You are on page 1of 97

pagALOCUS CP001747 181907 bp DNA circular BCT 25-JUL-2

016
DEFINITION Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete
sequence.
ACCESSION CP001747
VERSION CP001747.1
DBLINK BioProject: PRJNA36309
BioSample: SAMN02603256
KEYWORDS .
SOURCE Bacillus cereus biovar anthracis str. CI
ORGANISM Bacillus cereus biovar anthracis str. CI
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
Bacillus cereus group.
REFERENCE 1 (bases 1 to 181907)
AUTHORS Klee,S.R., Brzuszkiewicz,E.B., Nattermann,H., Bruggemann,H.,
Dupke,S., Wollherr,A., Franz,T., Pauli,G., Appel,B., Liebl,W.,
Couacy-Hymann,E., Boesch,C., Meyer,F.D., Leendertz,F.H.,
Ellerbrok,H., Gottschalk,G., Grunow,R. and Liesegang,H.
TITLE The genome of a Bacillus isolate causing anthrax in chimpanzees
combines chromosomal properties of B. cereus with B. anthracis
virulence plasmids
JOURNAL PLoS ONE 5 (7), E10986 (2010)
PUBMED 20634886
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 181907)
AUTHORS Klee,S.R., Brzuszkiewicz,E.B., Nattermann,H., Brueggemann,H.,
Dupke,S., Franz,T., Pauli,G., Appel,B., Liebl,W., Couacy-Hymann,E.,
Meyer,F.-D., Leendertz,F.H., Gottschalk,G., Grunow,R. and
Liesegang,H.
TITLE Direct Submission
JOURNAL Submitted (11-SEP-2009) Goettingen Genomics Laboratory,
Georg-August University Goettingen, Grisebachstrasse 8, Goettingen,
Lower Saxony D-37077, Germany
FEATURES Location/Qualifiers
source 1..181907
/organism="Bacillus cereus biovar anthracis str. CI"
/mol_type="genomic DNA"
/strain="CI"
/db_xref="taxon:637380"
/plasmid="pCI-XO1"
/note="biovar: anthracis"
gene 18..446
/locus_tag="BACI_pCIXO100010"
CDS 18..446
/locus_tag="BACI_pCIXO100010"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08036.1"
/translation="MLLFGLAACDSIKSVASDVTVGKVIEEFKAAGLEAEQPSDLPEK
EFGNTRKDAKRILVPALGEDSGGRIFEFKNKQDLEQAKKYYDDLGNGNQMLFSHTYAK
GNFLLQMNGDMEDAQFNKYKEVMDKIIKQVKESAFIFQII"
gene 462..554
/locus_tag="BACI_pCIXO100020"
CDS 462..554
/locus_tag="BACI_pCIXO100020"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08037.1"
/translation="MVARIHLIKFKVVIKSKKRHSNECLFLWTK"
misc_binding 934..1045
/note="BACI_pCIXO102110; putative PyrR binding site,
RF00515"
/bound_moiety="uridine nucleotide"
gene complement(1045..1158)
/locus_tag="BACI_pCIXO100030"
CDS complement(1045..1158)
/locus_tag="BACI_pCIXO100030"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08038.1"
/translation="MLYVLGFLVISIVAIRLNMKYYKLKGNKKDFVMKKNG"
gene complement(1176..1814)
/locus_tag="BACI_pCIXO100040"
CDS complement(1176..1814)
/locus_tag="BACI_pCIXO100040"
/codon_start=1
/transl_table=11
/product="transporter"
/protein_id="ADK08039.1"
/translation="MEVLIFELILIAVLIPLNSVVKKHVPKWKGKAGEKLVKRMLSKL
DPKSYYVLHNVTVYTEYGDTTQIDHIVIAETGVFVVETKNYEGWIYGSEKAARWTQGI
FRKKSSFQNPFHQNYKHIKAIEWLIEQQLPCISMAAFHPKCSLKRVNVHSKEKHVLYY
NDLQKCIESYTDVQLTNDEVQHIYHTILRANIMDKDIEKKHVKYLHNKFAKQ"
gene complement(1831..2214)
/locus_tag="BACI_pCIXO100050"
CDS complement(1831..2214)
/locus_tag="BACI_pCIXO100050"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08040.1"
/translation="MNRNREYIALRNSISIGWLLTCIVIGLSIYFSSVVYLLIGCFIL
SLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIK
GLCISYFILGLETHVFRLMRRNARM"
gene 2340..2924
/locus_tag="BACI_pCIXO100060"
CDS 2340..2924
/locus_tag="BACI_pCIXO100060"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08041.1"
/translation="MLKLVVNNTGTEPEGDSAFSNYFTCKDCVYYLSKSDSCSLQLAA
DSNNPLVPYECGNFEETYEIGTEDPLNSHIHQQLREEKAQILAESYPAQPSIDPIHKD
AIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNMSSKKYASPFPLHDHGAKEGIRHYM
CWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNY"
gene 2944..3522
/locus_tag="BACI_pCIXO100070"
CDS 2944..3522
/locus_tag="BACI_pCIXO100070"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08042.1"
/translation="MLEHTILFSLVQLVPLIVSTGIIYILLELTDTEWKTWFSYEGIF
AIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLVSIFLVLFASIPTLLKIAFILQM
TVILFLLEYLCLYIDRLPIHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTRDEQ
YFLYTAVYLSGILSPISEEVFEEYERNNLMGR"
gene complement(3573..4208)
/locus_tag="BACI_pCIXO100080"
CDS complement(3573..4208)
/locus_tag="BACI_pCIXO100080"
/codon_start=1
/transl_table=11
/product="DSBH, double stranded beta helix domain involved
in carbohydrate binding and protein-protein"
/protein_id="ADK08043.1"
/translation="MKREKGMIGVLCTLVLMILLLVPLQAAQASVKVDFNKLKGNDVS
SSFKDGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMAL
ITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIF
TPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM"
gene complement(4208..4837)
/locus_tag="BACI_pCIXO100090"
CDS complement(4208..4837)
/locus_tag="BACI_pCIXO100090"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08044.1"
/translation="MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFP
EFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDE
TIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETY
VAVEKEEIANAIMGAYTKANIYYAADLYYAAEGNEIKLKSIKPKLAGDV"
gene complement(5174..5887)
/locus_tag="BACI_pCIXO100100"
CDS complement(5174..5887)
/locus_tag="BACI_pCIXO100100"
/codon_start=1
/transl_table=11
/product="putative transposase"
/protein_id="ADK08045.1"
/translation="MFTKIFIGLFCYVFIVVCNSKKKFLREEAKKKEMENKPLERPVY
WCPRENKPIGREQERITVPTKEITLEKDVASIYDLVATSVHKNLGEVESDRLKHEDIE
EVEYAEDFHHTPTPEAVYDIHFPSDEDIPVELLEYEDMYPQQEYVSIPPETEPVFPVQ
QRVADVKDMDFVRWTTKVLEQEQGLTRVINMSNNKRYWIHTEGEILPENQLLYMKLEV
DSPYSYTLVEWSNRQLGNI"
gene complement(5904..6611)
/locus_tag="BACI_pCIXO100110"
CDS complement(5904..6611)
/locus_tag="BACI_pCIXO100110"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08046.1"
/translation="MIFYQLPYSLFALNQAARRHCRIGQTKQCRTFYLGYRETFQQQM
AQLIAQKNKAAEAMNGEATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAA
SGESKRVLANIGNVITPVFESIEIQFTNWVEKLPGTMDVAFMKEAQFVQKAVECIKKE
QVPGVRVKQNVLEVDGEIEDIIRALTTLNTDKRMLVQKQDITFWDSVIVEVDPSKKKG
KQKNKIIDGQYEFDLFG"
gene 6629..6708
/locus_tag="BACI_pCIXO102120"
ncRNA 6629..6708
/ncRNA_class="autocatalytically_spliced_intron"
/locus_tag="BACI_pCIXO102120"
/product="putative group II catalytic intron"
/note="RF00029"
gene complement(6728..8536)
/locus_tag="BACI_pCIXO100120"
CDS complement(6728..8536)
/locus_tag="BACI_pCIXO100120"
/codon_start=1
/transl_table=11
/product="reverse transcriptase/endonuclease protein"
/protein_id="ADK08047.1"
/translation="MNTVNMKSAVSPQVTQWNSIQWKEIENYVKKLRQRIYRAEQFGN
KRKVRKLQRLMLRSKANLLLSIKRVTQINQGKRTAGIDGITTNTPEDRVKLFHLLKGY
SVRNIKAFPVKRAYIPKKNGKKRPLGIPVIKDRIFQNMVKNALEPQWECRFESMSYGF
RPKRSAHDAMANLFLKLSRGTNRAWIFEGDFQGCFDNLNHEHILSCIEGFPYSNAINQ
WLNAGCIDNKTFYKTETGTPQGGIISPLLANIALHGMEKELGVRYHFPKRDGAMLYPD
SIGIVRYADDFVIVCNSKEEAESMYAKLQPYLDKRGLKLAEEKTRVVHITDGFDFLGF
NFRQYPTKEGSQLFIKPSNQSVKKAKEKISEIFKSHRGRSIGQLIRKLNPVITGIANY
WSPVVAKVIYGDIDSYVHKKVMHHLKYKHHRKGARWINKKYFHPDHTGVSQDKWLLTD
PDNHKNQLIRMRWTPIVRHVLIKYKNSPDDANLKKYFAKRDEKIFNRFNTNSKRKLAK
KTKYKCRVCNNSLVGEEPLESNHIVPKVIGGKDEYDNLELLHCSCHKQHHALLEWYGN
GKQLPKVQAYLKSQKIPINSKKAVRTMLNTFKKFKY"
gene complement(9041..9133)
/locus_tag="BACI_pCIXO100130"
CDS complement(9041..9133)
/locus_tag="BACI_pCIXO100130"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08048.1"
/translation="MLHYEVTLVMKGVPARSCYLSNRIVGLHES"
gene complement(9140..11773)
/locus_tag="BACI_pCIXO100140"
CDS complement(9140..11773)
/locus_tag="BACI_pCIXO100140"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08049.1"
/translation="MKRIDYDAFFILGGKLMLQEIIKQDTFDQEQTPAILQLETGTAS
HSAFCFAMAINHHREIQFAVLGANDSTLKSFRAAISMGTSRLYFGEGKREESHYTLDK
KVNVISKGQFEFINTQTINKKKAIIAFSKQLETKYIVAIDEAPEMQVRDFLMAPPYGL
PILEEWAKPIYEEMLTKNLLQPLEVYFDKNEFSSLSIAQVVLKEKDCKEFLSEMIRSG
KCQFPQEGTGEKINKIQDLNEYLLEYSPVMLDKVTKLDEPLHQPMKEQELSHFDTYKR
PLFPVQAHVATGAAKALQVQKGIIIQGEMSSGKSSIMTATVDGYFHLTGKKGYRTCVF
VPPTLTEKWAKEEIRHLIPDADVHLIKRTEDLIRIHQSWIQTGRPKPEKPTFFVISFT
TMRGDSIKQMPLPYKQIALSKKSKEEVQRYYKNGYYCPDCGAKLRKKTSSIMVHQANG
EQKEVCQYKDFTGSDLDSKTNKNSVCADCNSNIWSPKVKTKYASFKDWTKYENKLVQA
IKEGNKPLQKQLELENRVKPYDAKQSGRAYRKVATVEYIRRKMKHFFDALICDEVHEL
KSETAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKSGFEYSSFM
EWNETYGNIERTYYHDGEVTSNIASRGAQGTLDKTKVVPGISPYVFTQFLMDTTINVR
LKDVWPNPVELVNVPTILVDMSEEQKQAYEHMKESFEKAIEAAKGTPDAGKLWLSYIR
TGNAYPDNMIHYPNYYLDDAGKELVWSNDKFKFDEDCIQPKEKELQSILRTEISEGRP
TIVYVCDTGSTVKERDVQPRLQKVVEQIPGAKVATLRTNTVTPPKRSEWLKEQVNSGV
NVIICSLELVKVGLDCATRSR"
gene complement(11797..12024)
/locus_tag="BACI_pCIXO100150"
CDS complement(11797..12024)
/locus_tag="BACI_pCIXO100150"
/codon_start=1
/transl_table=11
/product="putative membrane protein"
/protein_id="ADK08050.1"
/translation="MSVLLGIGSLLIVWEFSNRMFRIAIVLTVICLCASQLGAGTHLE
VLEQFSVFHGVGDMLSAAEQSLPEWKRFIDF"
gene complement(12040..13131)
/locus_tag="BACI_pCIXO100160"
CDS complement(12040..13131)
/locus_tag="BACI_pCIXO100160"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08051.1"
/translation="MRLGNDLAAGFYPTPLTEGKHLVRLLQMESERAYACFDPCCGEG
TILRSFADETKQAGVQFHTYGVELDANRYGQAKEQLDVVVRSSFESMMISHNYFPLIF
LNPPYNTELRTENAKSEKMEFNFLKRAHLYLQEGGIMVYVIPYDRFARDDISYYLAKN
YEEIGLMRFGDENEEFEQFKQCVFIGRKRATTKNDTYFNDRFANFCENMSDLDFVRKH
VSTLAQMVNHKDWTIPELRHQNKLIFTSRVDYKDAYKGIGKSEGIASLKKRLNRGNGY
LLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYEHSFEQL
EKTTKEVVLQKRRAKFITATPTGVVKELV"
gene complement(13234..13377)
/locus_tag="BACI_pCIXO100170"
CDS complement(13234..13377)
/locus_tag="BACI_pCIXO100170"
/codon_start=1
/transl_table=11
/product="expressed protein"
/protein_id="ADK08052.1"
/translation="MEMKNYNVWTILDDPKEQETNEQSKESDDIFAGLDELSEIADDL
LPF"
gene complement(13393..13746)
/locus_tag="BACI_pCIXO100180"
CDS complement(13393..13746)
/locus_tag="BACI_pCIXO100180"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08053.1"
/translation="MEDNQKSYAAPVMSSESRARVNQMRGCFEAEIILPDGKFQYFKP
HALNEKEATQEIALYIEGIQEMKVGYVILWRFVGQQSFYSGTKIVAEPKFRKILRKLK
DYFFDYEEVVYEPKK"
gene 14353..15057
/locus_tag="BACI_pCIXO100190"
CDS 14353..15057
/locus_tag="BACI_pCIXO100190"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08054.1"
/translation="MKNLMLKNILICSISFIVFSLIFFVIPTQLDTMTKIVFVIFNGL
GISIPTIVAMRMQLKQTIKLDFDIKEMKKEITKKEITNFVGLLKLQKYIQGDLKRLSE
HYINRESEMHGLYREFRDWKDKYNAYIIPINMVAEKLIDDYASLLNLLEELDPHIQKI
VLSYVFTACEEYLNAIPSLGGSSEKDKEVVKLLSRNIQKKWIVLSAGFEKVFKEVQEE
TYTEFTFLVQKQNKRG"
gene complement(15168..19130)
/locus_tag="BACI_pCIXO100200"
CDS complement(15168..19130)
/locus_tag="BACI_pCIXO100200"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08055.1"
/translation="MAKKFEIPDIYKYEDIIKAAKTGNLIIFVGAGISMLLGLPSWKG
YAQEILEDAIEKGVIDSELYEKLKEEDPKKILTICKMLFDEKEIIPKSANEIFKFEKN
EEYKAIYEKLYSMNAIYITTNYDECLDVLTTPQSDNEKVSNSMDLSEENKLTEQSSET
KVFIDHTELLEAELKNGNVIHIHGSVKKEESMLVTVQDYLERYGTISKQSHPEVSVFL
DQVFNSNYVVLFMGYGLEEFEILEYMLSKTKNPSHTISHYMLFSENEENPQMTNLYKK
YYSNFGVELIPFNIYKNKYDNLIPIIDEWSKVLGEVSGERDFISKTISIDNVMKCDDT
