeunaextincindelarelacinlaboralcuyabaseesla
indisciplinaoelpeligrodelaseguridadenelCentro,tienegranaproximacinaloqueelart.54delEstatuto
delosTrabajadorestildacomodespidodisciplinario.

Enstoscasos,laempresahadeprobarelincumplimiento,yquelacausadeindisciplinaestdealguna
maneraprevistaenlalegislacinpenitenciariaolaboral.Noessuficienteconalegarmotivosgenricostales
como"algunosinternosvieronque..."Hayqueespecificarcuntos,quienes,ascomoacreditarlaconductau
operacionesprohibidas(Auto395/00APMadridseccin5de22demarzode2000).
Encuantoalaposibilidaddequeunmismocomportamientorecibadosrespuestas.ElAutodelJuzgadode
VigilanciaPenitenciarianm.3deMadrid,de2denoviembrede1994,habladelprincipiononbisinidemque
implicalaimp