You are on page 1of 137

IVRECEPTORESPTICOS

El receptor es un elemento esencial en un


sistemadefibraptica.
La tarea fundamental del receptor es
convertir la seal ptica transmitida a travs
delafibraensealelctrica.
Un elemento fundamental en un receptor
pticoeseldispositivodetectordeluz.
DETECTORESDELUZ
Losdetectorestpicosusadosencomunicacionescon
fibra ptica son los fotodetectores o fotodiodos
semiconductores.
Losfotodetectores estnconstituidosporunionesp
n y deben ser polarizados inversamente para
detectarluz.
Si un fotn incide en la unin pn con suficiente
energapodr permitirlacreacindeunparelectrn
hueco gracias a la energa proporcionada por dicho
fotn.
Ambos portadores circularn en sentidos opuestos,
creando una fotocorriente (denominada as en
analoga con los fotoportadores) sobre el circuito
externo, la corriente generada es proporcional al
niveldeiluminacindeldispositivo.
DETECTORESDELUZ
Enlafotodeteccin sedaelprocesoinversoaldelasfuentes
deluz.

Unfotnincidente,conlongituddeondaadecuada,ceder su
energaaunelectrn,situadoenlabandadevalencia;gracias
a ella, ste ser capaz de saltar a la banda de conduccin,
producindosealmismotiempoelcorrespondientehuecoen
labandadevalencia.Esteprocesogeneraelyaconocidopar
electrnhuecoyporconsiguienteunacorrienteelctrica.

Paraqueunfotnhagasaltarunelectrndesdelabandade
valencia a la banda de conduccin, requiere tener una
energaporlomenosigualaEg,queconstituyelaenergade
labandaprohibida(1.12eV paraelSi,0.81eV paraelGe).
Laenergadeunfotnest relacionadaconsufrecuencia(o
longituddeonda).
DETECTORESDELUZ
frecuencia de corte, fc, mnima frecuencia de trabajo de un
fotodetector,puesstenopuederesponderafrecuenciaspor
debajodeella:
fc =Eg /h
h:constante dePlanck,6.62x1034 Js.

Longitud de corte, c: mxima longitud de onda a la cual


puederesponderunfotodiodo.

c =(ch/Eg)

Ejercicio: Para un fotodiodo de Si, determinar el rango de


longitudes de onda y frecuencias que garanticen su correcta
operacin.
DETECTORESDELUZ
Eldiseodelfotodiodosehacedetalmaneraquelos
portadoressegeneren,principalmente,enlaregin
intrnseca.

Dada la polarizacin inversa a la que se somete el


diodo, en la regin intrnseca aparece un campo
elctrico intenso, que provoca que los portadores
generados se separen dirigindose en sentidos
opuestos,dandolugaraunacorrienteelctrica.

La longitud de onda a la cual responde un


fotodetector dependedesucomposicin.
DETECTORESDELUZ
Los detectores de luz usados en receptores de fibra ptica
deben generar corrientes de salida altas y, en caso de no
hacerlo se deben incorporar en el receptor etapas de
amplificacin.
CARACTERSTICASDEUNDETECTOR:
Seraltamentesensitivo.Lasensitividadmidequ tanbienun
detector responde a una seal como una funcin de su
intensidad. Debiendo generar corrientes elctricas tan altas
comoseaposibleenrespuestaalaluzincidente.
Tiempo de respuesta corto. El detector debera responder
(producir corriente elctrica) al ms estrecho (de menor
duracin)posiblepulsodeluz.Estoleposibilitaratrabajara
altastasasdetransmisin.
Serequierelinealidad enelfotodetector afindeminimizarla
distorsindeseal.
Elruidointerno generadoporeldetectordeberasermnimo
parapermitirqueentradaspticaslomspequeasposibles
seandetectadas.
DETECTORESPIN
Un diodo PIN (PIntrinsicN) est constituido por dos capas
semiconductoras (p y n) y, entre las dos se sita una regin
intrnseca (no dopada o muy pobremente ndopada), con el
objetivodemejorarlasensitividaddeldispositivo.
Con esto se logra que ms fotones sean absorbidos y
produzcanasuvezunamayorfotocorriente.Estaestructura
sepolarizainversamentedemaneraquelareginintrnseca
est totalmentedesprovistadeportadores.
Laluzentraaldispositivoporunaventanamuypequeaycae
sobreelmaterialintrnsecocarentedeportadores.
El material intrnseco est hecho de un grosor tal que la
mayora de los fotones que entran en el dispositivo sean
absorbidosporestacapa.
Estos fotones entregan su energa a los electrones ubicados
en la banda de valencia del material intrnseco, los mismos
que pasan a la banda de conduccin y se transforman en
portadores de carga que hacen que una corriente elctrica
fluyaporeldispositivo.
Lacantidaddecorrienteseincrementaconlacantidaddeluz
absorbidaporeldispositivo.
DETECTORESPIN
La adicin de la capa i (intrnseca) incrementa la
responsividad (reponsivity) y decrementa el tiempo de
respuesta deldetector.
LaaltavelocidadysensitividaddeundiodoPINlohacenmuy
adecuadoparagranpartedelossistemasdefibra,inclusoen
sistemas de gran desempeo. Usando preamplificadores
electrnicossepuedeaumentarlasensitividaddelreceptor.
A la sensitividad tambin se le denomina Responsividad o
factor de respuesta y mide la relacin que existe entre la
corriente que entrega el detector y la potencia ptica que
recibe,seevalaenA/W.Valorestpicos0.5a1A/W.
Tiempo de respuesta: Mide cun rpidamente el detector
puede responder a variaciones en la intensidad de la luz de
entrada,tiemposderespuestatpicososcilanenpocosns.
Un diodo PIN puede operar con voltajes de polarizacin
inversa en el orden de 8 a 10 V. Un incremento en la
polarizacin inversa tiende a producir una respuesta ms
rpidaeneldispositivofotodetector.
DETECTORAPD
Un detector APD (Avalanche Photo Diode) basa su
principio de funcionamiento en la multiplicacin
avalancha,consiguiendoamplificarlasealduranteel
procesodedeteccin.

Su fabricacin es similar a la del diodo PIN, pero en


estecasolareginintrnseca(denominadaregin)es
agrandada y ligeramente pdopada y cuidadosamente
diseadaparaaseguraruncampoelctricouniformea
travsdeella.
DETECTORAPD
Paraproducirelefectoavalanchaesnecesario
suministrar al diodo un alto voltaje en
polarizacin inversa, que genera la presencia
deunintensocampoelctrico.
La luz (fotones) que incide en el dispositivo
genera electrones a nivel de la banda de
conduccin, los cuales son acelerados por
accin del campo elctrico hasta que chocan
con los tomos de la estructura liberando
mltiples electrones, los cuales a su vez son
acelerados por el campo elctrico
produciendo ms electrones y, as
sucesivamente se suscita un fenmeno en
cadena(avalancha).
DETECTORAPD
Un electrn fotogenerado puede llegar a
producirpor efecto avalancha 100 electrones
libres(gananciaoamplificacin).
Tienen mayor responsividad (25100 A/W),
son ms sensibles que los PIN, pudiendo
detectar niveles de seal ms dbiles y
requierendemenosamplificacinadicional.
Los APD presentan menores tiempos de
respuesta que los PIN (pocos ns), pero
generanmayorruidoporelprocesoavalancha
que tiene lugar, adems presentan mayor
sensibilidad a variaciones de temperatura
(estabilidadtrmica).
DETECTORAPD
El voltaje de polarizacin inversa para
producirelefectoavalanchaenundiodoAPD
es alto (40400 V), se requieren circuitos
adicionales para proveer tales voltajes de
excitacin.

Dada la alta sensibilidad a la temperatura de


estos detectores, se requiere circuitos
especialesparacompensarla.