AFEVRSRSVIKEIGKSESLALYFFKEVNGKRWLKKLANAGFFDPEDVPQPKKVENGYR
IPYWEQGEYLRKVVNQHDLTDEDINDILGIVKSISFYKNKEEMYIDNYRVWNQFVEVL
EQIPNKYINLEFLDTINIWIKSMFSVDYISYNIGEKLVPKFLNSSEPEDIKKAEKIIE
CLVILDFEKNQVKLGKNYFYKIFTNDTVKKIAEKCSMQLLEKIMQQLKEYLGKAEREI
EFEYGEKPYTLEIAKIKKEYITRIVEHGIIKHENTMEENGIESFMEQVTKWIYTKFSK
DKLQTKIEDSVKSIYIDINYKEMLSLQYETRNSYNNGFELILYLFKDLCNYKKGSQMQ
PFLINLKNQEYLLFTKILLDVIGNDFVNYNDIFWSTLEQREGTIVFQEYYLESELKLI
LEQLETLNNDQESLLLYLIEKVSNEITAQDINVWKQKRLKALRHIPLFEKRYLKLKEI
TKVDPELSSKAKVIGSKFVRIVSPVSQAELLNMSNKEIAKYLREYVESKHESITTVYS
LGQAIRELSRENPAKMVEGLKQFINTDYYYIHQIILGLCDVWKEQKTMDWDKLLNFII
SYINRTEFWQGKLLINKNKRDYDCKVVISIICKLFVTGSENKEQAFNRKHYNKAKQIL
LLVFKKIIDLEECNSNDNSISYFLNSVKGNVLEALLKMSVLNKNMEWENKWDNDFKAL
YNEYLELNVGEAYSLLGMELANFLDLDREWTIDRINSIKLKSKSWEAFFEGYSNNLII
NEDIYILMKRQYESAIDYNFKEKEIKTRLSKVLVEIYLRGYEKEVEKTLYRKVMDSWN
YNFIKEFIDVFCFIENEKLKVDEKQKIIDFWKEIHNKYNGYETEDFSQEDKKLLSKII
LLTSKLDDIDETNCDLIKRAIPFVDNYFDVVIELLYVKIKETDNIGKRKIIGELVDVW
VSDLTPHKYCPEEEMLYIIKYLYAAQDKELFELANRVCNKFVENDFIFLRDLFLAQNQ
"
gene complement(19194..20888)
/locus_tag="BACI_pCIXO100210"
CDS complement(19194..20888)
/locus_tag="BACI_pCIXO100210"
/codon_start=1
/transl_table=11
/product="bacitracin transport permease protein BCRB"
/protein_id="ADK08056.1"
/translation="MEKLKVLFQNTLYISYPLLTGVEGSERVLNKWQQFYQDVEKDLQ
KIYNSSYSSQTFERLVKWVSKKEALGLSAIDILPKLDNYKEEIFECLKDDLYIEFGIK
FPVVAKELALDPENKSDYIERSNAGFMYHLSDTIAKNKFTDDQDKNVRIAQLQDKQNS
LVVVSSHDDGDMKLQREELKRWNTLIDSTFLTRVMDDLTADCLDIVTELWVKSAENDK
TIVPVHYEQILDMCNMKQIKNGKAYYRKEDRLKIMERLAALASIFIYVNEDNEIVILN
EEDPNETLAYKKQRIRRLFVMDEIIIAKDIDTDKTLGIESMNVTPGSFLSKYLYGSEK
LTGLLSKKALEYNSKQQRYHKRVTRYLSWRWRIQQSYQHLTHSYSIGGPKGLLQVMEI
SMNRKPSLIRQVFEKTLDDLMRDQVIQEWTYSPELDEEKCKGKNWFENYWLKLKVIIS
PTNELVKLQQELITKKSKQQLPLVIEMEEKPLVIEEKPICIPNQENPNSIDFYIEKMN
TYKEKNNKSIRELAKEIDISYSTLSRMLSGKRKRLNDDTKNKLDKWIERQEVVNLL"
gene complement(21047..21166)
/locus_tag="BACI_pCIXO100220"
CDS complement(21047..21166)
/locus_tag="BACI_pCIXO100220"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08057.1"
/translation="MRVKKLLFYISVAYYLVKVRKMGKMLPVLQKEYATRENK"
gene 21273..21707
/locus_tag="BACI_pCIXO100230"
CDS 21273..21707
/locus_tag="BACI_pCIXO100230"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08058.1"
/translation="MKRNKICTVLFSVALMFSVVFGAFSFPTGASARVMDENSGTYNA
PPKSSDTIKFSVTPGYGHLKVFIKNRGQSNLYVSLKHVASGKVYFENKEIRVGDPALE
WKSNKEGFPQGVKAGDFELSFSSGGKAAYLDWAYKSADIIWP"
gene 22316..24025
/locus_tag="BACI_pCIXO100240"
CDS 22316..24025
/locus_tag="BACI_pCIXO100240"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08059.1"
/translation="MGKSFVIRNQRSLNGETTNAVLVTLKSWQKFVETFEEKYYSYKD
TYLEDILQHMTYEERIADVEGFVEKAKPSFSRRAMSTIAEKTGRKHKLYGITNADLEV
FLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIEN
GLDGRYTIKLTHFMNEETEKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTET
TLKRSLDKQDERGNKTHFGGMYHFLHKKYPHQIRTVIEELTTALPCTGNPLFKICKMQ
KGVKHTKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKATYARKAKFIETVLQEMNIG
ELSADMNKFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQI
LDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFKNVHALLKQK
FAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKDRTI
PSDVREWFIEEIDKLPQEQLRVIELPKQFNLLEFMRTFERLVRAGVTIIAPDQVLHAM
EIK"
gene 24147..24374
/locus_tag="BACI_pCIXO100250"
CDS 24147..24374
/locus_tag="BACI_pCIXO100250"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08060.1"
/translation="MESFFMQLYTNSILAIYSSPHNTREYSSNVLKHILIYLQKIIRK
NIKIVDMRINMVQCEYNLSKITVITNVVVYI"
gene 24920..25111
/locus_tag="BACI_pCIXO100260"
CDS 24920..25111
/locus_tag="BACI_pCIXO100260"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08061.1"
/translation="MSFFHFNKQLTSGGLNMVVLENTTDITVSTNNEVRFFKGVFWGL
IFVVPFWSIIIAVFIWLCK"
gene 25252..26199
/locus_tag="BACI_pCIXO100270"
CDS 25252..26199
/locus_tag="BACI_pCIXO100270"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08062.1"
/translation="MNETISLEETLEDFSAYLNEKGRKYSTIQRYAYDIKDFYRWLEI
NKMLLHIKSWNELSQEIYQAYFSELEHKRKYSQKTRHRIWVVLKKLHTFLGIVSPLDG
IHLSLIPDQSLSDSDFITELEETLLKQTVLSTKGLTERQAKYRPLIMDRNACIINLIV
NYGLSLQELVSLNMSHIQFARNILIVPGENKLTRSVSLTMEDTQQLYKYYTTIPEPVR
PQQHTNNPLFVAFDFNRGTFRWVYENDAPKALSEVAIQKMIRLEVKRAELDRRISAQQ
MRNTFILRLIRQGVTEKDLVSMMGFKTKISLKRYYQYLQ"
gene complement(26285..26395)
/locus_tag="BACI_pCIXO100280"
CDS complement(26285..26395)
/locus_tag="BACI_pCIXO100280"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08063.1"
/translation="MKFEELIQFVEENKQEHFQDIISQNEAAIKKIDEEK"
gene complement(26401..26616)
/locus_tag="BACI_pCIXO100290"
CDS complement(26401..26616)
/locus_tag="BACI_pCIXO100290"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08064.1"
/translation="MHLYTPIDWVPTLVLYQDVKTDPVSFTIHKACLKKGNPGYNEVG
NALKTFLHIQVLSVFELEQVIKVNEIR"
gene 26794..28290
/locus_tag="BACI_pCIXO100300"
CDS 26794..28290
/locus_tag="BACI_pCIXO100300"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08065.1"
/translation="MAKPKKDCFIIELKLIVDTWQKDILLKRFEIARKLYNTTLSYAM
KQYTLMKEAKAYRKQLHCYQKAKKANHPKEWKEISKDLDSIRQSFGLSEYQLHAYIKK
HQHNYKKHIDSNTSQKIASTVWKAMQDVIFKGTKTHFKPFGMLHSVEGKSNKAGIRFK
ENRVYWNGLHLPVRFRKNDLFIEESLALHKIKYCRLVKKVIRGKDTFYLQLIMGGMPP
TKRINKTGAFRHSYQKKKRVGIDIGPSTIAIVSEETVSIQQLAPDVPLFEREKRRLLR
KLDRSRRSTNPNNFNTNGTIKCGIKLHWTCSKNYQKTKSLLNELYRKKAAYIKEKHGA
LANSILSLGDELYIETMHFNGLAKRTKETKTNQQGKFQSKKRFGKSIGNHAPAMLVEI
INQKLKYGKQEIQKVNTITFRASQYNHVTNSYEKKKLHQRWSQIGNYLVQRDLYSAFL
LMNSDATLKQTNQEHCIETFDTFVKLHHQHIESLQQTNKKYPLSMGII"
gene complement(28484..28651)
/locus_tag="BACI_pCIXO100310"
CDS complement(28484..28651)
/locus_tag="BACI_pCIXO100310"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08066.1"
/translation="MRLYILEITTEHKISFINATSIEKAIEAFKRIYKHYEEQVPFYV
REIHPTDYSHS"
gene complement(28771..30144)
/locus_tag="BACI_pCIXO100320"
CDS complement(28771..30144)
/locus_tag="BACI_pCIXO100320"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08067.1"
/translation="MQRKTKEILIESQTTNVIECFDEYDGVLMLAVRNEESARRRHSI
QKHEISNDSLFSRHNDMKNILCFNPVKFLTGDEVWMLLLDRGLLPFGVDVEEMSIQYG
QAMFECGIKTGGKQQGNACGAANSRSGCWTCLMMNGEDKMLTQLISEGYTDYAYLQSW
KSFLHSIRNDIRYRNVMNRRSLQTLLRNENKRDSDLFSIHNHAEYDYIMFDRTEKGDY
APGGLTVKGRRMLLEYLLFTQQEMNTILISEEEIEAILQAWYETDGIRVYRDELEPVY
HAYLGELVFKPDCTINEEKTTSPFPVFFVEIDIHLGKQELFRWIKERQRITHRSFFFF
PSNYSNEVAKLTWNKLTFVVSRVDVTEARNAERIVRHWLGMDMYQGKKNEQHKQMLIQ
ILIQSMKNEQLFKEDEKASTKLLYAAEFTNRLSRLIETEEMLSEETNHLFAKVLKELG
NESFPID"
gene complement(30216..30521)
/locus_tag="BACI_pCIXO100330"
CDS complement(30216..30521)
/locus_tag="BACI_pCIXO100330"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08068.1"
/translation="MILCYGDNNIMMDIHKEIKKEMKKVYLSRDCCFVGYSGGKDSSA
MLTLLWDAIAELPIEERTKPIHILTSEVGVETPAMTAYISRTLRKIQENADKQNLPF"
gene complement(30615..31058)
/locus_tag="BACI_pCIXO100340"
CDS complement(30615..31058)
/locus_tag="BACI_pCIXO100340"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08069.1"
/translation="MEIASNTYLSTINTEDLKEWVFIAKSDLDSASYLTHMNPFPTAI
ICYHSQQCVEKLLKGFLALNGRTVPKTHNLLMLHKLCRKLDEEFSLILEQCVQLNGYA
TDIRYPYFEAFTVQDGLMAIQHAQKVMNFYKEKLNKLNIHEITFD"
gene 31025..31112
/locus_tag="BACI_pCIXO102130"
ncRNA 31025..31112
/ncRNA_class="autocatalytically_spliced_intron"
/locus_tag="BACI_pCIXO102130"
/product="putative group II catalytic intron"
/note="RF00029"
gene complement(31204..33135)
/locus_tag="BACI_pCIXO100350"
CDS complement(31204..33135)
/locus_tag="BACI_pCIXO100350"
/codon_start=1
/transl_table=11
/product="group ii intron reverse transcriptase/maturase"
/protein_id="ADK08070.1"
/translation="MNGNSKSAPKGKKLRHNEYYGIQPVLDNLYQKATKGNSFKNLMS
IIISDENILLAYRNIKGNKGSRTAACDNVNIKNIEGMEQSYFLNEVKRRFQNYQPQKV
RRKEISKPNGQTRPLGIPAMWDRIIQQCILQVMEPICEAHFSNRSYGFRPNRSAEHAL
ADASVRVNKQNLTYVVDVDIKGFFDEVNHVKLMRQLWTLGIRDKQLLVIIRKILKAPV
QMPDGTTMFPTKGTPQGGILSPILANVNLNEFDWWISRQWETFKAKKVKPRCMRGIWC
NDVVTTQLTKTSKMKPMYIVRYADDFKIFTNTRSNAEKIFKATQMWLEERLKLSISAE
KSKVTNLTKQQSEFLGFTLKAVKKGKKKNGDTRYIAVTHVSPKALEKTKQDLAKQVRR
IQKTPNSNETIKRISIYNSMVIGKHNYYKIATHASQDFSKMNHNLDHIMYNRFPKSTT
GGKSNTNGYTNIGEYKGKDKGIKPYLKSKMTRFLMKRPILPISYIQHKNPMMKKQAIN
KYTAEGRALIHKNLADITEAELKWLRENPVINERATVEYNDNRISLYVAQKGKCSVTG
EKLLPWDIHCHHKRLWSETKDDSYKNLTIIKPSVHRLIHATKIETINQLLNELKFNEE
QLGKLNKLRKLVKNEEICI"
gene complement(33132..33335)
/locus_tag="BACI_pCIXO100360"
CDS complement(33132..33335)
/locus_tag="BACI_pCIXO100360"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08071.1"
/translation="MNTKWATKGSILNSGESSGTTVEGSVMELEEQPQVYIVGTEISS
NLAWILVRLKRSPKINLRVGDRP"
gene complement(33894..34292)
/locus_tag="BACI_pCIXO100370"
CDS complement(33894..34292)
/locus_tag="BACI_pCIXO100370"
/codon_start=1
/transl_table=11
/product="nucleotidyltransferase domain protein"
/protein_id="ADK08072.1"
/translation="MYNILKRQFNYIIRGVIRINEEVQRELDLLVQKIRETVSSVQKI
ILFGSHAYGTPNEDSDFDLCIVVEGVGERKREVINLINWGIYDVMETPVDILVYGPEE
FQERASRTVTMEHKIALEGKVLYEVRDVLE"
gene complement(34489..34662)
/locus_tag="BACI_pCIXO100380"
CDS complement(34489..34662)
/locus_tag="BACI_pCIXO100380"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08073.1"
/translation="MSIHIDNAEGKILVPYIALVGKRENRSLNIQRFVKIISLFKLNV
EIFAANPDVVSRS"
gene complement(34758..34952)
/locus_tag="BACI_pCIXO100390"
CDS complement(34758..34952)
/locus_tag="BACI_pCIXO100390"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08074.1"
/translation="MQIRDKSNINQIYEALEGQRNDTYMDSNAHPLYIHTLIKQPNLL
QYVISIVQEEGVIPAASAFI"
gene complement(35315..35599)
/locus_tag="BACI_pCIXO100400"
CDS complement(35315..35599)
/locus_tag="BACI_pCIXO100400"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08075.1"
/translation="MITVNRGYMYDPVDNEVLITEIYYEAATETKLGSKMDRLSYSVI
PNSIKEKIEAVTSLSYMESIEMSQQLAAVYQDEINKYGKPEKLYFEYTNM"
gene 36006..36122
/locus_tag="BACI_pCIXO100410"
CDS 36006..36122
/locus_tag="BACI_pCIXO100410"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08076.1"
/translation="MHSKISYKYTNRLKEALSKMKQDVTCFYNSTTTYKVWE"
gene complement(36300..36587)
/locus_tag="BACI_pCIXO100420"
CDS complement(36300..36587)
/locus_tag="BACI_pCIXO100420"
/codon_start=1
/transl_table=11
/product="Membrane protein"
/protein_id="ADK08077.1"
/translation="MLSIQRGYMYDPDDNEVIVNEIFYDAVSEQKLGSKMGVFAAVKL
PSAILQKIQENENMSYMESVAVGKETIQEILCYLDQNQKPEKLYFELQYMK"
gene 36904..38298
/locus_tag="BACI_pCIXO100430"
CDS 36904..38298
/locus_tag="BACI_pCIXO100430"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08078.1"
/translation="MYINSVQVINYGPLENFKVNFKPNCLNIIEGSFGHGKTQLFGAL
LIPLVGEKVVRKHKDSDSPNATISISTTHKNITQKNELNYIEDNFFYKFSSIGPFNHE
NPMEHQEDISYYHTFTPLFLSPEETKVNLSIDVKDIELISHLIMDDTEALKMWNDIVN
TYLIKYLSEWDKNFIHVSHGLEQILKLIKVVCIHAKNKLNSPIVIDGSFMTLSSDASK
VIFSILSAYSKSTQIILFTLSSLEIDNSYLVAKLPENRGGLYSSISYDTRHNSSSLLM
PSKKCGEDKLDDEGPVIVRYIKDSILDAEEYRYMEFKEVKGDHSIRSILSVVDQYVVA
YLNERKKQFPGTIIWGITDKERKVVGTKLIHKERDELRRSIVERLDQIQPPIPPSSYK
IDIKEVYDSSLKHIEDTYIVEVIVDTVTGNDLFATAKNEVYIKTDGGKKKLNHIQIQQ
EILLRNQHKRFNLK"
gene complement(38364..39296)
/locus_tag="BACI_pCIXO100440"
CDS complement(38364..39296)
/locus_tag="BACI_pCIXO100440"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08079.1"
/translation="MTMRTIEKQLSTYVPSIPHLSNEDVQGLQIYRIHELDKTYVFHS
YDELVKFKQRLTEEQYTVLTFIGVHTSVRFNHLLYLFKDKYSRKKINDALQGLLYYRL
IEKWQVESFDMEIFEETYTLSDNGYKLLKYWQGNMFFFAPERIDNHGKYVHLRYWHDL
DLICHLRYAPSFLGHVMHPSISKGVFTPPLSFAVQGGVDHKFNFVVYSTLLTDKKDRL
KRIIAQWKDFVESGRDVIMKDLGNNPTVLVIYVSTENQSKQVNNELLLDLLPGKVLLC
IGETLHIQGLQHAFYQPLAEGEIKQLNTKLFATN"
gene complement(39300..40283)
/locus_tag="BACI_pCIXO100450"
CDS complement(39300..40283)
/locus_tag="BACI_pCIXO100450"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08080.1"
/translation="MAEDKTNTQTVEELGMVFESENPQGDTQLETNFNQFERVREHEL
EELARMKRERIVGKGLITVVSEKLFPTKNGKSERIQVLTMQIGTHTTAYCPITEAGIN
IPKNPQWLVGRTKPVIIEHFQKTEEGNFAVVSITAGEVALQKRLYEEVTAQEGNKVYT
GTVSGHIPSAQTVLVEIHGVTVGVRYSQWSHSFVRSEDIIISDVVELIIDKVVEKNGR
YEFRGNKKILETDPMDKLLELNKRRDRFVGKIVGVDAIAGIFVEVAPGIQFKGLKSRN
LANPTPEDAINQTIVTCELLNIDAKNRRGTVRILNYPQGQSKKSNSSIFQF"
gene complement(40639..41418)
/locus_tag="BACI_pCIXO100460"
CDS complement(40639..41418)
/locus_tag="BACI_pCIXO100460"
/codon_start=1
/transl_table=11
/product="nucleotidyltransferase domain protein"
/protein_id="ADK08081.1"
/translation="MIHNEVKKVMMLYSSRLNEMFPNQVLGVYLYGSNVIGAFHPESS
DIDFVTVFNRELTGEELIKLSHLHKKVRAKCPLVKKFECEYLSLDEQNQLHLHKSFPF
FEGTKCKGKRKLMKIAVYQLVHDSYAVYGPKFSTYYSNIDWKDVMQEMEYNLNHYIAS
KASRSYLFLFDFWIEFIVLTLCRVYYTLKTGKITSKELACEEVIKDFDLRYSDILHEA
LRIRGRVQAKSNYKNRWERKNATIHFINSLREYCNQAFLSR"
gene complement(41434..42018)
/locus_tag="BACI_pCIXO100470"
CDS complement(41434..42018)
/locus_tag="BACI_pCIXO100470"
/codon_start=1
/transl_table=11
/product="transcriptional regulator, tetr family"
/protein_id="ADK08082.1"
/translation="MARTVNNQQRLVKRNVILKEAKRQFPREGFSKTTLSSIGQAIGI
NPATILLYFPSKEDLFENTVKEAFQETRKGQLYLPESLELSEQLEQMVRHHVRQYRED
PSNLRILQYLFSQSGRFPELEKEAVFITYEFVERMTELLKKRSSLNETEQELRDKTWA
YLSFLSGFTMIMLEPEKYPLWEGIVKQGVKLIET"
gene 42235..43440
/locus_tag="BACI_pCIXO100480"
CDS 42235..43440
/locus_tag="BACI_pCIXO100480"
/codon_start=1
/transl_table=11
/product="N-terminal part of transposase for insertion
sequence element IS231E"
/protein_id="ADK08083.1"
/translation="MNLSIQDELQLFAEELHQHLTPSFLEKLARELAFVKRKRKFSGH
DLAAICVWISQRVASDSLVRLCSQLHAITGTLMSPEGLNKRFNKKAVCLLKHIFSALL
KNKIYKTSVIPSSSIAYFQRIRILDATIFQMPKHLANVYPGSGGCAQTAGIKIQLEYD
LHSGQFLNFQVEPGKNNDKTFGTECLATLRPGDLCIRDLGYYSLDDLDQMDQRGVYYI
SRLKLNNMVYIKNEFPEYFRNGTVKKQSQYIKVDLEHIMNTLEPGQVYEITDAYIGKD
KKLFTRVIIYRLTEKQLRERKKKQVYTESKKGITYSEKSKRLAGMNIYVTNTPLEWVP
MEQIHDFYSLRWQIEIIFKTWKSLFQIHNWHNIKRERLECHIYGKLIAIFLCSSTMFK
MRQLILQKK"
gene 43471..43671
/locus_tag="BACI_pCIXO100490"
CDS 43471..43671
/locus_tag="BACI_pCIXO100490"
/codon_start=1
/transl_table=11
/product="C-terminal part of transposase of IS231E"
/protein_id="ADK08084.1"
/translation="MIQDHLYSLYQAIQQNTRRITKILIRLFHLLQKNGRKSHRYEKK
TVFDIMGVVYEYNGLRKQKKIA"
gene complement(44014..44196)
/locus_tag="BACI_pCIXO100500"
CDS complement(44014..44196)
/locus_tag="BACI_pCIXO100500"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08085.1"
/translation="MCLLLLAFVLRTISLKLPTGEMSMKNLSSLLNVKLFVSVVAETL
WTGVSGIAVSAEYMSE"
gene complement(44525..45607)
/locus_tag="BACI_pCIXO100510"
CDS complement(44525..45607)
/locus_tag="BACI_pCIXO100510"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08086.1"
/translation="MCSIKLEDLQRLKTFKEDKKEELQQNELNPFKDQPEYELIKKAR
NKEKMTIEEQIDYLSFKGVTFNYINESDAKNYLIENSYYYKLTAYRKNFSKNKAQKYQ
NLDFANLTDLAVIDMHLRYLLIKLSLDIEHSIKTKLMNLITNSDEDGYSIIEEYNSYQ
LNKIADKGNFVHVSDKILKDSENKKGYHRDLYEKYQKNPNIWVLIELMSYGQLSSFIK
FYVEKGKFGRNDLKHASDVMHFSKNIRDSAAHSRPILLNIVEPGQFKGRSNPKPKLRQ
YISDVGLPIPLVKPYMTNIKVHDLCALLYLHDNYVKGSRTRKERKKEMKSVFRRAKRE
KHLYTESKKLGEVLLLFGRLIIRYSC"
gene complement(45600..45869)
/locus_tag="BACI_pCIXO100520"
CDS complement(45600..45869)
/locus_tag="BACI_pCIXO100520"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08087.1"
/translation="MYEDFQLELFNLLYLNSIIMHNALLFSFYICWTVLSLNREGGYY
RYREKTIYGVIGLFVYSLEMLYMYIKYKKRFGYKYILKLGEIFYV"
gene 46326..46907
/locus_tag="BACI_pCIXO100530"
CDS 46326..46907
/locus_tag="BACI_pCIXO100530"
/codon_start=1
/transl_table=11
/product="acetyltransferase, gnat family"
/protein_id="ADK08088.1"
/translation="MLIRDYQNDDEQGWLRCRVLAFLNTAYYDNVLNKKEVYKNPSIE
LVAEIDGKIVGLIDVEYEKKEKTVCSRGTGLGGMIWHIAVHPDYARQGIGESLLKAAE
KRAIDLNLNRFEAWTRDDGWVRSWYEKMGFRLTESYYHLYFEGNEMNNRISSNIPNLY
PVFTFGHYDGEETEQFKELTRRHQCVCYEKYFE"
gene 47093..48523
/locus_tag="BACI_pCIXO100540"
CDS 47093..48523
/locus_tag="BACI_pCIXO100540"
/codon_start=1
/transl_table=11
/product="is231-related, transposase"
/protein_id="ADK08089.1"
/translation="MNMNQKKELSLLAEELYRYMSPAKLNQLAIEAGGMKRKRKCHGH
HFLSLCVWLNQQVATTSLTQLCSQLETSTGVLLSPEGLNRRFNSASVAFFRTVFTTLL
QAKIGGVSKISHSLSSYFERIRILDSTTFQVPDRFAAMYPGAGGCSHKAGVKIQLEYD
LLSGEFSDVKIEPGKRSDQAYGATRTDMIQKNELYIRDLGYFRLQDFKSIQDKQGYYL
SRLKLPTKIYRKECETVVFKTKPAQLRAVYIQIHLEDIMKQLQPGQVYELHDVYVGSK
DKLPTRIVVYRCTEEQKQKRLHDRAIREKKKGITYTERTKLLQGITVYMTNIPTEWVP
KEKIYDLYSLRWQIELLFKIWKSWFQIHRCKSIKQERLECHLYGQLISILLCSSTMFK
MRELLLRKKQKELSEYKAMYIIKDYFLLFHQALHKNTQELSKVLLRLFNLLQYNGRKS
HRYEKKTVFDILGVVYEYATSTHKVA"
gene complement(48790..50226)
/locus_tag="BACI_pCIXO100550"
CDS complement(48790..50226)
/locus_tag="BACI_pCIXO100550"
/codon_start=1
/transl_table=11
/product="is231-related, transposase"
/protein_id="ADK08090.1"
/translation="MNLSIQSELQLFAEELYQHLTPSFLENLAKELIFVKRKRKFSGN
DLAIICFWISQHVASDSLVRLCSQLHAITGTLMSPEGLNKRFNKKAVCLLKHIFSALL
KNKIYKTSVIPSSSIAYFQRIRILDATIFQMPKHLANVYPGSGGCAQTAGIKIQLEYD
LHSGQFLNFQVEPGKNNDKTFGTECLATLRPGDLCIRDLGYYSLDDLDQMDQRGVYYI
SRLKLNNMVYIKNEFPEYFRNGTVKKQSQYIKVDLEHIMNTLEPGQVYEITDAYIGKD
KKLFTRVIIYRLTEKQLRERKKKQVYTESKKGITYSEKSKRLAGMNIYVTNTPLEWVP
MEQIHDFYSLRWQIEIIFKTWKSLFQIHNWHNIKRERLECHIYGKLIAIFLCSSTMFK
MRQLILKKKKRELSEYKAIGMIQDHLYILYQAIQQNTRRITKILIRLFHLLQKNGQKS
HRYEKKTIFDIMGVAYEYNGLRKQKKIA"
gene complement(50348..50530)
/locus_tag="BACI_pCIXO100560"
CDS complement(50348..50530)
/locus_tag="BACI_pCIXO100560"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08091.1"
/translation="MEQIILNNKNGSTEIYYKLFSMLSLLTFHKITSIEKKKKNLKLS
LENELKNLTKNNPYKL"
gene complement(50622..50741)
/gene="cpdC"
/locus_tag="BACI_pCIXO102050"
CDS complement(50622..50741)
/gene="cpdC"
/locus_tag="BACI_pCIXO102050"
/EC_number="3.1.4.16"
/codon_start=1
/transl_table=11
/product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
/protein_id="ADK08240.1"
/translation="MLAVPHAHQLNILKYPPNEKIALLKVNIELEYKLSRNNN"
gene 50839..50943
/locus_tag="BACI_pCIXO100570"
CDS 50839..50943
/locus_tag="BACI_pCIXO100570"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08092.1"
/translation="MYKKIYSSIEQKRRFPCESRVPSFFFATDNDALC"
gene 51095..51292
/locus_tag="BACI_pCIXO100580"
CDS 51095..51292
/locus_tag="BACI_pCIXO100580"
/codon_start=1
/transl_table=11
/product="dna-binding protein"
/protein_id="ADK08093.1"
/translation="MTVKNKIKELRVQHEITQVQMAKDLQVTRQTIVAIENNHYNPSL
ELALKIAHYFNLKMEDIFTLE"
gene 51319..51645
/locus_tag="BACI_pCIXO100590"
CDS 51319..51645
/locus_tag="BACI_pCIXO100590"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08094.1"
/translation="MWIQKQDEMEKHHVAKASKNGFMVYTVLLLIWSLYDNFRNGHLG
NAFLILSIGNAVYFWTLVVQKRKIERFEETDDSDTTIKFVKRNKHFIIWVVILIVITV
IGLLTK"
gene 51768..51956
/locus_tag="BACI_pCIXO100600"
CDS 51768..51956
/locus_tag="BACI_pCIXO100600"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08095.1"
/translation="MNWLMLKDSKTMSGFVLAILLSILSVVLAVKGSDYWLVLIVLTS
VLTFLSVNRADKIYKARG"
gene complement(52122..55451)
/locus_tag="BACI_pCIXO100610"
CDS complement(52122..55451)
/locus_tag="BACI_pCIXO100610"
/codon_start=1
/transl_table=11
/product="conjugation protein, trag/trad family"
/protein_id="ADK08096.1"
/translation="METFKQRLPLFTTITLISGFILSFGFGLVNYIKLLYYAFEPPSY
PIEITYVPLILMFFSLLLGEFSFRFYSRIPALHVKNGKLIILIVSHIAVDIQFLWFAT
APIHAKVIPYLTDKSKHVNFGEYEAIGHVLTGNFHTLTMIFVFLPTVFMILFTLWYSG
HIVRYREEILKWVQKYEYKNHKLQKWFNSQEEQIYPDVEIGPHIEHKEMVRIKGKDRT
LNGIIIGPIGSGKTSSLIIPMINQDLHWMVRFINKFETAYKKNDYDTEEVKGTFLNGV
TVIEPSNDLCQKVFKLVQAHKIPASSVYYIDPTNPDTKNINILRGPVDKVAEVFAMVI
QGLSESNNAFFEQAQRNHLKQHIYLLKLHNPQKDVTFDDLIEMYDDVERVHRMHKLLK
IQVEKLYDFVQTGAASRDQKNEYKIIKGIEEWFNNTIREKMDFQGEPAVYKSGKYRGQ
PMHYDREEEYVKGLRNILKDLASNVLIRRVLFGKSDFDFDVHLEQGGILLVNTAKGEL
ADLSNVLGKFVLLSMQNAVFRREPNVSPYHHIIVDEFPDYVVKPFKEFPAQSRKYKVI
LTIASQTLSQLALDFTEQYMFTLLGSFRNKMIFGDVTPYDAKIFSDMFGEKEEFKEAE
SEQGISPMQDNPVSRLGSTYKKTKEVVMSPGDIMAQGAFICAARIVQDNHVQPVQQIT
SNFVPKEEFSQAITRVDEEIGRYWENERLRLINESIAKANPMKHVDAENMKKVQTLPP
IQEDEMKQNSSVETTEEQQHIVSLEDYKEHKSHNETLSNEPATMNQQGDVDDEAENKL
YEDIKEFIIESQQVSPSLLQRKFRIGYMKAMQYIEKLEQNLVVSSYTGDSNRKVLISN
NSRITEETSINTTHSSDNTISQEVAIPSEDKGTVQEETHIESVSTAITEPVINEVIEE
VIDIESPLMDECHEINMEVSELNKELSITMLKQDWNTDSIIHSRIPDETEPLFEEFPS
DGLPVTMIGTAETSIESTSIPVTITEPEETHVEINTIPIEETLNHTEENKLDEDVAKV
YESISITVQENLEKNREDHLKNDVKQPEYKPMSYKERQEHLKYQQKNKNNKSQSLVNN
IEKPKQKTSNVMSKELNNFFD"
gene complement(55469..55855)
/locus_tag="BACI_pCIXO100620"
CDS complement(55469..55855)
/locus_tag="BACI_pCIXO100620"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08097.1"
/translation="MNLQFASTTNGGVLSAREAFTNPELVLKHMTEEGATFSVSLQDI
QIPGKLNYYWYDVIIETATNKKIEVNIAVLSQEEYNQLCERDSIDLYLKQTEDAAKFF
LEKSKGLFQPEFNNRFTFHHKAQLYL"
gene complement(56046..57332)
/locus_tag="BACI_pCIXO100630"
CDS complement(56046..57332)
/locus_tag="BACI_pCIXO100630"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08098.1"
/translation="MKSKTYKYTSKGTQKSFRLKEADIFVFTFLYYKRHLTTRQITQL
YSAFEGRDFSEDSVFTKLNRFSKYGAILTKKIDKRDDSITRRATFSLKDRMVDYLQEI
GRIPKGSSKRRYSSSISLHTLCSREILVRTLLETSKKTNTNKILSELDIRSYHQKQKK
TEIEDAGLLLIPDEHISYLDKNIYIEMDMCKETNATLVEKVGKYIEYAQKNTKNITVV
FVMYDKSMFLVEDAEPPYVRMKNLLFSMREHHELLMNQPNLNMYICSLKEAGDVISDI
ILEIDDNQNFEQDILLPLSQRTVGDADWRYAFVEKVQTFKEIIDGGLRRTYRRDKDAM
QDFFFIFGNENDYRMIARLDDVVFSRREGDEGVPLVVIYPKRKKARDILLMDTYDNVL
LLSLKNEDVTIDADEQIVVRTANNIHPKRRKLVELY"
gene complement(57769..59076)
/gene="repX2"
/locus_tag="BACI_pCIXO102080"
CDS complement(57769..59076)
/gene="repX2"
/locus_tag="BACI_pCIXO102080"
/codon_start=1
/transl_table=11
/product="plasmid replication protein X2"
/protein_id="ADK08243.1"
/translation="MAGNFSEIESQGNISLKFGFLGLGMGGCAIAAECANKETQIKNN
KYPYRAILVNTNSQDFNKIEIKNAGNVRKIQLEGYEQGAARNPQVGEEAFVKHETKIF
ETVKQEFEDRDFIWITCGLGGGTGTGALLKAIEMLYEHDYNFGLLLTLPRDAEALKVL
ENATSRIRSIAMNQEAFGSIVLIDNAKLYRKFEEENPSALANEYTSYSNKYIADALHE
INLVTSSFTPFSDTHFDASEFAQVINTPGVLSLAKLELKSNQLDTENPLGYLTQLGNA
LEKGVLYDTEREELESAKKSALSIVTSPLRASRLYNFSFLNQMENFLKDRTPYVDERP
IAPYVNKHTAKKEEDIVKFYSVVAGLPLPKRVSDIIDEITRIKEEREQANSKKSNAVL
NKLFAFDDSVQEEKPKKKKLNFGAEPEVEVADDSQPTKKKLSF"
gene complement(59104..59454)
/locus_tag="BACI_pCIXO100640"
CDS complement(59104..59454)