Todo esto torna al APD en un detector ms


caro y complejo que el PIN y ha limitado sus
aplicaciones.
DETECTORES
Algunosreceptoresrenenlasfuncionesdedetector
y de amplificador (o preamplificador) en un mismo
circuito.
Elcircuitoamplificalasealelctrica,incrementando
la relacin S/N y la potencia de salida. Adems,
conviertelasealdecorrientedelfotodiodoenseal
de voltaje, como se usa en la mayora de circuitos
electrnicos. Puede incluir control automtico de
ganancia, de modo que el nivel de voltaje es
compatibleconetapasdeamplificacinposteriores.
Dentro de esta variedad de detectores podemos
citar: Fototransistores, Fotodarlington, PINFET,
fotodiodosSchottkyBarrier,etc.
OTROSDETECTORES
LosdetectoresPINFETintegrantantoalfotodiodoPINcomo
alamplificadorFET,tienenungrananchodebanda,sonmuy
populares para aplicaciones de velocidad moderada por su
simplicidad y costo razonable. A diferencia de los APD, no
requierenvoltajesdepolarizacindemsde5V.Su tiempo
desubidatiendeasermslentoqueenlosPINyAPD,pero
sonmuyapropiadosparatransmitircientosdeMbps.
Los fotodiodos SchottkyBarrier no son actualmente usados
en equipos de comunicaciones, pero son materia de ardua
investigacintodavezqueprometenvelocidadesmuchoms
altasymayoreficiencia.
En general los fotodetectores vienen en variados
empaquetados. Algunos tienen lentes, algunos tienen reas
sensitivas cuadradas o redondas. El material usado para la
ventana(estoeslaaberturaenelfotodetector queexponeel
reaactivaalaluzincidente)puedesersimplevidrio,lentede
vidriooresina.
RECEPTORESPTICOS
Un receptor ptico puede ser tan simple como limitarse al
detector ptico o tan complicado que incluya sofisticados
sistemasquerealizanunconsiderableprocesamiento.
Un amplificador ptico puede incorporarse antes del
detector, incrementando la potencia de la seal ptica, lo
cual puede conllevar a un menor BER o una mejor relacin
S/N en el receptor, as tambin permitira compensar
cualquierprdida.
Un amplificador ptico incrementa la potencia de todas las
longitudes de onda de la seal WDM, por tanto debera
ubicarse antes de la etapa de demultiplexacin. Si la fibra
lleva muchas longitudes de onda (WDM), stas deberan
separarse antes de que la seal ptica se convierta en seal
elctrica.
El rol de un receptor es reproducir exactamente la seal
recibida a travs de la fibra. Dos caractersticas bsicas
afectan esta reproduccin: el nivel de la seal y el nivel del
ruido,quepuedenoscurecerodegradarlaseal.
El BER (mximo nmero de bits errneos admisibles en
recepcinconrespectoalnmerototaldebitspresentesen
emisin) que habitualmente se exige en los sistemas
10
de
transmisin digital por fibra ptica es 1x10 , lo que
correspondeaunarelacinS/Nenelreceptorde22dB.
RECEPTORESPTICOS
Parasistemasanalgicos,larelacinsealaruido(S/N)mide
la calidad del sistema, a mayor S/N mejor recepcin. La
definicin prctica de una buena S/N depende de la
aplicacin. En muchos sistemas de fibras pticas, entre 40 y
50dB seconsideradebuenoaexcelente,perorelacionesde
S/N en el rango de 30 dB son aceptables para muchas
aplicaciones.
En sistemas digitales, la calidad del sistema es dada por el
BER, parmetro que depende de la potencia recibida, de la
sensibilidad,delruido,ydelavelocidaddetransmisin.
Un decrecimiento de 5 dBm en la potencia recibida puede
incrementarelBERde1012a 103.ElBERdependetambinde
lavelocidaddedatos.Lametatpicaparatelecomunicaciones
es un BER de 109, pero en ciertas aplicaciones se necesitan
valoresdeBERdelordende1012.
LarelacinS/NyelBERsonimportantesparalaseleccindel
receptor.Estosparmetrosmideneldesempeodelsistema,
que depende tambin de la salida del transmisor y de las
prdidas del enlace. Sin embargo, tambin es relevante la
sensibilidaddelreceptorparaeldesempeototaldelsistema.
RECEPTORESPTICOS

Entrelascaractersticasmsimportantesque
debe poseer un receptor ptico, figuran las
siguientes:
respuestarpida
altorendimiento
bajonivelderuido
altasensibilidad
anchodebandasuficiente
ligero,baratoydelargavida.
PERFORMANCEDEUNRECEPTORPTICO

a)Sensitividadradiante/Responsividad
Responsividad (R) o factor de respuesta, es la relacin que
existe entre la corriente que entrega el detector
(fotocorriente) y la potencia ptica que recibe, se evala en
A/W.

R=Ielect salida /Popt entrada [A/W]


Lasensitividadmidecmounreceptorrespondeaunaseal
deluzacordeconlaintensidaddelamisma.
Tantolapotenciadelasealpticaqueincideenelreceptor
comoelnivelderuido(quetiendeaobscurecerydegradarla
seal)afectaneldesempeodelmismo.
Enunsistemaanalgico,mientrasmayorsealarelacinS/N,
mejor ser la calidad de la seal recibida y la respuesta del
receptor.Enunsistemadigitalundecrementoenlapotencia
pticarecibidapuedeincrementarelBERsignificativamente.
PERFORMANCEDEUNRECEPTORPTICO
La sensitividad de un receptor tambin depende de
la longitud de onda de la seal de luz que a l
ingresa.
Los principales factores que controlan cmo un
receptor responde a diferentes longitudes de onda
es la composicin del detector, pues cada tipo de
semiconductor responde a distintas longitudes de
onda.Elsiliciorespondemejora menoresa1um,
mientrasqueelgermanio,arseniurodeindioygalio
y el fosforoarseniuro de indio y galio responden
mejora msgrandes.
Detectores basados en fototransisitores, PINFET o
fotodiodosAPDtienenunaaltaresponsividad,dado
elprocesodeamplificacinquetienelugarenellos.
PERFORMANCEDEUNRECEPTORPTICO

Un parmetro relacionado es la eficiencia


cuntica, definida como la relacin entre los
electrones de salida y los fotones de entrada al
detector.
Debe considerarse que no todos los fotones
incidentesproducenelectrones.
Laeficienciacunticadeldetectordepender del
materialqueloconstituya,desuestructurayde
lalongituddeondadetrabajo.
Q =#electronesdesalida/#fotonesdeentrada
Eficiencia cuntica

Si Ge
100 InGaAs

80

60

InGaAsP
40

400 600 800 1000 1200 1400 1600 1800 nm


PERFORMANCEDEUNRECEPTORPTICO

Laeficienciacunticapuedesermayora1sloenlos
detectoresqueincorporanamplificacin.
Factor de multiplicacin: factor de proporcionalidad
entre cada electrn primario y los electrones
secundariosgeneradoseneldetector.
Existe una relacin entre la eficiencia cuntica y la
responsividad:

R=Q /1.24[A/W]
PERFORMANCEDEUNRECEPTORPTICO

Ejercicio: Unfotodetector tieneunaeficiencia


cunticadel70%yoperaconunalongitudde
onda de 0.82 um. Determinar su
responsividad.
PERFORMANCEDEUNRECEPTORPTICO
b) Corriente de oscuridad y Potencia de ruido
equivalente(NEP)

Lasealelctricaquesaledeldetectortieneruido,partedel
cual es generado dentro del detector o aadido por el
amplificador.
Una medida del ruido elctrico inherente dentro de un
detector es la corriente de oscuridad, la cual no es sino la
corriente(deruido)queundetectorproducecuandono est
iluminado y, establece un nivel de mnima seal detectable,
puesto que una seal para ser detectada debe producir una
corrientesuperioraladeoscuridad.
Lacorrientedeoscuridadesunacorrientedefuga quefluye
por el fotodiodo en ausencia de luz (generada por efectos
trmicos), depende de la temperatura de operacin, del
voltajedepolarizacinydeltipodedetector.
PERFORMANCEDEUNRECEPTORPTICO

Potenciaequivalentederuido(NEP)

Parmetroquemidedemaneramsdirectaelmnimonivel
desealdetectable.
Representa la potencia ptica requerida en la entrada del
detector para generar una corriente elctrica rms igual a la
corriente de ruido para un valor determinado del ancho de
banda.
Este parmetro NEP se mide en (W/Hz1/2), dado que la
corrientederuidoesproporcionalalanchodebandausado.
Losdetectoresdegermanio sonmsruidososylentos.
NEP depende de la frecuencia de la seal, del ancho de
banda, del rea del detector y de la temperatura de
operacin.
Detector Responsivi- NEP Tiempo Corriente de
dad (W/Hz1/2) de Oscuridad
Respuesta