/locus_tag="BACI_pCIXO100640"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08099.1"
/translation="MSNISMSNNEIIDVLCENLNEGIWALRVLYAEGAMHKEKLWDCI
NQYHKEYQIENEKDYEGKKILPSRYALDIMTARLEGAGLISFKPFGRVRVYEVTNLGN
VLIKELEKRVEKNN"
gene 60040..60645
/locus_tag="BACI_pCIXO100650"
CDS 60040..60645
/locus_tag="BACI_pCIXO100650"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08100.1"
/translation="MIDEQLSDGYYRVSEVATMLDIPESTLRRWLNDFDEYLNIKKER
QLKYVHEDSIDTVKKIKHYYSESKKKHEIVVLLDMDPAVIRNVYAEEIDDDDEQKETS
LVKAQQMNTNLIEALTEKITEEVTAKVTAELTKQNMEFFAAVAKQSQDNFDRINKRLE
ERDEKLMSTIRLIQEQKSANAQRQENTEQKGGFFSKLFGKK"
gene 60837..61064
/locus_tag="BACI_pCIXO100660"
CDS 60837..61064
/locus_tag="BACI_pCIXO100660"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08101.1"
/translation="MWNKINNYKYHLKDLKFMTWLFPVIGLLYAYEFFSGIMFGQEFR
WLKLLCTIIMILGFMDIRKKLRNKDYRTTLC"
gene 62304..63440
/locus_tag="BACI_pCIXO100670"
CDS 62304..63440
/locus_tag="BACI_pCIXO100670"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08102.1"
/translation="MHTQMAFSQQNFKVHGVKFFDGLLNIVKLENERKELPSSALATY
ILLHFECNDIGMLPREFQIMDLAKESGIPYTTIYTGFQICLERRLIKETPVGNRTVYE
IVDYALYNHTTAETVNMTGISLSYFRIPFHLIQTAIMSSLVKARDNRGIMFLLDLINT
FSRKVGMEHHKHKIEEFQITRRMAFLKERLKRNAKKVRQYIEIIKPIVQFTAIDSKEK
NSNETRITSIRKQVKQIIIKKFSVVFSSNCVIENDRKELHKPVAKCRKEAVSRLKHMG
QSLRKKDKENIMTAFRQEIVDYAIYLPTNQKQNELLIYAMTYALDKVEGCTKEQEIFS
IPAFMRVQFRESWMYFKEKSLSVEERHDAMINYHKKNGVYPDFM"
gene 64151..65104
/locus_tag="BACI_pCIXO100680"
CDS 64151..65104
/locus_tag="BACI_pCIXO100680"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08103.1"
/translation="MNEIVNMSKERFKKYCEDNAAFEENINRIINHYFLLLGNKAKIL
QEREFNNEIEEKTFKNNVKRFETLFPAAVKNAFLKGYQLCLEFINHPETQIPDNLYTD
PNFIKDIPFALANASEFELYEIIRTDETQEFSVFAIRTYEGIRPLLEQVFCEIAFAGA
ECAFEHERLEKGFELEKGDITPLTKAPVDRLFAITPSINGVVVHAEEHCEIWNLNWNS
KVTIDDPFIEVAEVTFIYQTKDMIQKNIEDGVLYYSILYLDTPLHEIQDRLEIRVKLN
SDFGAPRPMEQVEIEYILNEIIGKVHLQAQIPIENMILIQR"
gene 65124..66602
/locus_tag="BACI_pCIXO100690"
CDS 65124..66602
/locus_tag="BACI_pCIXO100690"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08104.1"
/translation="MLKKIVLAISDTVYTSYLREDFTGAGFEVADSDVMHIKYLDEIL
DMEQPDILCINDKRLNIDAGHEEKRELIILQKLRDIRFNWDIRIVVFTERENDDEFLA
KLIYLGIYDIFNSRKIDIDNKVIPQLLQESDIKNVAEIVGASQAPQQTKLPEVPVDKE
EEEGGKSEPASSSNKLFKNKQKRKTISEETPKAPIIKKQYKLAFEPVYEKQIGIAIPR
KTIVVASMNSRSGATFVSHLLAAYLNELQIDVNYIENLYDDGYTYPLLKGYTEAPENY
RSEFMLQRYKEMLQKESDILSIPKWKQGRINYIVKNPIVDQELKNETEQDFDHFIKVL
LANQEAPISIIDAGSDWDKDLYHEICEMADYIFFVAEPDLHQLLKIAHPLTQRERKLV
SYLALEKTRIIGNKFSPALLKHEVVEECFGDKVLTALASYEIEDVFESQLNSSTLLSS
RNYYKELEGILKEIADLLLPNQLLNQKKSSILSGFRFRKSEN"
gene 66619..67068
/locus_tag="BACI_pCIXO100700"
CDS 66619..67068
/locus_tag="BACI_pCIXO100700"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08105.1"
/translation="MQKFIIGAASLLLFVGCLFLMTDMIIGDTTHTDNKSALERAGST
AMDKSVKVGVLRAQEEVAIEPEIAKKEFEKSYKQNATFKDPASKREFSVHAVQEQPAM
IAVEGEAETASYTKQFDEKKGSIKSNAKHIFIYEADSDNKKAGGNVK"
gene 67094..67489
/locus_tag="BACI_pCIXO100710"
CDS 67094..67489
/locus_tag="BACI_pCIXO100710"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08106.1"
/translation="MQNTVTTALFLTLSLLLITLIPEGVLYGMQLIKAHDFASSTVEL
AEQTGGFQYTYEGKNVNLIPDIEKKMKEQNMDGWKYEYTKGRVDHNQPLNFKIKAEHH
FFIFKMIGIDSVKAPIWANKDGMGQIYFR"
gene 67713..68891
/locus_tag="BACI_pCIXO100720"
CDS 67713..68891
/locus_tag="BACI_pCIXO100720"
/codon_start=1
/transl_table=11
/product="surface layer protein"
/protein_id="ADK08107.1"
/translation="MKKLIYLEEQTMANKFLKTATALTIMGTSLLGAGAFTVKADNTD
SLKFNDVPANHWSTKAIYGLANRKVVAGYGNGQFGFGDNVTRGQVARMIYAYVKPADA
DASFKNPFSDIKGHMFEKEILALAKEGLVAGYGEGKFGPDDILTREQMAQVLTNAFKF
KATKTTSFTDIDKNSWALKAISALEENGVTIGTGDKLYSPYAHVTREQYSQFLFNSIN
VLEKETKPETKPETKPETKPDVLDDKLVSNEFTFNKEWYESSKVINNSSSIQAQSLIN
EVNKKYNTNLKYAEVGGVIRLVDNGMYLPEGSLKAQFYIVPINEGSFKVIFLDNNDAT
VELAKKWTTLLKSDLNLDEEIQGTVESHKLNTFEKGNYKVRIGNSTADHMMYVQVESK
"
gene 69046..71397
/locus_tag="BACI_pCIXO100730"
CDS 69046..71397
/locus_tag="BACI_pCIXO100730"
/codon_start=1
/transl_table=11
/product="transport protein"
/protein_id="ADK08108.1"
/translation="MKLRKKLIILCTSAIIGMPTLANAQNKDVPFYNGNDNTFLRSGE
LQMPGKYFRAGSEYAPAGVDLMYKGDLHYPAVYNGSFDFDNPHDNLVKNEDLSEPYVR
ISNEGYWNSAIPVGDRMVTEVERMNETIISTKYWGNPEFVLHNLFPHPINNDALPINY
GMFYWIRDVAYLSGGYAGAGGVSGVNRYSLWYVRTSKPEIKEFKVSSGKKDTPVKFLF
NGFEYVSKDKGYTERGPKLDIGNPYSDIAGERNRVKWMLDITKSGEKVHHQEDYLRST
PQKDNQKPNEGDAARFTKEDISWQPQMCGRYTAKLKIIDGVQRDSNEKTVDFIVDGNC
GTEVTPNPDPGNEDDYKYKIDFSADRIEGETAREGKNIKTRVDVSRDNFKPERDQYRE
KVNNNINKSQQEVYSSESARDSAQSSLSYCRRNPIHEKDEEGHDYYIDRDCSWEENRL
DDAASRLDTARQKLEKEKNKIKKLDALEAKYANPETVVVLKHNGQQVALEKVRLTEGE
KKTLNLDWQHKGKGTIQAEINPAGNRIDIEETTYKNNPIKTAIYEPSKEKAMCGVTNV
KGVVETVSERVSKEDTVGEMYYETLSGSVDSLSPSKLHAGYGFSYEVNGKYRNDWNAN
YPGVFTKATAQYPFADEGLKTTQDLEGVSNNGLTSKFLPKNMYLSEVTGHVFDSKRPT
KSLYWDGQEKIIDGQRKWYAPLKTKDGKYAFNVETNPAGVNEMSLCLTNEVEIKGVAY
DDFKKRRVLADLPFPVQTPGWNWVGKEHIITDLSNWYYMKNRN"
gene 71529..71690
/locus_tag="BACI_pCIXO100740"
CDS 71529..71690
/locus_tag="BACI_pCIXO100740"
/codon_start=1
/transl_table=11
/product="aminotransferase, classes I and II"
/protein_id="ADK08109.1"
/translation="MDKKKKQRVRRAIFIGVIAMIVSLYIGNELQDRNGKSYAPAKYF
ETGTKLISY"
gene complement(71873..72058)
/locus_tag="BACI_pCIXO100750"
CDS complement(71873..72058)
/locus_tag="BACI_pCIXO100750"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08110.1"
/translation="MDILFTLAIEILKVIAREVAVFVAKRVGKSLSTSWKQIQRRKTK
RTTHNAGKRLKGGSKKK"
gene 72433..73293
/locus_tag="BACI_pCIXO100760"
CDS 72433..73293
/locus_tag="BACI_pCIXO100760"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08111.1"
/translation="MKPSKFQKKQIAAVGLAAATVAGIYGYNHFAVENAVKPTKIVVA
AKDIPAHTEIKEDMLVERTLPGDAIPPNALRANKKEVVGKWTNDGQPITENSYLFKNK
VVKKEELPDSAILNLKDGEVAFPLLVDLETSSGNSIIPNTYVDLYFKQVVKEGDNEKV
VFGGLFQRVRVTAAKDSNTEDAFVLEKKESKEEQEGKQKPKVTRLYTLAVSPEQLQYL
NRAKTLGDVIPVAVGQKVERTGKELEPAEGFSQISDQKNILDYVEKHSTNPISKNVKE
YVAQYLNESK"
gene 73310..74128
/locus_tag="BACI_pCIXO100770"
CDS 73310..74128
/locus_tag="BACI_pCIXO100770"
/codon_start=1
/transl_table=11
/product="putative transcriptional regulator"
/protein_id="ADK08112.1"
/translation="MDRPVRIIAFYATNENVGKSTLSITMANELAHLGKKVLYVEADQ
VRPSFAVGTGLSHESKNMLELVRKENEYNLLQYICTKQDLLERKVNLRLIQKLHDKMD
FLVFPSGYNLAQFPEIQNKELFVTTFIESLVDTEYDYIILSVPTELSEVLSYPILYQA
DLVVHVLNGNPRGALAIKRELQLIEDAKLTMPRMIHVLNMADENYVEDIEKLSSQKIA
VTIPYDRDRTSYEWGMQFGSPQINTKVHHIMEAAGLGIPSQQSSMKKGLFGLRN"
gene 74145..75578
/locus_tag="BACI_pCIXO100780"
CDS 74145..75578
/locus_tag="BACI_pCIXO100780"
/codon_start=1
/transl_table=11
/product="bacterial type ii/iv secretion system protein"
/protein_id="ADK08113.1"
/translation="MWGYLQEKQIALKRNRVDLYHFGYMIRSKSARKLGTTTAQQIKD
ITDEIRAFLVKDHRDILSESFMNKEKRAAVEQIIKSFLLSNQVVISDVPSEQLLNMVC
DDIVGFGIIEPLKEDKDVTDIYINGTKEIIYEKIGEGECTFPYRFETEEEVKALAYKM
VNSTSESLNTAKPYVDCVFPYIRINIALDELGGLGTTITIRKNADHLRASEERMLSTN
QASKVMLDFLAAAVKSKMNILVAGATGTGKSEFMKYLASHIPKGKKKERTLVVEDNPE
LYLHRIFPEHHFVPMQCRASEVEENAIDFDRLLTNALRQGPKRLIVGESRGKEALKMI
NFFQTGHPGFTSVHARSAKEAVRRLMLMCLQSGANIDAQYLYELISQTFDVIVFLEKK
DDGNRYITEMIELLDYQGDIQFNQLSQFITTYEEHDEMNERVGKIHGQHKITARMSAE
MERKFRSSSVNPALYAPFLSQQEVQYA"
gene 75571..76503
/locus_tag="BACI_pCIXO100790"
CDS 75571..76503
/locus_tag="BACI_pCIXO100790"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08114.1"
/translation="MHSLFAYGCIFLIFISIVFLVLLFAKSKGSALSQFVQENEKEER
RLELRNIKGIRMYLPQSVIQEAQKYEWKLTKSMYWVYTILSGMSIAAVFYFSFGRDPF
TLITVLSGFLVPRFFLYRRKKRYYLVVIDRLSIYMKAVANALQISNNAKRVLVQVKPM
MHESIQEEIEKVSLLLEGGTTMYRAFRGFNETFNFRELVFFHEMLEVCSREGGANSVQ
VLLDIAEDFEKQKLYLARLRSSLSQAQRAFVQNCLIVIAMPIVIMLMSKEAYGFLAGS
MMGKIALAVNMFIVFFLATRVEKIANYNPTERGE"
gene 76505..77371
/locus_tag="BACI_pCIXO100800"
CDS 76505..77371
/locus_tag="BACI_pCIXO100800"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08115.1"
/translation="MAAILAVVVFVVMYWVFSTFLQSKKDSGSLLTNYVENAKRIEKK
NLNQMMLAPFQSLSHKYLTEEKKEQIQKKLEEAGLDTKPEEYLKMKVAYPVIFTSVFL
ICTVFHDYYLFKVGVLISPLLYFYPDYLLKKRIKQAIEARKFELPEYLIPMLQLLKTH
TTLEAVKKAQIYAGRHLRPYVSTLTAELEMYAGSDQPFRNFAAALNSPEVNTFTIALQ
QAQKTDKVQSLRIMDAQIKMMRELKHENYNRLIQNKPMEMNKFNVAVIGCIVMYPMVI
VIQSLMQGFASI"
gene 77414..77617
/locus_tag="BACI_pCIXO100810"
CDS 77414..77617
/locus_tag="BACI_pCIXO100810"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08116.1"
/translation="MLTKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQG
GYDTILARFTKASSNADVNTWNK"
gene 77684..77887
/locus_tag="BACI_pCIXO100820"
CDS 77684..77887
/locus_tag="BACI_pCIXO100820"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08117.1"
/translation="MLAKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQG
GYDTILARFTKASSNADVNSWNK"
gene 77960..78166
/locus_tag="BACI_pCIXO100830"
CDS 77960..78166
/locus_tag="BACI_pCIXO100830"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08118.1"
/translation="MLAKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQG
GYDTILARFTKASSNADVDSWNKK"
gene 78238..78843
/locus_tag="BACI_pCIXO100840"
CDS 78238..78843
/locus_tag="BACI_pCIXO100840"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08119.1"
/translation="MRFSKVMIPTLATLALGMSLMGTPASAATTADTKLNQSITGGEH
NITVTPVSNFNAVTLSGETQMTHANPGVLTVTDATGSGNGWRINVKADQFKVSGDTKS
NRTLPKGSLVLNSGGATITKVGGTSSPNPEFKTTNFIIDTDNQVTILSAKKDEGMGKY
NVSFNDKSLALTLNPHSTYVENKAGATSYESKLTYSIVTGP"
gene 78875..79999
/locus_tag="BACI_pCIXO100850"
CDS 78875..79999
/locus_tag="BACI_pCIXO100850"
/codon_start=1
/transl_table=11
/product="putative nucleotidyltransferase"
/protein_id="ADK08120.1"
/translation="MYDSLLYIERRGRMKSYVYKILISTLVVIIFILSISLKPFKVVY
AEEKQDSLPFDVSIHVPDNQLGDIKKYFNLQVKKKQNQTVKMDVHNKANTPIKVNVKV
ANALTSTNGGIMYVPTREVSQSILTDTDFYMDQYVQAPDAVTLEENQTKTIEVHLTAP
NQGGVFLGGLLFELAHDTQGQKLEKDGLNFSVHNRIEYAVAIQLNSEETENSVNKAPL
KLNGTTVESYPTQPQVHALFQNTNANIVRDVAVYYEVLSQDNVLFHGNIPAFNVAPKS
KVGLAIPWKAKEYKDGKYMLKVKIKENGVSKTYTEEFQITASNVTKYAEQNGAVKVLP
IYSNQTYMIMAGVGILIISIFVFAWWRKKNEKQREELKAS"
gene 80030..81955
/locus_tag="BACI_pCIXO100860"
CDS 80030..81955
/locus_tag="BACI_pCIXO100860"
/codon_start=1
/transl_table=11
/product="putative metal-binding, possibly nucleic
acid-binding protein"
/protein_id="ADK08121.1"
/translation="MKRGKIFTSIMLLTATCLFIGTKDNTILAEESMKKQSDIPTLTA
SGNENEVKLEWAIDILEQDVLWKIDFNNPKDVNLMSGWGEFYGNGNQSLQSEVFYPGG
TDTSGYKVFDTKSGGNRVLYTYKVRESSIAVFKRLNVPNNAYISATFKANSQGLGRIS
FYGDGSWETGREFDYYNATVLKDVPGGSKEIEISNISLFPEREPGTNIPRDRRHITSD
INKDVYQDSPMIEKVIPYQDGSGKGKIILNSPIVTPMKQGDRLKTRKWAAPIQLPNNR
TVTKNDSNKDINGWSTFSMNTQVANNPFYITEQRGVTFYMLAYSEGITYVDELKVGYA
SEAEVYRGNQQIYKGRLSDYVDKEAKDQAVPTTPESFQIENRELKETKVTFAPTKDDG
SIYHYKIRGVGRNDVSEFSKEVPATVTSGVKGYEYVVNDKSDTSLDKVGGVQFTNQTS
IQFPTDYAKPQYVHIRTVDKAGNKSTTKHISTTQKGRVDMLTVPKSVEFTPIQLNGEK
QNSFGTLGKLMIHDSRNQADGWRLNMTISPFTESNIARQLPKGSLFIKTQVSVTKVKG
PETGKPIVQIPNTPVDNGAAHTIIRASKDVAIGEYQLDFGQNGLQLQLDPGTTYVGKN
RQATYTSTVTWSLVSGP"
gene 81994..82539
/locus_tag="BACI_pCIXO100870"
CDS 81994..82539
/locus_tag="BACI_pCIXO100870"
/codon_start=1
/transl_table=11
/product="PRC-barrel"
/protein_id="ADK08122.1"
/translation="MSIYAIGILLGYMSLNVFTDLKYRKTKNIWHLLFLIVGIGITYF
AGIRTGKEIVIVLAMALACGLLLETFKFSSSGDTKMLIVVALYISNVVEETAILTAIT
LTAFHLLFFWIASVYRLIKILGFVGAFKDQLEHAASIFGAKLPKKEIQLIQSFPGACS
ILLGAIVYITFTIYQNGGMLA"
gene 82617..83159
/locus_tag="BACI_pCIXO100880"
CDS 82617..83159
/locus_tag="BACI_pCIXO100880"
/codon_start=1
/transl_table=11
/product="putative inner membrane protein"
/protein_id="ADK08123.1"
/translation="MFINMVFILAYPLLIGLIVQVVLLQKIKKPFYRSGKELTEQLKL
KNMFLVESNILGDEEGTVYEVHQMPFSFSNGLINKDKSYKIIKQEYDRKVKEDLTKIA
KWQVTTRARLVTTTHFRLYTIWQKNSTGYQLKKIEDCVDPYAKMNLIQWMIASFCTTG
RIKYDKKPKEWASYEWVTLR"
gene 83898..84449
/gene="yicC"
/locus_tag="BACI_pCIXO102100"
CDS 83898..84449
/gene="yicC"
/locus_tag="BACI_pCIXO102100"
/codon_start=1
/transl_table=11
/product="protein YicC"
/protein_id="ADK08245.1"
/translation="MKMNYEVSIFCSAHPADFMPNLRALRMKVTKEGAFWERDCYQFS
IKPSNLSQRAAKQAGEIYLYHVYFNGCIRDFLFLLERCFRGTSYRFTAIRGFLEIEGY
SLKKWKPILRSHHINSTDVDSIFKKNDLTMIVHHHGALEVAKHAEKGEQLKKVNFLNV
DSWLQALNPTKEDLFSLTGVSVS"
gene 84642..85955
/locus_tag="BACI_pCIXO100890"
CDS 84642..85955
/locus_tag="BACI_pCIXO100890"
/codon_start=1
/transl_table=11
/product="ribosomal protein L7Ae family protein"
/protein_id="ADK08124.1"
/translation="MNYNIQKGQFRLTSAYPRGSWWEFYRVTCPICHDTGNCMLHVSQ
EKVACTRVESKWIYGKNTGNPSYIHYINGKDKYQLPAADEVQIHDKKSNKELDVFNRK
LMDFIPLQEHHHTHLLRDRKMTEEQIQVRQYRSFLKQQIELEEDNTYTTVWEKLFNQI
GNKNCWQGIPGFYEMKKGQLSLRLMSGSPGILIPFRNQYNQIVGWQVRVDEVKNSVHV
KSAPTGIQAELIEQPNVVKITKDGDCIFEGELEVSKKVEIPFQEGQIVVKIHKGQKYL
WLSSANKNQGTGAGGSENPLPVHVAVPSSHLKHWNSGTLHQTKSVMITEGPMKADLIA
DLLPERFNKGEISEIGTTVLAIPGVNAWRIAMPVLKDMGIENVYLAFDADLVENQKVR
KALIDFATELKRVGYNVIIAAWNPTQGKGLDDTMQAGFKPVFQRL"
gene 86067..87002
/locus_tag="BACI_pCIXO100900"
CDS 86067..87002
/locus_tag="BACI_pCIXO100900"
/codon_start=1
/transl_table=11
/product="transcriptional regulator"
/protein_id="ADK08125.1"
/translation="MNTSMKKNLVNLRVDFAFKRLFGVEGNEEILIGFLNAVLQSSLD
EEIISLHLDDPHLPREQKDDKLSILDLRATLNNGINLNIEIQVRDKKDMIERSLFYWA
GMYYSQMTQGMKYTELRPTICINIVDFILFPGEEDFHNVGVVMNKKSEHIISENMQLH
FLEIPKVIREWQEDRMDPWEDILARWLLLFPAYEDEKLTTILEGIAMEKDPVLKKAIE
DWERLSSDKDFLRLYEAREKAIKDRISEIETAEEKAAEKAAKEAAKEAAEEARIATKI
EMIHNLINVGVPIEKVAEATELSVKEVNEILKNKE"
gene complement(87089..87364)
/locus_tag="BACI_pCIXO100910"
CDS complement(87089..87364)
/locus_tag="BACI_pCIXO100910"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08126.1"
/translation="MFMGDLISDVLGGIVMSIPSRKEKMIRKNFKLLKKETWFKEIEQ
RYGRLMVFNHSIREFVEKEDLEAILNDVKKTNEFRYELEEILKQEKI"
gene 87604..87801
/locus_tag="BACI_pCIXO100920"
CDS 87604..87801
/locus_tag="BACI_pCIXO100920"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08127.1"
/translation="MICIMQKKKEGYYVHVYTLRDKSTKSIKIKPSRSLKEEMNVLGL
KDSDIFQIQMVWYDPNQEVKK"
gene 87951..88337
/locus_tag="BACI_pCIXO100930"
CDS 87951..88337
/locus_tag="BACI_pCIXO100930"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08128.1"
/translation="MGSFCVLRAKSPGGAGIMLNWLSAKLMTTSVGDFLLAKDSFTGG
LGKNSSGSNAATVQDSMNTLVKTLIGFGGIWVVACVVFASIKLSGAQGKNPENRTQAM
IGLACAAIGGFVMIKAYDIASWVTTI"
gene 88404..88754
/locus_tag="BACI_pCIXO100940"
CDS 88404..88754
/locus_tag="BACI_pCIXO100940"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08129.1"
/translation="MRKVTVPVDMTSEQKTLLGVLSKRQLIYLLGGGAALYLYVPFLW
RLFAPFDAVVAFFICLILALPTVVGVIAFAFIYKEKQHMYLDRFLLIKMRSRSEKGKW
RKGYEPTTWVKENL"
gene 88906..89658
/locus_tag="BACI_pCIXO100950"
CDS 88906..89658
/locus_tag="BACI_pCIXO100950"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08130.1"
/translation="MSAESEVDEDNVDFFSAFVEDIKEIDNHMIRYHDDTFVLIAEAH
PVNYYLLSNMEQEAIDIKIESWLTTLEFNTKVYIQSKFVDLTDPVRKMTETMKGAKDL
TPETVLYGQEVIDNLEYWQRSQPRYEQKRYLIYPYKVDISTITADTEDELEEKIVDKA
FNELYRRYNASRNLLSKAKINVEMLTKDKLIELLYVAFNRRKAVKARFQDLIENENFS
LYSTGETNERKLELLKKVLAEEKTEKSNNGVA"
gene 89661..91760
/locus_tag="BACI_pCIXO100960"
CDS 89661..91760
/locus_tag="BACI_pCIXO100960"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08131.1"
/translation="MKLFGKKKKEKKKIEAEEKDELELEEEELEDEEIPTQLDNQTTV
FDVIAPEGMKIDAEDYGVIKQSLGSNTFFRPFYIPRDGYPRMMQTNWLNMLTSAGEVD
VMIDIHKEPKAKAMRSLDMQLTMLRSNLSFQRTRGNIDQEKDLDAKIQDTNNLMDEIQ
FNENDSYMVSTMGVAYAESKKELDVLCEYIEDEMQASHFKIASTWNRVKSGLKAVMPL
GAPNTLQDTYRNIDRRALCTFAPFVSGSGRFNGGIPIGKNKITGQVEFLNSFGNADYR
PPNYNIGVTGISGSGKSLLLKMKLARETSLADTHAMIIDPEGEFVKITKRLGGINLNI
SPESNIIINPCAIAVTELQITDKDEELEALEQYDKKELVERDGVKYVRFVPILEKINE
ILGFFDIIIRGQDFDQPGLNVFQRTMLEDAIREVFDKHGITSHPSSLYTDEVKKVDGQ
LIQSQVRKPEPELKEIYDVIVERHGDDVKAEELIAAIRPFLRDGSKPLFDGQSHFGRG
VETQLNESRVVNFNISHLEEGFLKPIAFHVILNYIWEHWIKSPEHAIKRKVLYVDEMW
QFIDYEQTVNFLEKVARRSRKRNAGMCWASQDFVRILENVKARGILQSTFSYFFLEQN
KIDKKKIQENFNLTAGELDIILNNPGKGEGIFRVGDSSVWIQTDPSDKEMMFIESNEA
VLQELLNNMKKVQGYAG"
gene 91791..95807
/locus_tag="BACI_pCIXO100970"
CDS 91791..95807
/locus_tag="BACI_pCIXO100970"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08132.1"
/translation="MLEKIIDWVGGLIIHMVKTLLAPIYGFMDTIPVLVFGGDNANLD
FLYEKNAVTNVLDTGMPVMFKFVAFCVLVSVVFTAAKYSATAINPNNRTALIEYAKDL
MIISICLWHLDFFYNFVFNLNNWITLEFKEAINGVNNGNFNPDQQIPLLKSGLSDYKT
ITELSMKGHENDYMFIIFGLFIEAGLMIWANFYYLMRAVTLYVLMLLGPVMVGMWLFP
QKKQQTLYWIREFMGAVLIQAIHAITLWLVITLIGGAQNPIIKLVLLAMFIPVGEIVK
SFIGLSTNASAGIHRAGTMMGMGALASVAGLVKGVRDDYRNSKVKPDDKGDKEKTKED
ADNPKDALGANLGTDIGTTSRAARMLKAGQVGSALGKATTGLAGMAAGAGLGPGAMVA
GSQVGSALGAAPGAAAGRSVAAVGEGAVALGKHIGSSIKKGADTYSNLNGESYPELTD
EDIAQDLATKDFENWKADNPNSAVASRLKQAFPNASDAEIAKKVAKTNSDQMSRFTNQ
RKQDLQNMKKTATPYGNARDLVNAATNAFQKGYEGDHKDTFMSQLPENMSAEEKEKQW
NDHLNAKVQGFRNHAEQAATKAGAMPVDAKDKQGNNLFDKSYVNKDAFASQLALGKVG
KAVEGVKGETLESDHQNMGQVGALVGASTAAFKKGYTADHKAGFMKQFPADMSQQEKE
AAWNKHLDQKVQGFKNYAQQAAESAGIVQQKDGTNYANKEAFASHLSQQLQKNPDLNA
MGISSAAGIQKAVNGVKTHGLTSGTGSQQAKQVSNVGNLVQASTESFKQGYAAEQQAS
FMKNLSPTMSQQQKKQAWQSHLNEKGNEFKAVAQQAAVQAGAMPVQAKDTSGKSLHNQ
SYINKDAFASQLTKGLQSHASLGTVSQQVGSGITSAIQGVRSHGVAAGGAINKAVYAA
TQTQASIARAGDLSVAEIERSYADASTSVANIAQSAGKMSIPTSAVGRITQQSTKLGM
SVMEGAKHLMLADRIDTVSNAYFSAASAVQQSGGNAVQRVISGTTAAVNTSLGGNAAE
RHYNVTKGLSYAAGVIGGAGAYQATARMVSKHNPYNSAVRTEAKEIQEIQQMVPTTTD
HTGAQSVVKGAVRLVTTNNKSWIEAKDASGMTQVVSRYGSGDSSIRSGQVVYQDLNIS
DGQLTQYRNGTKASPAYIQDSSGGKININRSINVNPNQLVGNPNQRPLQQKLVFNEPP
LTVNHKVDNGHFYMSDLDQGGYKNVQMVVERDRSYMVATTTDGTVSRISPFGKGDTRL
QANQRIERACEVKDSSIKPREEILVTHTQDEVVRTETHLNLSEHDPQNLIPFAPNPRL
AQRRGRNSQNGKYGVISL"
gene 95890..97995
/locus_tag="BACI_pCIXO100980"
CDS 95890..97995
/locus_tag="BACI_pCIXO100980"
/codon_start=1
/transl_table=11
/product="possible membrane protein"
/protein_id="ADK08133.1"
/translation="MQARGKIAKLAGKAGKAAAKAAAKMLKAGILKIVGAVVAAVGVP
AALIMGVIIAVCVILVSLVPFTDDDTKTEEQVKKYMEVSMALNVDWKEVVAFDMARYD
NDLTGKDPHDAISYFLDIQYEEYTEKEVCEAGPNGPCEKKKKEMQKTKSESYSGPDVK
KILGDTDFKKKIDEINASGSKKVTTSSHGLEKAMELAKFSKSQKERAREILEAGLLEA
TYGHLAPSSNFVGGMCVGNVSPGGEPVNLNAKVTGYLPKIKEMAEKHGVAQYVGILAA
QMMQESQGEGNDPMQAAEGHYGDLSSSCIGLKGSARIGCIKDPNISIEAGVQEFKDVL
AKANGDIALALQSYNYGPGFISYALAKGGYSEETAIAFSREHAGENPAGCSDPNNFRT
KVGACYGDFTYVSKILKYYKDLGCVTAGDGEWISDKGWKWPTKSGRITDTFDAVRNGK
QHNAVDIGAMTAGKPGDPVWSMEAGVVTAQTGYVNYGGLGVYIDHGNGIVSRYLHLSK
ISVTPGTMVTKGQIIGEMGGSNYVGGVLNMLGYAVHLDFQIRINDQPTDPMKFFKKND
DPGLSSGGSPTMTNAKRQKVLEEAKKWLGQGKVRYVLGDRNPPGGTSDCSGFTQYVFR
TSIGVQLGDWTGAQVGQGKQVPDINHAQPGDLIFYENPGHVAIYMGNQKMIHIGDNKG
VTNYWSKLYGKRSTYDANT"
gene 98025..98600
/locus_tag="BACI_pCIXO100990"
CDS 98025..98600
/locus_tag="BACI_pCIXO100990"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08134.1"
/translation="MKKIINILFNMPRKYLVILGIIVLVVGVATYNTIHRYMMKSQVQ
EEEQVNQDEIEMLGDKPKGFDTKEDEYIAKTKTVEDLLRKISNSSYDVPYLFTKAGFG
IEPMKMTSNERMLATEAVQRYFLNGDKFYNARITKIDRGKKVDTFHIEVLIQQVNFLE
PRQFKVQVNKYAQIVTPIAQIPHGQEEVPVD"
gene 98758..99141
/locus_tag="BACI_pCIXO101000"
CDS 98758..99141
/locus_tag="BACI_pCIXO101000"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08135.1"
/translation="MRMLIGTAANFVSGYYIGRNSGLLGTLLGWAFLLGGGYLLIENW
DSITAWMHSLNIVRGLDGYEDMSNGFVFICLVVSGFILILLSPLFIILLIVCFVLMNI
VACTLVLLTSPSTYIKKKDKENEWE"
gene 99132..99437
/locus_tag="BACI_pCIXO101010"
CDS 99132..99437
/locus_tag="BACI_pCIXO101010"
/codon_start=1
/transl_table=11
/product="possible aluminum resistance protein"
/protein_id="ADK08136.1"
/translation="MGMSTILVLGGSNGRTLEKLAKKRDCQVIFHDGKNHGGVKKTFR
SVIKKCDVIVIQKGACGHVSIDVAKEYAKKYDVPLLFNQGFGGTGALEMGLKHLKAA"
gene 99567..99854
/locus_tag="BACI_pCIXO101020"
CDS 99567..99854
/locus_tag="BACI_pCIXO101020"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08137.1"
/translation="MKGRFANVRTKKQVEFIKRRYKEAYQTVIGVMDGLKVGDKVVIH
TCLESKRYDGKVWTCRTNQFTAESGTQVVFLEGFRGYFAVKFLQRISLLEN"
gene 99930..100661
/locus_tag="BACI_pCIXO101030"
CDS 99930..100661
/locus_tag="BACI_pCIXO101030"
/codon_start=1
/transl_table=11
/product="caax amino terminal protease family protein"
/protein_id="ADK08138.1"
/translation="MSGIKKIKKVEGGNKNMSSGIRYKSGFVILIYFVMTQFVGIIGV
QLLAKTGWYDIQGNQQQAIQQLLVHWDLIGFSLMLIIIFLIYGKEIINDPKLSIKLSR
NSFIWILVGIIFVFLAQIVGSMLDKSIFQLTTQSANTSNIVAAAAISPVALISIVLLA
PLVEEFVFRYAAINILMSKFKQTWSILISSSFFSIMHFDFPFIFGYFLIGVILALVYV
RTNRLLVSFVVHASMNLIVVILQIS"
gene complement(101082..102227)
/locus_tag="BACI_pCIXO101040"
CDS complement(101082..102227)
/locus_tag="BACI_pCIXO101040"
/codon_start=1
/transl_table=11
/product="membrane protein, putative"
/protein_id="ADK08139.1"
/translation="MQQNARIHSLDIIRGIAILCILFANLPTMTGLDSFNQAGYTGTD
KAIRFLVDLFIQAKFYTIFAFLFGVGFYIFMKNTEAKGYPMYKLFTRRLYILLVFGLL
HFTLLWFGDILHAYALAGFILLFFYKRSTKLIFIAGCSFLLVSYVLHIIVFLRASSTI
TEVPNYYQYMFTGNTTNHTVNLFIHYSHQVKARLFFLMTQEFQQLLIGIPEYIGLFLI
GLWAGKKNIFKRIPGLIKKIRFLQWSSLCISCLLSCPIIYYFIKMDVYYSKDVQLWIL
FGGKTLAIFYICTLLRVCENKKYIEWLQPFMNVGKYALTNYISQSILTLVILSLYFKD
VSQVYYWKLCTFGLLIIFVQMIFSKMWSEYFRYGPIEWVWRKGVYKK"
gene complement(102267..102749)
/locus_tag="BACI_pCIXO101050"
CDS complement(102267..102749)
/locus_tag="BACI_pCIXO101050"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08140.1"
/translation="MKKIYKIGAVITTLCVIGITIFTLTKNESVKTEIVTPEKTIVSA
ADVKGLPENIKDISKEELKQKIQSHEEFIAYYYQPTCHYCKKAAPDINRMSKKHDRTI
YRIDISTSENQSAFQEFDIPGTPVVVAYNRGEEVERLEGAVSAATYDGFFARRNSSAS
"
gene 102977..103475
/locus_tag="BACI_pCIXO102140"
ncRNA 102977..103475
/ncRNA_class="other"
/locus_tag="BACI_pCIXO102140"
/product="putative ncRNA RNAIII like"
/note="RF00503"
gene complement(103619..103897)
/locus_tag="BACI_pCIXO101060"
CDS complement(103619..103897)
/locus_tag="BACI_pCIXO101060"
/codon_start=1
/transl_table=11
/product="conserved domain protein"
/protein_id="ADK08141.1"
/translation="MQSSNDNESRMNSYVKSPATLTVKNNKKYISFKVNSSSYIKGLQ
IKKGNKFVETAVLEKNIQENSRIGEFEVDNLLNILDSKVHVKIPVIYD"
gene complement(104518..105543)
/locus_tag="BACI_pCIXO101070"
CDS complement(104518..105543)
/locus_tag="BACI_pCIXO101070"
/codon_start=1
/transl_table=11
/product="conserved domain protein"
/protein_id="ADK08142.1"