Fototransistor 18 A/W N.A. 5 15 us 25 100 nA

Fotodiodo P-N 0.4-0.7 A/W 10-13-10-14 5 10 ns 1 5 nA

Fotodiodo PIN (Si) 0.6-0.8 A/W 10-13-10-14 1-5 ns 3-300 nA

Fotodiodo PIN 0.8 A/W 10-13-10-14 1-3 ns 10-30 nA


(InGaAs)
Fotodiodo 74-100 A/W 10-14 0.5-2 ns 1 nA
Avalancha (Si)
PERFORMANCEDEUNRECEPTORPTICO
c)Velocidadyanchodebanda
Los detectores no responden de manera instantnea a
cambios en la entrada, hay un retardo entre el tiempo que
entralaluzaldetectoryeltiempoqueeldetectorgenerala
corrienteelctricacorrespondiente.
La seal elctrica de salida del detector viene caracterizada
por los tiempos de subida (rise time, tr) y los tiempos de
bajada(fall time,tf).
Elanchodebanda(RespuestadeFrecuencia)deundetector
tpicamente se define como la frecuencia a la cual su
respuesta ha decado 3dB y, suponiendo que el tiempo de
subida es igual al tiempo de bajada, el ancho de banda
dependedetr,deacuerdoalasiguienteexpresin:

AB3dB =0.35/tr
Tiempo de subida: Tiempo que le toma a la seal de salida
parapasardel10%al90%desuvalorfinal.Anlogamenteel
tiempo de bajada es el tiempo que demora dicha seal en
caerdesdeel90%desuvalormximohastael10%.
PERFORMANCEDEUNRECEPTORPTICO
Los tiempos de subida y de bajada afectan directamente al
anchodebandaoalavelocidaddeunreceptor.Elanchode
bandadeundetectoresinversamenteproporcionalaltiempo
derespuesta.
Los fotodarlingtons son los detectores ms lentos, con
tiempos de respuesta del orden de los us. Los fotodiodos
avalanchayPINrpidostienetiemposderespuestadelorden
de los ns. Los detectores ms rpidos tienen tiempos de
respuestaenelrangodelosps.
La geometra del detector puede influenciar su velocidad y
sensitividad.
Para que un detector opere eficientemente, toda la luz que
emerge de la fibra debe caer dentro del rea activa (rea
sensitivaalaluz)deldetector.
Elreaactivadeldetectordebesermayoraldimetrodela
fibra; sin embargo, se pueden tener prdidas si la fibra est
lejosdeldetectorosieldetectorest malalineado.
Lavelocidaddeldetectorest limitadaporsurea,mientras
el dispositivo es ms grande mayor es su tiempo de
respuesta.
Rangodinmicodeldetector
Eselrangocomprendidoentreelvalordelamnima
potencia ptica presente a la entrada del conversor
optoelectrnico que garantiza la obtencin del BER
deseadoyelvalordelamxima potenciapticaque
es capaz de soportar el receptor ptico sin que se
produzca variacin alguna en el BER especificado
(prefijadoanteriormente).
La potencia de las seales que ingresan al detector
debe estar dentro del rango dinmico del mismo
paraevitarqueseproduzcadistorsin.
Silasealdeentradatieneunvalormuyalto(fuera
delrango)producir unnivelderuidoelevadoenun
sistema analgico o un BER elevado en un sistema
digital.
PERFORMANCEDEUNRECEPTORPTICO
Sensibilidaddeldetector
Se define como la mnima potencia ptica presente en la
entrada del conversor optoelectrnico necesaria para
obtenerunBERdeseado.

Correspondeportantoalvalordepotenciapticainferior
delrangodinmicodelreceptor.

SeexpresaenunidadesdepotenciaelctricadBm ouW y
siempreparaunBERespecfico.

Vergrficadondesecomparalasensibilidadenfuncinde
lavelocidaddetransmisinentretresclasesdedetectores
pticos,paraunalongituddeondade1300nm yunatasa
debitserrados(BER)de109.
PERFORMANCEDEUNRECEPTORPTICO
La sensibilidad del detector (y del receptor completo)
dependedelalongituddeonda.

El rango de longitudes de onda de operacin de los


detectoresdependedelmaterialdelqueest hecho.

Lascaractersticaselctricas,talescomolavelocidady
lacorrienteoscura,tambindifierenconelmaterial.

LosdetectoresdeGesonmslentosyruidososquelos
deSiuotrosmateriales.

La sensibilidad del detector tambin depende de la


temperatura.
ESTRUCTURADEUNRECEPTORPTICO
Las funciones bsicas de un receptor ptico incluyen la
deteccin,laamplificacinylademodulacin.

El receptor debe incluir en su estructura un circuito


electrnico que eleve la seal elctrica generada a un
nivelsuficientecomoparaquepuedaserposteriormente
procesada.

Las seales de salida del fotodiodo constituyen


corrientes muy bajas que requieren amplificacin y
muchasvecesconversinavoltaje.

Adicionalmente, pueden requerir una reconstruccin de


los pulsos deformados, regenerando las seales para
transmisin digital, o filtrando el ruido introducido. En
muchas ocasiones esta etapa electrnica est ya
incorporada al propio fotodetector, formando un
mdulonico.
Detector Preamplifi Amplificador
luz Demodulador Out
cador de elctrica
bajoruido
ESTRUCTURADEUNRECEPTORPTICO

a)Detectordeluz

Conviertelasealpticarecibidaenunasealelctrica
Puede ser de diferente naturaleza, siendo los ms utilizados
losdiodosPINylosdiodosAPD.
ESTRUCTURADEUNRECEPTORPTICO
b) Preamplificador de bajo ruido y Amplificador
principal
Amplificanlasealelctricaentregadaporeldetectordeluz,
afindeponerlaenunniveladecuadoparaquepuedaservir
comosealdeentradaaldispositivoterminal.
Tpicamentelassealespticasquelleganaunreceptorson
del orden de 110 uW o menores, si un fotodiodo PIN con
responsividad de 0.60.8 A/W detecta estas seales,
entregar corrientesenelrangodelosuA,lasquedebenser
amplificadas para la mayora de usos y en algunos casos
convertidasavoltajes.
Los receptores pueden incluir una o ms etapas de
amplificacin; la primera de ellas es un preamplificador de
bajoruidoaptoparatrabajarconsealesdbiles.
Acontinuacinseincorporaunamplificadordealtaganancia,
quepuedeincluircontrolautomticodeganancia.Enalgunos
casosseincorporatambinunaetapadeecualizacin,lacual
es requerida en virtud de que la deteccin y amplificacin
puedendistorsionarlasealreciba.
ESTRUCTURADEUNRECEPTORPTICO
c)Filtrado
Ayuda a incrementar la relacin S/N al atenuar el ruido de
maneraselectiva,opuedeserdeutilidadensistemaspticos
paraeliminaraquellasfrecuenciasindeseadasqueestncerca
delasealdeseada.
d)Demodulador(discriminador)
Permitereproducirlasealelctricaoriginal.
Losreceptoresanalgicosydigitalesusandetectoresdeluzy
amplificadoressimilares;perodifierenenlaltimaetapa.
Los sistemas analgicos requieren una reproduccin precisa
de la forma de onda original, pues cualquier cambio implica
distorsin y, una vez que la seal se distorsiona, para los
circuitos no es posible discriminar qu es seal y qu es
distorsin.
Los sistemas digitales en cambio, no requieren una rplica
exactadelaformadeonda,puessolamenteprecisandecidir
silasealeson (pulsoenalto)uoff (pulsoenbajo),tareaque
larealizauncircuitodetomadedecisininclusoenpresencia
dedistorsin.
ESTRUCTURADEUNRECEPTORPTICO
e)Temporizacin
Otratareaesencialenmuchosreceptores,especialmenteen
los sistemas de alto desempeo, es la de resincronizar la
seal.
Elcircuitodetemporizacin delreceptordeberecrearlaseal
de reloj (extrayndola desde la seal recibida) y poner los
pulsos regenerados dentro de los slots de tiempo correctos,
esdecirdebedefinirconprecisinlosinstantesdetiempoen
losqueempiezanyterminanlospulsos.
Las seales digitales (pulsos) son generadas a una tasa de
reloj definida. Esta seal, durante su recorrido por la fibra,
incorpora gradualmente errores aleatorios en la
temporizacin,enalgunoscasosestadesincronizacin puede
sercomparableconladuracindelospulsos.Demodoqueel
receptor puede confundir los pulsos sucesivos, causando
erroresdetransmisin.
ESTRUCTURADEUNRECEPTORPTICO
Consideracionesdeencapsulado:

Losprincipalesrequerimientosmecnicossonlosmontajes.
Losinterfaceselectrnicosdebenpermitirentradasparaelvoltaje
de polarizacin y de amplificadores de potencia (donde se
necesiten)ysealesdesalidaenelformatorequerido.
Losrequerimientosdelinterfazpticosonmssimplesqueparalos
transmisoresporquetransferirlaluzdelafibraaldetectores ms
simplequegenerarla.
Lasreasactivasdeldetectorsonmayoresquelasreasdeemisin
delamayoradefibras;deestamanera,simplementejuntandola
fibracontraeldetectoressuficienteparalamayoradepropsitos.
Los receptores de corta distancia usados en las fibras monomodo
vienenconconectoresquecalzanconlosdelasfibras.
Elconectorencualquiercasoenvalaluzdirectamentealdetector
oalafibraquelallevaaldetector.
AMPLIFICADORES
Las seales necesitan amplificacin si ellas viajan
distanciasconsiderablesbienseaatravsdemedios
metlicosodefibra.
Dada la baja atenuacin de las fibras, los sistemas
pticos pueden lograr alcances ms grandes sin
amplificacin.As unsistemadecobre,trabajandoa
cientos de Mbps requiere amplificadores o
regeneradorescadaKm aproximadamente,entanto
que un sistema de fibra puede llevar seales a la
mismavelocidadhastacentenasdeKm.
Setienendosalternativasparaamplificadoresenun
sistemaptico:electrnicayptica.
AMPLIFICADORESELECTROPTICOS
Los repetidores y los regeneradores electropticos
convierten la seal ptica en elctrica antes de amplificarla,
luego la amplifican, regeneran y finalmente la vuelva a
convertir en seal ptica para que contine viajando por el
siguientetramodefibra.

La regeneracin puede ser importante en sistemas con


distancias largas, en los cuales el ruido y la dispersin del
pulsopuedenacumularsedegradandolaseal.

Laregeneracinest limitada a los sistemas digitales, donde


los pulsos hacen posible la discriminacin entre el ruido y la
seal.

Siemprequelospulsospuedanserreconocidoscomotales,el
regenerador puede producir nuevos pulsos con la misma
temporizacin e informacin de seal. Los receptores, sin
embargo,notienenformaderemoverelruidodelasseales
analgicas,yaquelosrepetidoresloamplifican.
AMPLIFICADORESELECTROPTICOS

Este tipo de amplificadores era de uso comn


hastahacealgunosaos;sinembargo,limitaban
en parte las ventajas inherentes a las
transmisionesporfibracomograndesanchosde
banda,conlaconsiguientemuyaltavelocidadde
transmisin.
Elrequerirunaconversinpticaelctricaptica
impone una limitacin a todo lo anterior dado
que, en esas condiciones, la velocidad vendr
limitada a la de los circuitos electrnicos
empleados.
AMPLIFICADORESPTICOS
Un amplificador ptico recibe una seal ptica dbil, la
amplificaafindeproducirunasealpticafuertequepuede
viajaradecuadamenteporelsiguientetramodefibra.
Los amplificadores pticos actuales no regeneran la seal,
solamente incrementan su amplitud as como el ruido. Son
por tanto sistemas ms simples que los regeneradores
electropticos.
Su demanda se ha incrementado significativamente, son
costosos an pero producciones masivas tienden a bajar los
costosnotablemente.
Losamplificadorespticosofrecenaltaconfiabilidad,porque
contienen pocos componentes. Esto es crtico para cables
submarinos, porque cambiar repetidores daados ubicados
enelfondodelmaresmuydifcilycostoso.
Losamplificadorespticostienenunnivelderuidomuybajo.
AMPLIFICADORESPTICOS
Losamplificadorespticospuedenamplificarcualquierseal
quelafibrapticaest transportando,dentrodesurangode
operacin.
Los AO pueden amplificar simultneamente seales de
diferenteslongitudesdeondaensubandadeoperacin.Por
ejemplo, un amplificador ptico puede amplificar seales a
1530, 1540 y 1550 nm, sin que existan interferencias entre
ellas,mejorarando lascapacidadesdetransmisindeunared
instalada.
Un solo amplificador ptico puede amplificar
simultneamente muchas seales multiplexadas WDM
transportadasenlamismafibra.
Los amplificadores pticos no dependen del formato de la
seal.
Las seales pticas pueden requerir amplificacin en
diferentes puntos: luego de la salida del transmisor
(postamplificadores), luego de un tramo de fibra
(amplificadores en lnea), despus de un componente con
prdidas p.e acoplador, conector o empalme ;y, antes de
unreceptor(preamplificadores).
AMPLIFICADORESPTICOS
Durante los ltimos aos, los amplificadores pticos han
reemplazadoasuscontraparteselectropticas.Bsicamente
existen dos clases de amplificadores pticos: los de
semiconductorylosdefibra.
Estos amplificadores operan con el principio de la emisin
estimuladaqueeslabasedeloslsers,ysonesencialmente
lsers de propsitos especiales diseados para amplificar
seales de una fuente externa en vez de generar su propia
luz.
Amplifican un haz de luz dbil que ingresa por el lado de
entrada,yproduceunasealfuertequesaleporelotrolado.
Unaspectocrticoparaelusodelosamplificadorespticoses
su longitud de onda de operacin, la cual determina su
compatibilidadconlossistemasexistentesycmopuedenser
insertadosenlossistemasnuevos.
Los mejores amplificadores pticos son para la ventana de
1550nm.
AMPLIFICADORESPTICOSDESEMICONDUCTORES
Son bsicamente lsers semiconductores sin cavidad
reflectiva (sin espejos), a fin de que puedan actuar no como
fuentesdeluzsinocomoelementosamplificadoresdelaluz
quepasaatravsdeellos.
Los extremos del lser estn recubiertos de materiales que
reducen la reflexin de la luz, originada en la superficie
posteriordelsemiconductor.
La luz proveniente de una fibra entra por un lado del
integrado,esamplificadaenlacapaactivaysaleluegoporel
otro lado. La seal de salida se aplica al siguiente tramo de
fibra.
Se los conoce tambin como amplificadores de
semiconductor, amplificadores de lser semiconductor (SLA)
oamplificadoresosciladoresdesemiconductor(SOA).
Puedentrabajartantoensegundacomoenterceraventana,
propiedadquenoofrecenlosotrosamplificadores.
Losamplificadoressemiconductoresporsureducidotamao
puedenserintegradosconotroscomponentespticos,porsu
bajocostosonmuyutilizados.
AMPLIFICADORESPTICOSDE
SEMICONDUCTORES
Unadesventaja,quelimitasuuso,esladificultaddeacoplar
lafibraalamplificador(loquenoocurreconlosEDFA).
Otro problema es el derivado del ruido que genera la
estructurayqueessuperioralquegeneranlosEDFA.
La tecnologa de los SOA est bien desarrollada, y estn
disponibles para un amplio rango de longitudes de onda
dependiendodelacomposicindelmaterial.
Este tipo de dispositivos tienen la particularidad de poder
conmutarsealespticasy ser muy rpidos, lo que los hace
atractivosparaserusadoscomoswitches pticos.
Otraposibilidadesintegrarunamplificadordesemiconductor
con un conmutador ptico o acoplador, fabricado dentro de
unaguadeondadesemiconductor.
Amplificadordefibradopadodeerbio(EDFA,
Erbium Doped Fiber Amplifier)
Estetipodeamplificadoressurgieronenladcadadelos90y
puede decirse que, en cierta manera, han desplazado a los
amplificadorespticosdesemiconductor.
Tambinconocidoscomoamplificadoresdefibraptica(OFA,
Optical Fiber Amplifier).
Operana longitudes de onda en el rango entre 1520 y 1630
nm,aunqueparaalgunaslongitudesdeondadentrodeeste
rango su implementacin prctica an no est muy bien
desarrollada.
Estos amplificadores se caracterizan por tener una alta
ganancia(tpicamente3050dB),bajoruidoyampliaanchura
espectral. Potencia de salida en el orden de las decenas de
dBm. Conexin con bajas prdidas y pequeas no
linealidades.
Amplificadordefibradopadodeerbio(EDFA,
Erbium Doped Fiber Amplifier)
UnamplificadorEDFAsecomponeesencialmentedeundiodo
lser y una seccin de fibra (longitud tpica 1020m, mayor
longitud para trabajo en la banda L) dopada con impurezas
constituidasportierrasraras,depreferenciaerbio(Er).
Los EDFA pueden amplificar seales de luz dbiles de
cualquierlongituddeondadentrodesurangodeoperacin,
lalongituddeondadeoperacindependedeldopante ydela
composicindelafibra.
Ellser(lser debombeo)eselencargadodesuministraruna
radiacin infrarroja (9801480 nm), que es absorbida por los
tomosdeerbio,loscualespasanaunestadoexcitado.
Lasealdeluzentranteestimulaalostomosexcitadospara
queemitanluzalalongituddeondadelasealyenfasecon
ella,loqueproducelaamplificacin.
Amplificadordefibradopadodeerbio(EDFA,Erbium
Doped Fiber Amplifier)
Como elementos adicionales del EDFA se tienen dos
aisladorespticos uno acadaextremo quepermitenelpaso
de la luz slo en una direccin, un filtro para bloquear las
longitudesde onda del lser de bombeo y, un acoplador al
finaldelafibra parasepararlasealdesalidadelalongitud
deondadebombeo.
Elerbiosueleserelelementomsusadocomodopajedelas
fibras, por su adaptacin a las condiciones de la tercera
ventana.
Las fibras dopadas con praseodimio, en cambio, son los
mejores amplificadores disponibles para la ventana de los
1300 nm, pero su desempeo no es tan bueno como el del
erbio.
Hay dos posibilidades: que la radiacin de bombeo se
propagueenelmismo sentido de la seal, o que lo haga en
sentidocontrario(mayorganancia).
Amplificadordefibradopadodeerbio(EDFA,Erbium
Doped Fiber Amplifier)
Un acoplador colocado al final de la fibra dopada enruta la
sealamplificadahacialafibrasaliente,separndoladelade
bombeo.
La bomba lser opera continuamente y tiene que proveer
fotones con ms energa que la que emiten los tomos
dopantes.
De esta forma, la longitud de onda bombeada es ms corta
queladelaseal.
Elamplificadordefibrageneraluzalalongituddeondadela
seal solamente cuando una seal de entrada est
atravesndolo.Cuandoelniveldeentradaescero,nodebera
producir luz; sin embargo, puede emitir un poco de luz,
consideradacomoruido.
Los amplificadores pticos trabajan con emisin estimulada,
de modo que la luz amplificada est en fase con la seal de
entrada.
Amplificadordefibradopadodeerbio(EDFA,
Erbium Doped Fiber Amplifier)
Unasealpticadbilentraporlaizquierda,pasaatravsde
un aislador ptico (cuyo bloqueo dispersa la luz que podra
causar ruido) y por un filtro que permite el paso de la
longitud de onda de la seal entrante pero bloquea la
longitud de onda del lser de bombeo. Esta seal entra
entoncesaladefibradopada.
El amplificador de fibra es iluminado desde el otro extremo
por un haz fuerte de luz de longitud de onda ms corta,
generadoporunlserdebombeoexterno.
La luz de bombeo excita los tomos del material dopante,
elevndolos a un nivel ms alto de energa, y estimulando a
estostomosexcitadosparaqueemitansuexcesodeenerga
enformadeluzalalongituddeondadelasealentrante,y
enfaseconlamisma.
La potencia de la luz de bombeo est en el orden de las
decenasmW.
Amplificadordefibradopadodeerbio(EDFA,Erbium
Doped Fiber Amplifier)
Las fibras dopadas con Praseodimio pueden amplificar la luz
entre1280y1330nm cuandosonbombeadasconunlsera
1017 nm, pero utilizan potencias de bombeo del orden de
cientos de mW, 10 veces superiores a las potencias de
bombeodelosEDFA,puedenconseguirgananciasdehasta30
dB (enrgimendebajasealdeentrada).
El desempeo de los amplificadores de fibra depende del
material de la fibra y de los elementos dopantes, ya que el
materialanfitrinafectalaestructuradelniveldeenergadel
dopante.Elgradodeamplificacinadiferenteslongitudesde
ondapuedediferirgrandementeconlosmateriales.
UnagranventajadelErbioesquetrabajabien confibrasde
xidodesilicioquesonlasmscomunes.
El Praseodimio no trabaja bien con con fibras de xido de
silicio,perosiconfibrasdevidriosfluorados.
El Neodimio cuando es material dopante no amplifica la luz
entre1300y1310nm.
Amplificadordefibradopadodeerbio(EDFA,Erbium
Doped Fiber Amplifier)
Con los EDFA se consiguen ganancias de hasta 50 dB (en
rgimendebajasealdeentrada),conpotenciasdebombeo
moderadas(devariasdecenasdemW).
Se utilizan otros mecanismos de bombeo consistentes en
codopar alafibraconiterbioybombearconluzde980nm,
que provoca la excitacin de los iones de iterbio con gran
eficiencia, que se transfiere posteriormente a los iones de
erbio,aumentndoselaeficienciadebombeo.
Lasiguientefiguramuestracmocambialaamplificacin(en
dB) con relacin a la longitud de onda y a la potencia de
entradadeunamplificadordefibradopadaconErbio.
Conpotenciasdeentradabajas,lagananciaesmayora1530
nm, pero con mayores potencias de entrada la ganancia se
hacemsuniformeconlalongituddeonda.
Ganancia (dB)
POTENCIA DE
40 ENTRADA
35

30
1 W
25

20 70 W

15 1mW
10

0
1520 1525 1530 1535 1540 1545 1550 1555 1560 nm
Amplificadordefibradopadodeerbio(EDFA,Erbium
Doped Fiber Amplifier)
Los EDFA son muy buenos, pero generan pequeas
cantidades de ruido debido a un proceso llamado
emisin espontnea amplificada. Cuando el lser
excitaalostomosdeErbio,stosesperanporuna
seal de entrada que libere su energa, algunos
tomosdopantes noesperanestasealyemitenluz
deformaespontneaenelrangodelos1550nm.
Losamplificadoresdefibranopuedencompensarla
dispersin en la transmisin. Si hay dispersin la
sealseamplificacondispersinytodo.
Es muy importante controlar la dispersin en
distancias grandes. Una alternativa es utilizar fibras
de dispersin desplazada para producir menor
dispersina1550nm.
Amplificadordefibradopadodeerbio
(EDFA,Erbium Doped Fiber Amplifier)
Los EDFA son capaces de conseguir seales
amplificadasdevariosvatiosdepotencia,con
lapotenciadebombeoadecuada.
Aestos niveles de potencia hay que tener en
cuenta los efectos no lineales que se
producen en las fibras que pueden perturbar
a las seales que se propagan, por lo que es
preciso determinar cuidadosamente el valor
mximo de potencia que cada tipo de fibra
permite.
Amplificadordefibradopadodeerbio(EDFA,Erbium Doped
Fiber Amplifier)
En WDM los amplificadores pticos amplifican
simultneamente todas las seales multiplexadas,
cuyas longitudes de onda se encuentren dentro del
espectrodegananciadelosamplificadores.
Lafaltadeplaneidaddelacurvadegananciadelos
EDFAhacequesealesdediferentes longitudesde
onda puedan alcanzar potencias muy diferentes. Se
han desarrollado varios mtodos de aplanamiento:
usaraltas concentraciones dealuminioen el ncleo
de las fibras dopadas, usar filtros espectrales, redes
deBraggofiltrosactivos(p.e.filtrosacustopticos)
para controlar de forma dinmica la potencia de
salidadelasdistintaslongitudesdeonda.
Amplificadordefibradopadodeerbio(EDFA,
ErbiumDopedFiberAmplifier)
Estosamplificadoresse usan enredes digitalesy en
redes analgicas. Su uso, de gran utilidad en
comunicaciones alargadistancia,esvitalen el caso
de cables submarinos, debido a su simplicidad y
buenasprestaciones.
AT&T y KDD consiguieron propagar una seal de 5
Gbps a lo largo de 9000 Km, utilizando 274
amplificadores de erbio, situados a una distancia
mediade33Km.
Estos amplificadores permiten cubrir las distancias
necesariasennuestroplaneta.
Esquema de un amplificador
EDFA
Fibra dopada con
erbio (10-50 m)