/translation="MNNVIKRRHTIQYAQIHNNPLQNDLVDLRAIGLLSHLMSLPSDW
IIYKTQLYKKFSRKNIDAAWKELANKNYIIGFNCYVNGKKQSFYNVSDIPFKSEEFVE
FIQGTITELIYSGYSVKSLSPMNGGSLDIDRDLTDVLNVHQFETFNTESSVPTVQYSQ
YCTVGTHTKDKVNKKTQKNLEDDKPTVLYTIRNNTKKPEIETINQKMHPTPLLIDSEI
SKINNKVRDIFKNNIQKRSFDSVLKKCINNYNKGTVPNYENYLITSIENKIEELEIRR
KKENSFIPKTKKRRCRTEIVPEWLSEQKNTETLSLGERSKPQIPSQKTIEDERKQLME
IIKKYKK"
gene 106438..106611
/locus_tag="BACI_pCIXO101080"
CDS 106438..106611
/locus_tag="BACI_pCIXO101080"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08143.1"
/translation="MNVKYGLIMFIALLLGLVLFGYFNMQYTDDYNQEWTAFNGKIYR
IPKNECGLNGGGN"
gene 107068..109089
/gene="bslA"
/locus_tag="BACI_pCIXO101090"
CDS 107068..109089
/gene="bslA"
/locus_tag="BACI_pCIXO101090"
/codon_start=1
/transl_table=11
/product="s-layer protein"
/protein_id="ADK08144.1"
/translation="MKKRKIKAITSFTLIGSILFGGNINSTQAESDFKKIVPDQMVPA
FLDVPSNHWANVAINNLLKKEIIVGYGNNKFGLGDSVTREQVAAVIYRIKFPEKEVEA
EAQNPYRDVNKSSTMFLDEILTLTKMGIFSGDEKGNFRPKSPISRAEMTQVIKNAFNI
PVVGKHNFRDVAKDYWANDAISALQSNQLVSGTGNGLFEPYKSVTREEYAQFIFNVLN
FEDLVNKEKQLDELNKRRDVINQKIDEFDKLNSQRKDLERMLEELNQKLSQLKQQSPQ
LQDLKNKLKESQSRLLELNKKDSNRLELNSEIKKLNDRKAELLSLIMELIKQQSEFDK
KIKNEKDDLNKKREDLINRIAESKELAKKKAELNTKLVELFKVQEALNKKSGQYLYYI
NKLDNELRELADKYKNSDNKISRLKNHIGEYNKQLEKIENELEECNKKIDNTKKQLAE
FDKSNKKQQELESELVQLNKKIDELGKRHKHRQELEASQKKALDEAKEINKKLAEKDP
ERQHINDKLKKLNNDWRLTNNELNRLNSELQKVNTKLLGYSQEHQYYNALNKERTELS
KKVDEIYQKQSEIDKNYIELNRQLDELSNPKPNEQVQLLKNQINELNSSINQILNHRK
NEINNITQRKDHIIDQLNQFPKLNLEYQTVKNELNVIDQEIGKLVQSKA"
gene 109301..110143
/locus_tag="BACI_pCIXO101100"
CDS 109301..110143
/locus_tag="BACI_pCIXO101100"
/codon_start=1
/transl_table=11
/product="phosphatase, pap2 family"
/protein_id="ADK08145.1"
/translation="MFNFDVSFLKWMNNIENVTLSSYLKFVSNMASETLYLIIISMIY
WCVSKRKAFHMINIICISGYISVMTKGFLKIPRPFTYDGIQALYEESASGYSFPSTHV
QLTTTFWSSLMVLFKKKIIYLIGTVFIVLIAISRLYLRVHWFSDVIGSIIIGVVIICL
YVKFIMKISDIKIPFLQWGIVIFSLIAYYFTDQVENYKVLGIATGTTIGMILERKFVN
FNEKNVFIVQLCKITTGLFFVMAIQVILKKSIPELIFVRYAMTGFAITFICPYVFRIF
HVHR"
gene complement(110408..110635)
/locus_tag="BACI_pCIXO101110"
CDS complement(110408..110635)
/locus_tag="BACI_pCIXO101110"
/codon_start=1
/transl_table=11
/product="transposase"
/protein_id="ADK08146.1"
/translation="MSKIIFKEIQIKQLEKNKNVLKASERSISYCPDFKIRAVKENQQ
GKGPSQIFLENEFDLAVIGEKKPKQCLKRWR"
gene complement(111232..111369)
/locus_tag="BACI_pCIXO101120"
CDS complement(111232..111369)
/locus_tag="BACI_pCIXO101120"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08147.1"
/translation="MDSPYVFYSVLINQKEIYFLNINFQGILNNRWKLTNIILHCHTA
E"
gene 111375..112772
/locus_tag="BACI_pCIXO101130"
CDS 111375..112772
/locus_tag="BACI_pCIXO101130"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08148.1"
/translation="MKNFFINIKPYTSYEKFRSYLPKGENSLKQNKIKSSLKMPFILL
VFSLLIVAMYYINFTIRGSFSLFLGIYGTLMVIYLLGKQSLSFFYRPITGDKVPNMKV
AVVVPSYNESASAIVNTINSVLAQDYPIHEIFFVDDGSKDKSAYEVALKMREELLRTQ
REIAATTKNNCSEILGIPDLIVHRLPKNCGKRHAQLWAFKRTTADAIVTIDSDGDLFP
NAVRELLKPFNDEKVMATTGHVNIRNRNDNLLTKLIDMRYDNAFRVERAAQSVTGNVL
VCSGPLSCYRREVITENLEHYGSQMFLGEEVQFGDDRCLTNYAILKGKTVYQSTARCI
TDAPTTLKQFLKQQLRWNKSFFRESLISLGIGMKKPNVLVWTIFEISLWILFGLSLLL
SIILKASHVGLILAVYYLGYISLAAYARNVFYLLKHPLTFLLAPLYGILHVLALLPIR
FYALLTIKSNGWGTR"
gene 112815..113702
/locus_tag="BACI_pCIXO101140"
CDS 112815..113702
/locus_tag="BACI_pCIXO101140"
/codon_start=1
/transl_table=11
/product="utp-glucose-1-phosphate uridylyltransferase"
/protein_id="ADK08149.1"
/translation="MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEA
VSSGIEDIIIVSGRGKHVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIR
QKEPKGLGHAIYCARRFIGEEPFAVLLGDDIVSSTYPCLKQLIDVYEEHHCSVVGVQR
VLETEVSKYGIVKSANQNVNQSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVL
KNLPVGSGGEIQLTDAINVLNKQQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESL
KEDVLSYLRNITRDKLINK"
gene 113729..115060
/locus_tag="BACI_pCIXO101150"
CDS 113729..115060
/locus_tag="BACI_pCIXO101150"
/codon_start=1
/transl_table=11
/product="udp-glucose 6-dehydrogenase"
/protein_id="ADK08150.1"
/translation="MNISIVGTGYVGLVTGVCLSEVGHNVTCIDIDEEKVKKMKLGYS
PIFEPCLEELMKNNIIKGRLHFTTNYVDGADGAEIFYIAVGTPQKEDGSADLSFIKQA
AINIARTIKNDVIIVVKSTVPVGTNIYIKNLILKNLNYDVKVDIISNPEFLREGSAVN
DTFYGDRIVIGSENKTSANVMEEVYKPFGTPIFKTDIQSAEMIKYASNAFLATKISFI
NGIANLCEMVGADVEKVAQGMGQDKRIGSQFLNAGIGYGGSCFPKDTHALVKVSESLQ
HKFHLLESVIKLNKNQQTVLIEKIKKRFGSIVGKKIALLGLSFKPNTDDLREAPSIPI
ARKLVEEGAQVIAYDPVAIKNAREVLPKEVHYVYSTMEALTEADIALVLTEWDEVVDS
LLLKASQLMKEPVIFDGRNCFELNEAKNYDVEYHSIGRPSVLREVKGEITA"
gene 116334..116585
/locus_tag="BACI_pCIXO101160"
CDS 116334..116585
/locus_tag="BACI_pCIXO101160"
/codon_start=1
/transl_table=11
/product="is1627s1-related, transposase"
/protein_id="ADK08151.1"
/translation="MGTRKSYSEEIKWKTIELKKQGYTNKEIMEQLGIKNKAQIKTWM
KWHREGETYRFNRPVGKQSTLQKTSEEGITEIERSWLKK"
gene 116606..117250
/locus_tag="BACI_pCIXO101170"
CDS 116606..117250
/locus_tag="BACI_pCIXO101170"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08152.1"
/translation="MKDEYSIKEICILIGIPRSTYYRWKNKEKDVKEAKLEQAILTIC
MTNHFRYGHRKVTALLKRKYNYHPNRKTVQKIMQKKSLQCRVKRKRRTWINGESRIVV
ENLLNRNFQANKPNEKWVTDITYLPFGTEMLYLSSIMDLYNNEIIAYEISNRQDVTLV
LRTVEKAIKLQQKTQIILHSDQGAVYTSYAFQTLSKKMALPQVCPVKEIVMIMP"
gene 117271..117429
/locus_tag="BACI_pCIXO101180"
CDS 117271..117429
/locus_tag="BACI_pCIXO101180"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08153.1"
/translation="MKSELFYSQEKQIHSTSTLKQLIHDYIEYYNTERIQEKLNYLSP
IEYKKQVA"
gene 117441..117539
/locus_tag="BACI_pCIXO101190"
CDS 117441..117539
/locus_tag="BACI_pCIXO101190"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08154.1"
/translation="MYQIRGSVHLVCGFNGGVFRLKTRVHYLEEIK"
gene 117625..117735
/locus_tag="BACI_pCIXO101200"
CDS 117625..117735
/locus_tag="BACI_pCIXO101200"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08155.1"
/translation="MNEMVLNRLNVPSSTNCRKTILLWEKPKELSELEQL"
gene 117890..118147
/locus_tag="BACI_pCIXO101210"
CDS 117890..118147
/locus_tag="BACI_pCIXO101210"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08156.1"
/translation="MEPVLVSHQLECQFEVAIPTEKGVTDVTYLLFGELTLYLSTIID
ASNREIISYIISELQTLTLDLRKLKRAGRGRKVENVIRHSD"
gene complement(118441..118686)
/locus_tag="BACI_pCIXO101220"
CDS complement(118441..118686)
/locus_tag="BACI_pCIXO101220"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08157.1"
/translation="MVKQYIEDREKLALEIQKYYNSLGLKSKRCFLGSEDGEAVVGID
KEGELIKLIHLDPETIEGMQNNKNLTTFFRKFHEIIV"
gene complement(118731..119042)
/locus_tag="BACI_pCIXO101230"
CDS complement(118731..119042)
/locus_tag="BACI_pCIXO101230"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08158.1"
/translation="MILLELIQGKEKHTIGLFNNEECIKKFIDKIPFVTKTSYTIDNH
NYTEYVLLYSQIPEYYEVNYKEFIFILSKYMFSRNEKIYISWNFIHYWDEKWNLNKKT
F"
gene complement(119139..119594)
/locus_tag="BACI_pCIXO101240"
CDS complement(119139..119594)
/locus_tag="BACI_pCIXO101240"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08159.1"
/translation="MKISYGISTTNLLDYYKNTEDHIGISRNEDRLIEKDFKNRETQN
DDWILNRAYQLAERYELKEIVIFQKNNDIKNLILDPMCDKTNLNYFGYCIKCTIDEKN
KNLTLNYLTHGHLFKDWPFSISGFKFLNVGEYLKTLETKKYKEYEEIFQ"
gene complement(120420..120797)
/locus_tag="BACI_pCIXO101250"
CDS complement(120420..120797)
/locus_tag="BACI_pCIXO101250"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08160.1"
/translation="MSLNLGGYVDNYKTFDKPKRYIEIELPHGVTFVGKPNTLPKERL
NIQLYTKGVVWPTHEAYVKDIIDMRKDSNVGRIPLSKGVINYYYIHAYISNIKVNVDT
NVYKDDYVKFKAGGNTLTYLHFI"
gene complement(120927..121379)
/locus_tag="BACI_pCIXO101260"
CDS complement(120927..121379)
/locus_tag="BACI_pCIXO101260"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08161.1"
/translation="MIFTQDGNSLRVESKNNGKSVSNKRHAWSVRVDGKEIYSFHEST
KVEQVVDAFNKLPKVKKQGKQFEVVQKSHEIHRLGSKDGQLTFFKVGSVFSMYAQKPD
KSISTKDKNWAVLVDGVIKHTFSKKTVRDVKASIDKLKLRGQRFELQL"
gene complement(121433..121546)
/locus_tag="BACI_pCIXO101270"
CDS complement(121433..121546)
/locus_tag="BACI_pCIXO101270"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08162.1"
/translation="MKKKHIVTTTALSFGLIALGGVGTTFAAADILRNLAQ"
gene 121680..121796
/locus_tag="BACI_pCIXO101280"
CDS 121680..121796
/locus_tag="BACI_pCIXO101280"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08163.1"
/translation="MEERSIKVTYSTASDVFYFFYEKISSLIVKFEGAMLLI"
gene 122034..122228
/locus_tag="BACI_pCIXO101290"
CDS 122034..122228
/locus_tag="BACI_pCIXO101290"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08164.1"
/translation="MVLHKLCSCKGNYYDNAAIENSNGIMKFKFLNRNEFKNIEYFKY
ELVKYTAYYNHTRINRNKKS"
gene 122856..125258
/gene="cya"
/locus_tag="BACI_pCIXO101300"
CDS 122856..125258
/gene="cya"
/locus_tag="BACI_pCIXO101300"
/codon_start=1
/transl_table=11
/product="calmodulin-sensitive adenylate cyclase"
/protein_id="ADK08165.1"
/translation="MTRNKFIPNKFSIISFSVLLFAISSSQAIEVNAMNEHYTESDIK
RNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDVLEIYSELGG
EIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLIINIKDYA
INSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQKFKEKL
ELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEKGGF
EEISESLKKEGVEKDRIDVLKGEKALKASGLVPEHADAFKKTARELNTYILFRPVNKL
ATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQQLAVEKGNLENKKSIT
EHEGEIGKIPLKLDHLRIEELKENGIILKGKKEIDNGKKYYLLESNNQVYEFRISDEN
NEVQYKTKEGKITVLGEKFNWRNIEVMAKNVEGVLKPLTADYDLFALAPSLTEIKKQI
PQKEWDKVVNTPNSLEKQKGVTNLLIKYGIERKPDSTKGTLSNWQKQMLDRLNEAVKY
TGYTGGDVVNHGTEQDNEEFPEKDNEIFIINPEGEFILTKNWEMTGRFIEKNITGKDY
LYYFNRSYNKIAPGNKAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDS
GDKDEFAKKESAKKIAGYLSDYYNSANHIFSQEKKRKISIFRGIQAYNEIENVLKSKQ
IAPEYKNYFQYLKERITNQVQLLLTHQKSNIEFKLLYKQLNFTENETDKFEVFQKIID
EK"
gene 125351..125524
/locus_tag="BACI_pCIXO101310"
CDS 125351..125524
/locus_tag="BACI_pCIXO101310"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08166.1"
/translation="MDIPLILWEVVDIKQHIANELECRSKEIFLKNISSLIKNGTVYK
AATDKIITYMQKI"
gene 125545..125877
/locus_tag="BACI_pCIXO101320"
CDS 125545..125877
/locus_tag="BACI_pCIXO101320"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08167.1"
/translation="MESRGFIFGCPVSYALGIGFIPVRKLGTLVGFDNENVKDILTIN
NDAIKPGQRVLITDDVLTTGRTIEAIIKLVEEAGGIISGIVFLVELTDLDGRKMLDGY
DVLVLGID"
gene complement(126257..126460)
/locus_tag="BACI_pCIXO101330"
CDS complement(126257..126460)
/locus_tag="BACI_pCIXO101330"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08168.1"
/translation="MNVFACPMGCILEYVTTDREGYRQYKSNPEDCAVCPLREVCFSK
KQKQKVITHHIWEKYKDIAKKTS"
gene complement(126466..126771)
/locus_tag="BACI_pCIXO101340"
CDS complement(126466..126771)
/locus_tag="BACI_pCIXO101340"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08169.1"
/translation="MRDGKPNGFHFLDHRTTDAKYNIITDTYVTAGNMADSEPYLARL
QAQIDKFGFKVEAVALDAGYFTGYICKKLSERNIFMVMGIADLENEIKKYRKANLNM"
gene complement(126846..127418)