Luz de 3 o Acoplador Acoplador Luz de 3 o


4 ventana WDM WDM Filtro
Aislante Aislante 4 ventana
ptico ptico ptico

Lser de Lser de
bombeo bombeo
a 980 nm a 1480 nm

Ganancia 25-50 dB

AmpliacinRedes468
Ganancia de un EDFA y de
una cadena de EDFAs

Obsrvese
que la
Ganancia
escala no de un amplificador EDFA
empieza
en cero
Ganancia Ganancia
AmpliacinRedes469 de un de un
amplificado j
AmplificadoresRaman
Otros amplificadores pticos de fibra de ltima
tecnologaestnbasadosenlaamplificacinRaman,
quesecaracterizaporextraerenergadeunlserde
bombeoparaamplificarunasealpticadbilaotra
longituddeonda.
A diferencia de los EDFAs y de los SOAs, los
amplificadores Raman se basan en una interaccin
no lineal (efecto Raman) entre la seal ptica y la
sealdebombeodealtapotencia.
La fibra convencional ya instalada puede ser usada
como medio para la amplificacin Raman. Es mejor
emplear fibras especialmente diseadas (fibra
altamente no lineal) en las que se introducen
dopantes y se reduce el ncleo de la fibra para
incrementarsunolinealidad.
AmplificadoresRaman
El efecto Raman tiene lugar cuando una radiacin
monocromtica (bombeo) de alta intensidad pasa a
travsdeunmediomaterial(lafibra).Sistecumple
unas determinadas condiciones, el resultado de la
interaccineslaaparicindeunanuevalongitudde
onda.
Lasealsebombeosepuedeacoplaralafibratanto
enlamismadireccinenlaquesetransmitelaseal
(bombeo codireccional) o en el sentido contrario
(bombeocontradireccional).
Es ms habitual el bombeo contradireccional para
evitar la amplificacin de las componentes no
lineales.
Elmximodegananciaseconsigueen13THz (unos
100 nm) por debajo de la longitud de onda de
bombeo.
AmplificadoresRaman
Para obtener una buena amplificacin es
necesariousarpotenciasdebombeoelevadas
(de hasta 1 W y hasta 1,2 W para
amplificacinenbandaLenfibrasmonomodo
estndar), lo cual eventualmente puede ser
uninconveniente.
Normalmenteseemplean msde dos diodos
debombeo.
El nivel de ruido que se obtiene es bajo
especialmente cuando se usa junto con
EDFAs.
Caracterstica EDFA Raman
Banda de operacin Las bandas C y L(1530- Depende de la disponibilidad de la
1605 nm); no trabajan en el fuente de bombeo; funciona en
rango de 1300 nm. todas las bandas.

Ganancia Hasta 50 dB dependiendo de la Hasta 30 dB, proporcional a la


concentracin de los iones, la intensidad de la bomba y la
longitud de la fibra y la efectividad de la longitud de la
configuracin de las bombas. fibra.

Potencia de saturacin Depende de la ganancia y las Se aproxima a la potencia de la


constantes del material. fuente de bombeo.
Ruido Amplifica el ruido. No amplifica el ruido.
Longitud de onda de la fuente 980 nm. 1480 nm. Aproximadamente 100 nm ms
de bombeo abajo que la longitud de onda de la
seal en ganancia pico.

Nmero de amplificadores Alrededor de 6. Alrededor de 12.


Espaciamiento 80 100 Km Alrededor de 65 Km
Caracterstica Configuracin Hbrida EDFA y Raman
Nmero de amplificadores Alrededor de 12.
Espaciamiento 80 a100 Km.
Parameter Value Unit

Wavelength range 1530 - 1565 nm

optical output (@ 0 dBm in) > 17 dBm

signal gain (@ -10 dBm in) > 25 dB

Small signal gain (@-20 dBm optical input) > 25 dB

noise figure 5-6

polarization sensitivity 0.07 dB

isolation (input&output) 40 dB

return loss -60 dB

loss of signal < -25 dBm

pump leakage (980 nm) <-15 dBm


Amplificadoresdelnea

Compensanlaatenuacindelasealenlargostrayectosdefibraptica.
Cumplenlamismafuncinquelosrepetidoreselectropticos,elevando
elniveldelasealentranteparagenerarunasealdesalidaquepueda
manejar la siguiente etapa defibra. Se usan por lo general en sistemas
delargasdistancias,comoencablessubmarinos.
Post-amplificadores

Se conectan inmediatamente despus del transmisor para incrementar la seal


que ser enviada a travs de un tramo largo de fibra. Son convenientes en
sistemas de alto desempeo. El amplificador ptico toma la seal limpia de
baja potencia del transmisor (despus de la modulacin externa si se usa), y a
partir de ella genera una seal de alta potencia que puede viajar ms distancia
sin amplificacin.
Los post-amplificadores se usan en enlaces punto a punto, ya que proveen
suficiente potencia para evitar la necesidad de repetidores. Tambin pueden
ser tiles en la generacin de seales para distribucin entre varios abonados,
debido a que la alta potencia permite que la misma seal se reparta entre ms
terminales.
Pre-amplificadores

Pueden incrementar la sensibilidad del receptor, elevando la potencia ptica que


llega al detector. Esto hace posible que las distancias de transmisin se
extiendan y que la calidad de la seal mejore.
Compensacin de las prdidas de los
componentes
Los amplificadores pticos permiten superar las altas
prdidas producidas en los componentes pticos, tales
como los acopladores y los conmutadores.

Los acopladores pticos deben dividir fsicamente la


seal entre los diferentes terminales, de modo que
reducen su nivel.

Dividir la seal entre dos terminales produce una


prdida de 3 dB, mientras que dividirla entre 20
terminales causa una prdida de aproximadamente 13
dB.