/locus_tag="BACI_pCIXO101350"
CDS complement(126846..127418)
/locus_tag="BACI_pCIXO101350"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08170.1"
/translation="MMGALKNHRDERVSVSVEELVPQYHFLRAIEATISFEFIEEKLR
PYYCENNGRPSIHPIVLFKMMFIGYFYGIRSERQLEKEIKTNIAYRWFLGFSLSDTIP
DHSTISWNRRTHFIHTNIFEEIFDEIVRQATEHRMVGGRALMTDSTHIKANANKNKFV
HKYKKEKAKFYIDELEAAVIEDREVHRKKN"
gene complement(127447..127704)
/locus_tag="BACI_pCIXO101360"
CDS complement(127447..127704)
/locus_tag="BACI_pCIXO101360"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08171.1"
/translation="MAVSYLLGNILTADIVTKLKHNVDIRAEGSGKPGTRNMGRVYGK
GYLFHLYKIKTTYLYVVFIRLWRKSSPQPIFVSEPLFMCQH"
gene complement(128013..129440)
/gene="atxA"
/locus_tag="BACI_pCIXO101370"
CDS complement(128013..129440)
/gene="atxA"
/locus_tag="BACI_pCIXO101370"
/codon_start=1
/transl_table=11
/product="transcriptional activator"
/protein_id="ADK08172.1"
/translation="MLTPISIEKEHIRLINLLHFINEQNRWFTIKELSDYLQVADKTV
RKYLKLLEDEIPPSWNLLVQKGKGIYLKKPLNESLSFVESKILRKSLNLQICEELVFK
KNSMQSLAQKLHLQVGALYPIINQINYDIQSSHLNIKKKPLEISGREQDVRVFMLRLY
CNIPNDYWPFPYINKQNITDLINKMEKNLNVQMYTYSKHKLCVLFAITISRLLSGNTI
DNVSGLILVNKNDDHYKTVASITSELQNSFGVTLHETEISFLALALLLSLGNSITTDS
NKTLTSYKKTIMPLAKEITKGIEHKLQLGINYDESFLTYVVLIIKKALDKNFIQYYNY
NIKFIRHIKQRHPNTFNTIQECISNLNYTVYSHFDCYEISLLTMHFETQRMLFKNNPK
KIYVYTSQGCIHREYISALLEKRYNGLIKIVRNTIINLTNESLQDMEIDIIISNVNLP
IKNIPIVQISEFPTERDFHEIKKII"
gene complement(129555..129635)
/locus_tag="BACI_pCIXO101380"
CDS complement(129555..129635)
/locus_tag="BACI_pCIXO101380"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08173.1"
/translation="MLICYFNRRNKKPIFPLKKSFPKYVF"
gene 129799..130251
/locus_tag="BACI_pCIXO101390"
CDS 129799..130251
/locus_tag="BACI_pCIXO101390"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08174.1"
/translation="MEATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGT
HLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLL
NPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYYELKKKYN"
gene complement(130407..130913)
/locus_tag="BACI_pCIXO101400"
CDS complement(130407..130913)
/locus_tag="BACI_pCIXO101400"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08175.1"
/translation="MEKSLEQFQYNWNNKTPQKLTDTYYATINNMYLDKYNNSIIDLN
FNLGGFIDNYKTYKKEERYVEIELPYGVTFTGEPSKINSNKLKLYYYVKGYIRNAGYF
YNITVDLLKGSNTGRILLRRAALNYYYLHLYMHNIKLNIDTNIYIKNYLTFKAGGNYI
YINNKILK"
gene 131001..131083
/locus_tag="BACI_pCIXO102150"
ncRNA 131001..131083
/ncRNA_class="antisense_RNA"
/locus_tag="BACI_pCIXO102150"
/product="ctRNA_pND324"
/note="RF00238"
gene 132039..132173
/locus_tag="BACI_pCIXO101410"
CDS 132039..132173
/locus_tag="BACI_pCIXO101410"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08176.1"
/translation="MANKSFSNVLLCNTLFNLTLFWIFIRRAAAIFESNFVEGELYEK
"
gene 132163..132369
/locus_tag="BACI_pCIXO101420"
CDS 132163..132369
/locus_tag="BACI_pCIXO101420"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08177.1"
/translation="MKNEKDLIHNWKIDLQIIKEEKTKRKNKKKKNKKRKNYKIGNRE
VVFGDKRLYYKKNGVWRQIETRRK"
gene complement(133377..134855)
/locus_tag="BACI_pCIXO101430"
CDS complement(133377..134855)
/locus_tag="BACI_pCIXO101430"
/codon_start=1
/transl_table=11
/product="transposase x"
/protein_id="ADK08178.1"
/translation="MKQTQQIPLEFTEDVEKYLNKRFEQLDIELSKVNCLIANQDLQG
VTIYGDKIQVASLKKMVPEDVEEITRLVYDLLPRIKLTDLLVEVDTWTQFSKHFVHLH
TQKAPKEKSILFAAILSDGINLGLSKMADACPNISYSQLAWIADWYIRDESYTKALGD
IANFHHKQPFSSYWGEGTTSSSDGQFFRAGGTSSPLAQVNGKYGHDPGLSFYTHISDQ
YHPFYVQVISSSEEAPHIIDGLLYHETDLQIEEHYTDAAGFVDHIFGMCHMLGFRFSP
RIKTIDNHKIYTLSVPTIYDHINFMVGGTIQVKKIRENWDEILRLVSSVRQGTVTASL
ILKKLSSYPRQNSLCIALREIGRIERSLYMLKWIQDPEHRRKVQVELNKGESKNSLAR
AVFFNQLGEIRDRSYEDQLHRASGLQLIISAIVTWNSIYISRAIETLRNNGIHIPEEY
IQHISPLGWEHIALTGDYIWNLNQELNFENLRPLRKNRIKQK"
gene complement(134899..136395)
/locus_tag="BACI_pCIXO101440"
CDS complement(134899..136395)
/locus_tag="BACI_pCIXO101440"
/codon_start=1
/transl_table=11
/product="transposase x"
/protein_id="ADK08179.1"
/translation="MIIIDFLEERNPILKTRELLTDIQRTFFYKIPSQMDERELIRYY
TLSDEELQIVNQQRGDHNRLGFAIQISYPRFPGRPLLAKEKIPQFLVNFLAKQIGVAS
WEVQNYARTRDTTRREHVNKIRNLYNLRTFTLREYRELARWLLPLAMKTENGYLLVEA
LIQEMRKRKIILPAVYAIEHLAWSVRERARKRIFKYLTKGLSSYQYEQLDTLLYTHEE
KKSSLLSWLRQPPGVIALKKFHEILDRLEFIQSLDLPLDNGKEIHQNRLIQMAREGSR
YSIQHLSRFNERKRYATIMAFLIHIYAFLTDQGLDMFAKLMGRMFNRGENKHNKLFQK
DGKSINEKVRLYVEIGKALIEAKELETDPFEAVQSIISWEKFIHSVHEAESLARPIEF
DYLDLLDNHYGHFRKMAPRLLNRYVFKASSTSQTVLQALELLKEANQSGKRKIPDNVP
TDFIKSKWMKYVYQDDKINRHYYEFSVFSELLNTLRSGDMWGKRQQAI"
gene 136497..137078
/locus_tag="BACI_pCIXO101450"
CDS 136497..137078
/locus_tag="BACI_pCIXO101450"
/codon_start=1
/transl_table=11
/product="resolvase x"
/protein_id="ADK08180.1"
/translation="MIYGYARVSAQDQNLDTQIEQLLKYGVDKIVKEKISGVSQEKIE
LDDLLSQLLKGDTLVVTRMDRLGRNTIQLLQFVEHLREKGVHFAVLNLGIDTRTPTGK
FFLTVMSAFSELDREMIKEKQIAGIKLAKQKGVYRGRIKKYTEQHAGMNHAIELRQQT
KKTIKEICAITDVSQAALYRKLRELKKDEKTIL"
gene 137494..138486
/locus_tag="BACI_pCIXO101460"
CDS 137494..138486
/locus_tag="BACI_pCIXO101460"
/codon_start=1
/transl_table=11
/product="spore germination protein xb"
/protein_id="ADK08181.1"
/translation="MLLDHSGRDSWISIIILSLVYIIWIPCVFIVHKYTREEHLFSWL
MRNYGGFITYPLLSIIVLYLIILGTVTLKETLTFFSFYLPETPRILLGVLLSIICFYN
IQRGVQSIALTTGILLPVVFLLGFFVMIANFPHKDYSLLKPIMEHGMDPVIKGMIYPA
AGFVELIFILFLQHHIGSKIKLSQLIIVGIILAGITLGPTIAAIVEFGPFVAANQRYP
AFEEWRLVSIGKYIEHLDFLSVYQWLVGVFIRISLVIFLIPDVLQVTKQKARNQIISI
LLICMVIICILPISDASFYWFLSHVFLPISAIGLFLFSMLLLVFVWVSKNKKRA"
gene 138530..140008
/locus_tag="BACI_pCIXO101470"
CDS 138530..140008
/locus_tag="BACI_pCIXO101470"
/codon_start=1
/transl_table=11
/product="spore germination protein xa"
/protein_id="ADK08182.1"
/translation="MKRTVEVNESILRVWFEGCKDVKIMNRKWCADTTTTTILLVYCQ
HVIDHTKLKQAIAPEMCNDLLQSSFKDSNLLASNSQFSVTTLELENSNENVSRMLFEG
KLLIIFQEYKRGYTIDIAKLPTRSIEQSNTEMTIRGSRDGFVEELSTNIGLIRKRLKT
SSLSYDEFIIGERTQTKVGLLYLKDVASQETISQVQFKLKEINIDGVVSSAQIEEFIT
GDQFSLFPLIEYTGRPDYAVNCLLHGRFILLVDGSPTATIAPVSFPFFVNTAEDQNYF
YLFGSFVRLLSLFGIAISIFLPGFWVALVTYHPDQIPYTLLATLSLSREGIPFPAPLE
GMIMITLFELLRQAGLRIPAAFGQTLSVVGGLIIGQAAISSGFVSPSMVVMIAISVVS
TFTLVNQSFTGTLSILRYGVFLMSSFLGIVGFICSILLIVIHVANLRSFGLPFLAPYS
PPVFSSMLPSTFRIPFTRMKKRPKELHTYDNTRQRTNNDENK"
gene 139992..140948
/locus_tag="BACI_pCIXO101480"
CDS 139992..140948
/locus_tag="BACI_pCIXO101480"
/codon_start=1
/transl_table=11
/product="spore germination protein xc"
/protein_id="ADK08183.1"
/translation="MMKINRKGGLFLLMFLFLLTGCWDRRELEHVLFINTLGIDFKDN
HYIIYPQFINFTNMAKQEGPANRNYSPAYIGKGEGKLLYDAAFDFYKSSQQKVSWEHI
KSIVVTERFLKNGNLNQLNDFLSRFFQFRNTMWVFGTKEPLENILATNNIFNISSLYT
IMNLPQETIRQSASVDPLRLYTFRSNYYEPGMTTRIPFLATTTEHWKQGHKAFWMLEF
NGYGCIAAKSYVNHLNDSDIAGVRWTNKNTNRAPLLLKVKNRAIGELILKKPKIDTKV
SIEKGKPHIVMNISLEGDIYQLMKPMPVHKVKKTLRISLKKK"
gene 140951..141163
/gene="bclA"
/locus_tag="BACI_pCIXO102040"
CDS 140951..141163
/gene="bclA"
/locus_tag="BACI_pCIXO102040"
/codon_start=1
/transl_table=11
/product="protein BclA"
/protein_id="ADK08239.1"
/translation="MTYQKGLEKGIDVYQLSHLLYRDQLTLWKKYQKKGMIPLQNNTL
DLNVSINISTNGKSKVTPIKNVEAQG"
gene complement(141558..141683)
/locus_tag="BACI_pCIXO101490"
CDS complement(141558..141683)
/locus_tag="BACI_pCIXO101490"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08184.1"
/translation="MEQIHGFYSPRWQMEIIILWKTHRASAVFFAPEPQFLLYYT"
gene 141691..141840
/locus_tag="BACI_pCIXO101500"
CDS 141691..141840
/locus_tag="BACI_pCIXO101500"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08185.1"
/translation="MPSTVVNLETIIKSINEDDILTRLKQEHLLEEKYPIKRIRAIKG
EIQPS"
gene 142646..143260
/locus_tag="BACI_pCIXO101510"
CDS 142646..143260
/locus_tag="BACI_pCIXO101510"
/codon_start=1
/transl_table=11
/product="protective antigen-related protein"
/protein_id="ADK08186.1"
/translation="MNILVRDPYHYDNNGNIVGVDDSYLKNAYKQILNWSSDGVSLNL
DEDVNQALSGYMLQIKKPSNHLTNSPVTITLAGKDSGVGELYRVLSDGTGFLDFNKFD
ENWRSLVDPGDDVYVYAVTKEDFNAVTRDENGNIANKLKNTLVLSGKIKEINIKTTNI
NIFVVFMFIIYLLFYIISSTVFAKSCNCILIYVEVSQLMNSVFY"
gene 143617..143760
/locus_tag="BACI_pCIXO101520"
CDS 143617..143760
/locus_tag="BACI_pCIXO101520"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08187.1"
/translation="MGYKTKRKHVSRYNNYGSLAFCKTALIVGFMTIKVSIQHTQSIE
GYL"
gene 144034..146328
/gene="pagA"
/locus_tag="BACI_pCIXO101530"
CDS 144034..146328
/gene="pagA"
/locus_tag="BACI_pCIXO101530"
/codon_start=1
/transl_table=11
/product="protective antigen"
/protein_id="ADK08188.1"
/translation="MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESS
SQGLLGYYFSDLNFQAPMVVTPSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKK
SDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLD
FKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEV
EGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV
SPEARHPLVAAYPSVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHG
NAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNAN
IRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIAL
NAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSE
VLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPN
GNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNVTNIYTVLDKIKLNAKMNILIRDKR
FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK
EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPS
ENGDTSTNGIKKILIFSKKGYEIG"
gene 146828..146932
/locus_tag="BACI_pCIXO101540"
CDS 146828..146932
/locus_tag="BACI_pCIXO101540"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08189.1"
/translation="MIEIDKDHKSVANILKEKATAKNILLLEKIKVVI"
gene 147251..147550
/gene="pagR"
/locus_tag="BACI_pCIXO101550"
CDS 147251..147550
/gene="pagR"
/locus_tag="BACI_pCIXO101550"
/codon_start=1
/transl_table=11
/product="transcriptional repressor"
/protein_id="ADK08190.1"
/translation="MTVFVDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKHKALNV
TQIIQILKLPQSTVSQHLCKMRGKVLKGNRQGLEIYYSINNPKVEGIIKLLNPIQ"
gene complement(147959..148249)
/locus_tag="BACI_pCIXO101560"
CDS complement(147959..148249)
/locus_tag="BACI_pCIXO101560"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08191.1"
/translation="MLCNITIYKTCSSIALYNSKTSDGTFLRSFSISSFFTSTLTTCS
MIFFKYSSRVFFVSHLLFYFSIPFYMHSFIIMNTGSMHKGYKDGPLLYKKRL"
gene 148672..148902
/locus_tag="BACI_pCIXO101570"
CDS 148672..148902
/locus_tag="BACI_pCIXO101570"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08192.1"
/translation="MNGKNIVKWSAPPEDEDRQNGSILSYHPHEETEWFESYLTKDGI
KLEISNFLSVTVERLFQMWWASAKLTTRNSGL"
gene 148926..149192
/locus_tag="BACI_pCIXO101580"
CDS 148926..149192
/locus_tag="BACI_pCIXO101580"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08193.1"
/translation="MYGKEIIQKLKDRIEKYPLELSKRMIEENLLLSNCWNNREVLLK
RKDWLILYDVIGEVEKNIFCVLFGFNEMYVHHLAFKWTLLILNK"
gene complement(149272..149478)
/locus_tag="BACI_pCIXO101590"
CDS complement(149272..149478)
/locus_tag="BACI_pCIXO101590"
/codon_start=1