Un amplificador ptico puede elevar el nivel de seal lo


suficiente como para compensar todas estas prdidas.
SWITCHES oCONMUTADORES
Permiten redireccionar seales pticas, esto es
permiten conmutar el haz lumnico presente en un
puertodeentradaentredosomspuertosdesalida
medianteunaaccindecontrol(mando),yas lograr
lamodificacinquesedeseaenlatrayectoriadelhaz
lumnicoentreelpuertodeentradayeldesalida.
Antes del aparecimiento de los switches pticos, la
conmutacin era realizada a nivel electrnico; en
cuyocasoseconmutabansealeselctricasenlugar
desealespticas.
Actualmente el control del flujo de datos en una
comunicacinporfibrapticaserealizaconmutando
sealespticasentrefibras.
SWITCHES oCONMUTADORES
Hay numerosas ventajas en la conmutacin ptica
respectodelaconmutacinelectrnica.
La primera es el costo, es ms simple y menos
costoso conmutar seales pticas en un sistema de
fibra ptica que convertir dichas seales pticas a
seales elctricas, ejecutar la conmutacin, y
convertirderegresoasealespticas.
En segundo lugar, es posible conseguir con la
conmutacin ptica mayores anchos de banda y
mayorestasasdedatos.
SWITCHES oCONMUTADORES
Losconmutadores(switches)sonimportantesenun
sistema de comunicaciones, pues permiten
adaptarse a condiciones cambiantes que impliquen:
encasodefallasdeuncable,enviarlassealespor
otro; hacer conexiones punto a punto temporales a
travsdeunared;etc.
Una caracterstica importante de un switch es el
nmerodeentradasysalidas.
Los sistemas modernos de fibra ptica tpicamente
tienen al menos dos rutas a cualquier locacin
importante, as si uno de los cables falla, la seal
puedeserredireccionada atravsdelsegundo.
SWITCHOPTICOOSWM1xN
ConmutadoresElectromecnicos
Sebasanenelempleodeelementosmecnicosmvilespara
activarelconmutador.
Elelementomecnicoimpulsorpuedeserporejemploun
rel solenoidal.
Actanenformaindependiente delalongituddeondade
trabajoydelapotenciapticadelhazlumnico.
Tiemposdeconmutacintpicosparaestetipodeswitches
estnentre5 8ms,porloqueresultanlentos.
Lasprdidasdeinsercin(estoeslaprdidadepotencia
comoconsecuenciadeinsertarelswitchenelcircuitoptico)
sondelordende1dB.
ConmutadoresElectromecnicos
a)Conmutadoreselectromecnicosdefibramvil
Se basan en el alineamiento o enfrentamiento directo entre
losncleosdelasfibraspticas.
Su construccin es posible para fibras pticas con dimetros
dencleodesde50um hasta1000um.
Susprdidasdeinsercinoscilanen0.5dB.
La configuracin 1 x 2 se puede utilizar como interruptor
ptico o como conmutador ptico. En el primer caso
permitiraoimpediraelpasodelhazlumnico,mientrasque
en el segundo caso establecera una ruta alternativa
realizandounafuncindebypass.
ConmutadoresElectromecnicos
b)Conmutadoreselectromecnicosdepticamvil
Sebasanenlamodificacindelatrayectoriadelhazlumnico,
porloquenoexisteenfrentamientodirectoentrelosncleos
delasfibraspticas.
La modificacin de la trayectoria del haz lumnico se logra
mediante elementos mviles pticos tales como lentes,
prismasoespejos.
La seleccin del puerto de salida se logra en base al
posicionadoquepresenteelelementopticomvil.
ConmutadoresElectropticos
Los switches electropticos (o de conmutacin ptica
directa)puedenconmutarentiemposdens.
Sus prdidas de insercin son altas (3 10 dB), aunque con
ltimastcnicasdefabricacinymaterialesempleadossehan
logradobajarsignificativamente.
Sebasanenelempleodemateriales(cristales)cuyondicede
refraccinvaraenfuncindelpotencialelctrico(voltaje)al
queselessomete.Alvariarelndicederefraccindelmedio,
el haz lumnico modifica su trayectoria inicial, con lo que se
producelaconmutacindelhazlumnico.
Elcostodeestosconmutadoresessustancialmentemsalto.
ConmutadoresElectropticos
Existendostcnicasconstructivasparalarealizacinde este
tipodeconmutadores.
Laprimeraconsisteenlautilizacindeunsustratodedixido
de silicio depositado sobre una oblea de Si. Estos
conmutadorestienentiemposdeconmutacindelordende1
ms yprdidasdeinsercinbajasentre1dB y2dB.
Lasegundatcnicaconsisteenlautilizacindeunsustratode
niobato de litio (NbO3Li) sobre el que se difunde una
estructura con una fina capa de titanio. Estos conmutadores
se caracterizan por menores tiempos de conmutacin, del
ordende1ns,yprdidasdeinsercinmsaltasentre4dB y
6dB.
CONMUTADORESPTICOS
Dentrodelosconmutadorespticosactualmentedisponibles
se pueden mencionar: conmutadores con intercambio de
longitudes de onda, de barras cruzadas, de Benes, de Clos
(direccional de mltiples longitudes de onda, reconfigurable,
sin bloqueo por reconfiguracin), de Spanke, de Spanke
Benes, espaciales por longitud de onda, selectivos a la
longituddeonda.
Unswitch departicularinterssonloscrosconectores (cross
connects), los cuales permiten hacer conexiones entre
muchas posibles entradas y salidas. Los crosconectores
modernos usan tecnologa electrnica; sin embargo, se han
desarrollado crosconectores pticos, pero de pequea
capacidad(reducidonmerodeentradasysalidas).
CONVERTIDORESDELONGITUDDEONDA
Enunaredpticadecomunicaciones,unamismalongitudde
onda no va desde el terminal inicial hasta el destino final.
Paraunmximoaprovechamientodelaslongitudesdeonda
disponibles, suele ser preciso un proceso de conversin de
longitudesdeonda.
Se aprovechan procesos no lineales que tienen lugar, y que
permiten a partir de una inicial y otra seal de diferente
longituddeonda,generarunanuevasealconotrovalorde
. En algunos casos esta tarea es realizada por un proceso
hbridooptoelectrnico.
Se usanfundamentalmenteenlossistemasWDM.
Convertidoresdelongituddeondapticospurospuedenser
implementados en base a amplificadores pticos de
semiconductor, o mediante los dispositivos llamados
interfermetrosdeMachZehnder.
ACOPLADORESPTICOS
Sistema que une entre s los extremos de 3 o ms fibras
pticas,deformaqueunasealpticapuedaserreconducida
de una fibra a dos o ms fibras; o viceversa. El acoplador
ptico permite realizar la unificacin o bifurcacin del haz
lumnicoprovenientedeunaomsfuentesdeluz.
Losacopladoresdifierendelosswitches enquelosprimeros
hacen conexiones permanentes, en tanto que los switches
pueden alterar esas conexiones y adems son dispositivos
activos.
Un acoplador ptico divide la seal entre sus salidas
correspondientes reduciendo su potencia, lo cual limita el
nmerodeterminales(salidas)quepuedenserconectadosa
unacopladorpasivo,uobligaaelevarlapotenciatransmitida
hastanivelesqueseancompatiblesconlosnecesariosparala
recepcin. Si se dobla el nmero de salidas, la potencia se
reduceen3dB.
Optical Couplers Special Wavelengths 532630
83098010641480
WDMMultimodeFiberCoupler850/1310nm
1x2SingleModeWidebandOpticalCouplers
WDMCoupler1310/1550nm UltraHigh
Isolation
ACOPLADORESPTICOS
Directividad o diafona: Representa el grado, expresado en
dB, en que el acoplador enva la seal hacia el puerto o
puertosdesalidano deseados.Elclculodeladirectividad es
unitarioyserealizaporcadapuertodesalidanodeseado.
Directividad (dB) = 10 log (P no deseada / P entrada)

Los valores tpicos de directividad para acopladores pticos


comercialessesitanenelordende50dB.

Prdida deretorno:Eslamedidadelasealderetornoque
se obtiene en el puerto del acoplador por el que se ha
inyectadolaseal.
ACOPLADORESPTICOS
Anchodebanda:Eselmargendevariacindelalongitudde
ondadetrabajodelacopladorconrespectodelvalorcentral
delalongituddeondaespecificada.
Valores caractersticos son para banda pasante ancha
50nm;y,parabandapasanteangosta 10nm.

Acromaticidad: Representa la capacidad de un acoplador de


mantener sus caractersticas para una banda pasante
especfica y, por tanto, para todas las longitudes
comprendidasenlabandapasante.
ACOPLADORESPTICOS
Prdidas por divisin: Las prdidas por divisin (Splitting
Loss) son las que se producen por el reparto de potencia
entrelosn puertosdesalidadeunacoplador.

Para acopladores con un reparto de potencias idntico, las


prdidaspordivisinvienendadaspor:

Prdidaspordivisin(dB)=10log (1/n)
ACOPLADORESPTICOS
Relacindeacoplamiento:Representaelrepartode
potenciasqueseproduceencadapuertodesalidadel
acopladorconrespectodelapotenciainsertada.Seexpresa
enporcentajeoendB.
Larelacindeacoplamientoesvariableenfuncindela
longituddeonda,porloquesiempreseespecificaenfuncin
delamisma.Elclculodelarelacindepotenciaesunitario
paracadapuertodesalidadeseado.
Siseconsideraunacopladorcondospuertosdesalida,la
relacindeacoplamientoparaelpuertodesalida1sera:
Relacin deacoplo(puerto1)(%)=100.P1/(P1+P2)
Losmrgenesdevariacindelarelacindeacoplamiento
varandesdeel1%hastael90%.
ACOPLADORESPTICOS
Prdidasdeexceso: Eslaprdidatotaldepotencialumnica
queseproduceenelacopladorysedefinecomolarelacin
entrelasumaalgebraicadelaspotenciaslumnicaspresentes
encadaunodelospuertosdesalidadeseadosdelacopladory
lapotencialumnicainsertada.Valorestpicosdeprdidasde
excesoparaacopladorespticosestnenelordende0.5dB.
Prdida deinsercin.Sedefinecomolaatenuacintotalque
seproducedesdecualquierpuertodeentradahastacualquier
puertodesalida.Suclculoserealizadeformaunitariapara
cadapuertodesalidadeseado.As,paraunacopladordedos
puertossuatenuacincaractersticaparaelpuerto1sera:
Prdidadeinsercin(puerto1)(dB)=10log (P1/Pentrada)

Losvalorestpicosdeprdidasdeinsercinparaacopladores
comercialessondelordende3dB.
AcopladoresenT
Estetipodeacopladoressonlosmsclsicos.
Su funcin es la de llevar la seal que va por una
fibra a otras dos de salida (en cuyo caso se suele
denominardivisorpticoosplitter),oladeunificar
lasealquevienedesdedosfibrasenunanicafibra
de salida (en cuyo caso se denomina combinador
ptico).
Las prdidas producidas en estos acopladores
aumentanconelnmerodederivacionesrealizadas.
AcopladoresenT
Puedenirdesdeelsimpleenfrentamientodeuna
fibraconlasotrasdosreceptoras,alaintroduccin
deunespejosemitransparente.
Enambospuedenlograrsediferentespotenciasen
losdosterminalesdesalida.
Enelprimeromedianteelgradodesolapamientode
cadaunadelasdosfibrasreceptorasconlaemisora
yenelsegundopormediodevariacionesenelgrado
detransmisinyreflexinqueposeaelespejo
semitransparente.
Lasprdidasquesuelentenerseenestetipode
acopladoresseencuentranentre1y2dB.
ACOPLADORESPTICOS
Otra forma que suele emplearse muy a menudo
consisteenelusodelentesGRIN.
Un divisor ptico de 2 puertos bajo este esquema
estara constituido por dos lentes de Grin y una
pelculareflectoraentrelasdos.
Por tanto esta lente de Grin tiene la propiedad de
guiarelhazlumnico incidentehacia la zona central
de la pelcula reflectora; la pelcula reflectora
permite reflejar un porcentaje del haz lumnico
incidente, que ser conducido hacia el puerto de
salida por la lente (1), y atravesar el porcentaje
restante,queser conducidoalotropuertodesalida
porunasegundalentedeGrin(2).
ACOPLADORESPTICOS
AcopladoresenEstrella
Esundispositivopticopasivoinsertable,convariospuertos
de salida y uno o varios puertos de entrada. Se caracteriza
porqueelhazlumnicopresenteensuentradasedistribuyea
todoslospuertosdesalida.
Las prdidas en estos acopladores aumentan en forma
logartmicaconelnmerodederivacionesrealizadas.
El valor caracterstico de atenuacin que introducen est en
funcindelnmerodepuertosdesalida,ylosvalorestpicos
varan desde los 15 dB para acopladores en estrella con 3
puertosdesalidahastalos30dB paraacopladoresenestrella
con40puertosdesalida.
Este tipo de acoplador ptico es siempre equipotencial y
presenta idntica potencia ptica en todos los puertos de
salida.
ACOPLADORESPTICOS
AcopladorTAP
Es un dispositivo ptico pasivo unidireccional con varios
puertosdesalidayunoovariospuertosdeentrada.
Se caracteriza por no ser equipotencial al presentar una
relacindesigual enelrepartodepotenciasentrelosdistintos
puertosdesalida.
Suconfiguracinhabituales1puertodeentraday2puertos
de salida (configuracin 1 x 2). Tambin estn disponibles
versiones4x4.
Lasrelacioneshabitualesentrelaspotenciasdelospuertosde
salidaparalaconfiguracin1x2son:10% 90%,20% 80%,
30% 70%,40% 60%.
PorejemplounTAP1x2conrelacindeacoplamiento20%
80%,repartelapotenciapticadeentradaensusdospuertos
desalidaas:20%alprimerpuertoy80%alsegundo.
MULTIPLEXORESWDM
Multiplexores/Demultiplexores por divisin en
longituddeonda
WDM es un proceso que consiste en conformar de
manera simultnea un haz lumnico con diferentes
pulsos lumnicos, cada uno de ellos con su
correspondientelongituddeondaespecfica.
El haz lumnico constituido por las diversas
longitudes de onda provenientes de diferentes
fuentesdeluz,sepropagautilizandounanicafibra.
Trabajan en forma independiente de la potencia
lumnica de cada fuente de luz, al ser nicamente
selectivosalalongituddeonda.
MULTIPLEXORESWDM
LossistemasWDM,pararealizarlatarea
anteriormentedescrita,requieren
acopladoresselectivosdelongituddeonda,
loscualesdistribuyenlasealdeacuerdoasu
longituddeonda.
Enestecasoelacopladornoesunelemento
totalmentepasivo,puesdebesercapazde
diferenciarunaslongitudesdeondadeotrasy
encaminardeterminadalongituddeondapor
lafibraocanalcorrespondiente.
WDM Modules

WDMModule
CoarseWavelengthDivisionMultiplexer(CWDM
Module)
MULTIPLEXORESWDM
FiltrosInterferenciales
Sonelementospticosquesecomportancomo
filtrossintonizadosconunadeterminadalongitudde
onda.
SufundamentoeselinterfermetrodeFabry Perot y
suelementoconstructivobsicoeslapelcula
interferencial.
Lapelculainterferencial seencuentrasintonizada
conunadeterminadalongituddeondayes
transparente aella,reflejandoelrestodelongitudes
deondaqueincidanenlapelculainterferencial.
MULTIPLEXORESWDM
RedesdeDifraccin
Elementos pticosquesecomportancomofiltros
sintonizadoscondiversaslongitudesdeonda.
Difractan laluzqueincideenellasyseparan
espacialmentelaslongitudesdeondaunitariasque
conformanelespectrodelhazlumnicoincidente.
Sebasanenlapropiedadquepresentanlasredesde
difraccindereflejarloshaceslumnicosincidentes
enellasconunosngulosdesalidaespecficos para
cadaunadelaslongitudesdeondaunitariasque
conformanelhazlumnicoqueingresaalaredde
difraccin.
MULTIPLEXORESWDM
RedesdeDifraccin
Suelementoconstructivobsicoesuna
superficieoredqueseencuentraescalonada
yquepresentadiversosndicesderefraccin
consecutivosyenordencrecienteparacada
unodesusescalones.
Introducen prdidasdeinsercindelorden
de3dB yconunaislamientomnimoentre
sealesde30dB.
MULTIPLEXORESWDM
MultiplexoresAdd/Drop

Losmultiplexoresadddrop sonuntipode
acopladoresselectivosdelongituddeonda,los
cualesseparanunalongituddeondaparaenrutar
dichasealaundestinoparticular,mientras
continanenviandolasotraslongitudesdeonda.
Tambinpuedenincorporarunanuevasealdeuna
determinadalongituddeonda.
ATENUADORPTICO
Esundispositivopticopasivoinsertable enun
sistemaptico,constituidoporunpuertodeentrada
yunpuertodesalida.
Esteelementoreducelaintensidaddelhazdeluz.
Permitevariaravoluntad,dentrodelosmrgenesde
regulacinpermitidos,larelacinentrelapotencia
lumnicadeentradaylapotencialumnicapresente
alasalidadelatenuadorptico.Estoposibilitapor
tantoobtenerunaprdidadepotencialumnica
controladayespecifica.
ATENUADORPTICO
UtilizadoslentesdeGrinyunprismade
absorcinenelcentro,conuncoeficientede
absorcinlumnicavariableavoluntaden
funcindeldesplazamientoradialdelprisma.
Cuandoelprismadeabsorcinsedesplaza
radialmente varalaabsorcinlumnicadel
atenuador,queesmximacuandoste
presentasuseccintranslucidayesmnima
cuandoelprismadeabsorcinpresentasu
seccintransparente.
ATENUADORPTICO
Tpicamentesetienenatenuadoresfijosconatenuacionesde:
5,10,15y20dB,oatenuadoresvariablesenunrango
comprendidoentre2y70dB.
Sondependientesdelalongituddeondadetrabajoyse
fabricanparadiferenteslongitudesdeonda.
AISLADORPTICO
Esunelementopticopasivoinsertable,conun
puertodeentradayunpuertodesalida.
Unaisladorpticoesunelementoquetransmitela
luzsolamenteenunadireccin,eimpideelpasode
cualquierhazlumnicoenelsentidocontrario.
Secomportacomoundiodoptico.
Suelementoconstructivobsicoeselrotador de
Faradayqueseconstruyeconunmaterial
magnetoptico,yquepresentalapropiedadde
defasar cualquierhazlumnicoqueincideenl.
FILTROPTICO
Los filtros bloquean selectivamente la luz, o
transmiten solamente longitudes de onda
seleccionadas,bloqueandootraslongitudesdeonda
quepuedengenerarruidouotrosproblemas.
Un tipo especial de filtros son los ecualizadores,
requeridostodavezqueunamplificadordefibrano
amplifica por igual todas las longitudes de onda, ya
quesugananciavaraconlalongituddeonda.
Unecualizadorbalanceaelgradodeamplificacinde
lassealesadiferenteslongitudesdeonda.
COMPENSADORDEDISPERSIN
Elndicederefraccindeunmaterialdependedela
longituddeonda;as,elndicederefraccinenel
vidriodisminuyeamedidaqueaumentalalongitud
deonda;portantolas msgrandesusualmente
adelantanalas mscortas.
Sinembargo,esposiblecompensarladispersin
usandofibrasespeciales orejillasdefibra para
reducirladispersintotaldelsistema,estaltima
alternativatrabajamejorconsistemasqueutilizan
rangosde mspequeos,entantoquelasfibras
decompensacindedispersintrabajanmejorpara
rangosde msgrandes.
COMPENSADORDEDISPERSIN
Enelcasoqueseutilicenfibrascompensadorasde
dispersin(DCF,Dispersion Compensating Fiber),la
dispersindestasdebeserdesignocontrarioala
introducidaporlafibraprincipal.
Sinembargo,debetenerseencuentaqueestos
tramosdefibrascompensadorasdedispersin
elevanlaatenuacindelsistema,puesdebidoasus
propiedadesespeciales,susatenuacinesmucho
maselevadaqueenunalongitudsimilardefibra
convencional.