/transl_table=11
/product="ribonuclease domain protein"
/protein_id="ADK08194.1"
/translation="MIFYVFVRYEGKNNDPDLELNDNVINNLMPFIGILVKVPKRSCC
KAFKEHIILSSGCIFCVIFNKFCN"
gene complement(149611..152040)
/gene="lef"
/locus_tag="BACI_pCIXO101600"
CDS complement(149611..152040)
/gene="lef"
/locus_tag="BACI_pCIXO101600"
/codon_start=1
/transl_table=11
/product="lethal factor"
/protein_id="ADK08195.1"
/translation="MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHV
KEKEKNKDENKRKDEERNKTQKEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSD
VLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEP
VLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDG
QDLLFTNQLKEHPTDFSVEFLEQNSNEIQEVFAKAFAYYIEPQHRDVLQLYAPEAFNY
MDKFNEQEINLSLEELKDQRMMARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIE
PKKDDIIHSLSQEETELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNK
IQVDSSNPLSEKEEEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQ
NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNF
KYSISSNYMIVDINERPALDNERLKWRIQLSPDTQAGYLENGKLILQRNIGLEIKDVQ
IIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRY
ASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDKI
YEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDL
VTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQF
INDQIKFIINS"
gene 152599..152979
/locus_tag="BACI_pCIXO101610"
CDS 152599..152979
/locus_tag="BACI_pCIXO101610"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08196.1"
/translation="MEKLIIIFRLLYRIKGILFFYFRVFIFYNGKKRAMNIIDIAYNF
LIIRASLHIQFVFMYNKNKEILSDSESKPLSNQKLVNLRIDFAFKQLFGTSRREDILL
TLLNAMLADSLKSSIRRSAFASRI"
gene 152981..153124
/locus_tag="BACI_pCIXO101620"
CDS 152981..153124
/locus_tag="BACI_pCIXO101620"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08197.1"
/translation="MDKLSILDVSATLDTGTKINIETQLNNNQDLLKCTLYHWSKLYA
SPF"
gene 153108..153332
/locus_tag="BACI_pCIXO101630"
CDS 153108..153332
/locus_tag="BACI_pCIXO101630"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08198.1"
/translation="MHLHFKKGMPYSSLHKTITINLLNFVIFKDYETFHTTGQLWNVQ
QQQFLSDDIEIHVIEIPQLMQQWRGDKVNP"
gene 153711..153914
/gene="repX1"
/locus_tag="BACI_pCIXO102070"
CDS 153711..153914
/gene="repX1"
/locus_tag="BACI_pCIXO102070"
/codon_start=1
/transl_table=11
/product="plasmid replication protein RepX1"
/protein_id="ADK08242.1"
/translation="MWVILIIYFIYFIILDTSFPGCLLLSIITGVILWSIGLIHLKLF
YELREKQKIMNIATINEMKKINI"
gene 154088..154270
/locus_tag="BACI_pCIXO101640"
CDS 154088..154270
/locus_tag="BACI_pCIXO101640"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08199.1"
/translation="MVERYINHRDTGKQIGEIRKQYLLSDSTVLTLDKAINLVDTIVV
LHTYNAIVLLKGLRRT"
gene 154267..154470
/locus_tag="BACI_pCIXO101650"
CDS 154267..154470
/locus_tag="BACI_pCIXO101650"
/codon_start=1
/transl_table=11
/product="transition state regulator, putative"
/protein_id="ADK08200.1"
/translation="MRNCRKNPIEIFVEDEKIILQKSKSYDACTITADISEKIIPLAN
RQIVLSSDGIELLIKEIQQHLVK"
gene complement(154971..155153)
/gene="trsE"
/locus_tag="BACI_pCIXO102090"
CDS complement(154971..155153)
/gene="trsE"
/locus_tag="BACI_pCIXO102090"
/codon_start=1
/transl_table=11
/product="conjugative transfer TrsE-like protein, ATPase"
/protein_id="ADK08244.1"
/translation="MCISDLHNISIDELFGRDSTLERKLECIKVALADLSDEKQQEVL
VVLIDYTYFIKKHFIK"
gene complement(155184..155297)
/locus_tag="BACI_pCIXO101660"
CDS complement(155184..155297)
/locus_tag="BACI_pCIXO101660"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08201.1"
/translation="MSHLSKRLAELRKKQGYTQSDISHRLNIARTNYAIWE"
gene 155418..155513
/locus_tag="BACI_pCIXO101670"
CDS 155418..155513
/locus_tag="BACI_pCIXO101670"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08202.1"
/translation="MVKEKDLKFYEQKNRKKPMHQIENLPIIYVY"
gene complement(155510..156553)
/locus_tag="BACI_pCIXO101680"
CDS complement(155510..156553)
/locus_tag="BACI_pCIXO101680"
/codon_start=1
/transl_table=11
/product="integrase/recombinase, putative"
/protein_id="ADK08203.1"
/translation="MNIINYEHNNQLVKSKSDFFDSSHFEKIMGMGIRNIDYSQLSEG
SLVYLFLHDEPSLTKKRSERTKKLYLHDLSHFLRYIKETIGIIKELSHNEMEIYFYQL
SKKYAATTLRRKKTVVQQFLKYVYDNNGLSDNFSSRLKKVSVKKEELVNRDLFPEEVN
EILDTLKKTNFFMYSLFFLLTTTGLRIEEVANAKWADLVFHPSLNVYLLRVVGKGNKT
REVRIFEDVLNDLCHLRQLRKQKSELDASSSSAFLPKADGSHYRADYLSKYVAEKIEE
TNLPFLRYRKHRITPHTCRHFFANHLMGKGVELKKIRDYLGHESIMTTERYLRERTRR
QNLATIDIGNSLF"
gene 156782..157132
/locus_tag="BACI_pCIXO101690"
CDS 156782..157132
/locus_tag="BACI_pCIXO101690"
/codon_start=1
/transl_table=11
/product="transposase for transposon Tn554"
/protein_id="ADK08204.1"
/translation="MTSLRLKILQEIHNLEDTHCSICPLNNLSVNCTDEQEQAKQRNY
KHCKGCPIFDSIREKGEQLNSLSKKSTFNKVRERYMENPFKYLQYKEYSITDVVKETG
LTKYQLRKFKQQLE"
gene 157154..157666
/gene="orfX"
/locus_tag="BACI_pCIXO102060"
CDS 157154..157666
/gene="orfX"
/locus_tag="BACI_pCIXO102060"
/codon_start=1
/transl_table=11
/product="protein OrfX"
/protein_id="ADK08241.1"
/translation="MDYLSLEEVCDRVGLTKNQLGYLIKYKHIKPINLATWKADGGYR
FEQEDVEKLEELYKDSLTLKEAAEFLNKSKTYVHNAAKDGILPFKEITKGKSTERLYL
KKDLEIFKERIENRSKEESKDKKQHLSLYLDEKVLEAIKKKAEKKGYNGYKKFAEDIL
SAEVKEDIEE"
gene complement(157912..158094)
/locus_tag="BACI_pCIXO101700"
CDS complement(157912..158094)
/locus_tag="BACI_pCIXO101700"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08205.1"
/translation="MSKSKIKKIVGALSLTSALLISAMPASAGSGLIWVRDKYPNAYE
FDYNGAKGTVKIFYLE"
gene 158871..159059
/locus_tag="BACI_pCIXO101710"
CDS 158871..159059
/locus_tag="BACI_pCIXO101710"
/codon_start=1
/transl_table=11
/product="putative transmembrane protein"
/protein_id="ADK08206.1"
/translation="MMSELVQFVMINLKNSGSEFDFESYTKKLLENIKKDLRPNDLNF
LSSNTKTTKCAIMIDDIN"
gene 159348..159590
/locus_tag="BACI_pCIXO101720"
CDS 159348..159590
/locus_tag="BACI_pCIXO101720"
/codon_start=1
/transl_table=11
/product="putative transmembrane protein"
/protein_id="ADK08207.1"
/translation="MPTKLVQGYKDRDEQFKKRSHNFKNIHTSLMSIDTKDLISILTF
KTHKVKEVNLFASPNTDNPDIQKFQYIMSDLLNGQN"
gene 159857..160390
/locus_tag="BACI_pCIXO101730"
CDS 159857..160390
/locus_tag="BACI_pCIXO101730"
/codon_start=1
/transl_table=11
/product="putative transmembrane protein"
/protein_id="ADK08208.1"
/translation="MEQYLEKLEEQEVMQMMGDYEAELHYRRRMREEAAIDSSECGVS
TVNLILFYNNTPQITSKITFTNGSSYFDDDQGTYMPDNESELDIDGLEEIETEICYLI
ANFMPEIEEDDIASFPCEQCNKYNINLSEDNGFEIGTCLYCEHPNHVGKCMKCGKILN
SPTDKVCDECWEEIKED"
gene 160523..161743
/locus_tag="BACI_pCIXO101740"
CDS 160523..161743
/locus_tag="BACI_pCIXO101740"
/codon_start=1
/transl_table=11
/product="Isoflavone reductase"
/protein_id="ADK08209.1"
/translation="MSTQIKVTPEQLEQAAKTVKNTRSSLEYIHQDLYSQTEYIASQW
SGASSDRFYQMFNEAKPMMFNILQELDKIAVELERAAVKFREADELYGGNLVDSDIQE
GAMCGKIPPKSEESFFNNKDLNAAWTGISTGFVDGAVDAWEVGDKETWLNMRDAIVNY
EETIPAALNALSDSFVNNLWHGDMESREHYAAYGIATLGLGLLGDKGLSKAGQVGKGA
AITGFTKGKSLVTNSPAYRNALHILNNYEFKAGNHLSYAGVGSIQKYLQKAAPYTYEG
PNGPKTIRLRLGELAGDKHPVTGIRYDLDGFPIFKALSEVKLKEADFKKSRPTHDRIC
SKALYEQIMKDPKLAAKFTEEEIELFKLGEVPENYTWHHHQEAGRMQLVDYETHRKTG
HTGGYKIWGKDSDK"
gene 161756..162205
/locus_tag="BACI_pCIXO101750"
CDS 161756..162205
/locus_tag="BACI_pCIXO101750"
/EC_number="2.4.-.-"
/codon_start=1
/transl_table=11
/product="glycosyltransferase involved in cell wall
biogenesis"
/protein_id="ADK08210.1"
/translation="MSNVTWIGVNKKEITDENIQKVEHYFNIKFPMDFVECVKKYDSG
YPRPKIFDVPGQDENVFSKLLTFDLENRNSIIQVYDDIKDRLANKVYPFGKDSFGNHL
CFDYRSNPESPTVVFWDHEEENIEEAIHPVCSTFTELLASLRDFEED"
gene complement(162327..163187)
/locus_tag="BACI_pCIXO101760"
CDS complement(162327..163187)
/locus_tag="BACI_pCIXO101760"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08211.1"
/translation="MVKEVVVEVVELMKDEYSIKEICILIGIPRSTYYRWKNKVKDVK
EAKLEQAILTICMTNHFRYGHRKVTALLKRKYNYHLNRKTVQKIMQKKNLQCRVKRKR
RTWINGESRIVVENLLNRNFQANKPNEKWVTDITYLPFGTEMLYLLSIMDLYNNEIIA
YEISNRQDVTLVLRTVEKAIKLQQKTQIILHSDQGAVYTSYAFQTLSKKNGITTSMSR
KGNCHDNAVIESFHSSLKSELFYSQEKQIHSTSTLKQLIHDYIEYYNTERIQEKLNYL
SPIEYKKQVA"
gene complement(163172..163492)
/locus_tag="BACI_pCIXO101770"
CDS complement(163172..163492)
/locus_tag="BACI_pCIXO101770"
/codon_start=1
/transl_table=11
/product="is1627s1-related, transposase"
/protein_id="ADK08212.1"
/translation="MGTRKSYSEEIKWKAIELKKQGYTNKEIMEQLGIKNKAQIKTWM
KWHREGETYRFSRPVGKQSTLQKASEEGITEIEKLQIENRKLKMQLDILKKYQEIERS
WLKK"
gene 163600..163905
/locus_tag="BACI_pCIXO101780"
CDS 163600..163905
/locus_tag="BACI_pCIXO101780"
/codon_start=1
/transl_table=11
/product="is1627s1-related, transposase"
/protein_id="ADK08213.1"
/translation="MKTRVHYPEETKWKVIEMKKESYSNRTIMEKLGIKNVSQIKTWM
KWYRTDQTYRFQQPVGKQYSYGKGPKELSELEQLRLENKHLKTKLLVWGKYLEIERG"
gene 163965..164513
/locus_tag="BACI_pCIXO101790"
CDS 163965..164513
/locus_tag="BACI_pCIXO101790"
/codon_start=1
/transl_table=11
/product="conserved hypothetical protein"
/protein_id="ADK08214.1"
/translation="MCNVLELPRSTFYRWLQRTEDLKDDIEEKVKDVCLRHKFRYGYR
RVTATLRKMGLCVNHKKVLRIMRQNHILSKVRRKKKKYINGAESMVAPHRLERQFDAS
RPNEKWFTDVTYLLFGERTLYLSTIMDAFNREIISCVISESQTLTLAMKTLKQAMRGR
KVKDVLLHSDQGSIYTAKEFQA"
gene 164577..164756
/locus_tag="BACI_pCIXO101800"
CDS 164577..164756
/locus_tag="BACI_pCIXO101800"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08215.1"
/translation="MESFFGHLKSEAFYSQKITKVSNTTVRKIVLEYIHYYNCVRIQE
KSNHLSPKEFREQVV"
gene 164819..164938
/locus_tag="BACI_pCIXO101810"
CDS 164819..164938
/locus_tag="BACI_pCIXO101810"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08216.1"
/translation="MNLLIQDELYLCFKELQRYLSSHILQQLAQETGFVKRKS"
gene 164954..165169
/locus_tag="BACI_pCIXO101820"
CDS 164954..165169
/locus_tag="BACI_pCIXO101820"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08217.1"
/translation="MTVLCIWISQQVASDSITRLCSHLCANTAILMISEGLNQRFNRC
AVLFLQRVFRRYTTKAIHLSKRTHFHV"
gene 165591..166304
/locus_tag="BACI_pCIXO101830"
CDS 165591..166304
/locus_tag="BACI_pCIXO101830"
/codon_start=1
/transl_table=11
/product="zinc-binding lipoprotein adca domain protein"
/protein_id="ADK08218.1"
/translation="MKIAFTKMVGILTISSMLVLVGCQTSGSSKKQEQTSESHTHENE
HDHSHDHSHAHDESTEKIYEGYFEDNQVKDRSLSDWKGDWQSVYPYLQDGTLDEVFAY
KAKHKGKMSAKEYKEYYNEGYQTDVNRIVIQGDTVTFYKNKEEYSGKYIYDGYKILTY
DAGNRGVRYIFKLAEKTEGVPQYIQFSDHGIYPNKANHYHLYWGDNREALFDEVIHWP
TYYPSDMNGHDIAHEMMAH"
gene 166571..166663
/locus_tag="BACI_pCIXO101840"
CDS 166571..166663
/locus_tag="BACI_pCIXO101840"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08219.1"
/translation="MKSTELKAEEIRLITNINKKIKQVVNHLYV"
gene 166929..167978
/locus_tag="BACI_pCIXO101850"
CDS 166929..167978
/locus_tag="BACI_pCIXO101850"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08220.1"
/translation="MQLNQQEFFETYNIDTQEFETAEISWNSLLEIHSDYLSYKETLI
PTAEHLSMMLRTHPASHTVRSRVKDAGHLIDKIIRKTIREKEKNPDYYIDVNNYKSEI
TDLIGIRVLHLYKDQAAPIDKFIRDTWDLREKCTIYYRQGDYSKQEEPKNNDLFNFKV
HPFGYRSWHYLISSQATKNVHIAEIQVRTIFEEGWSEIDHQLRYPNNMNDVQLTKQLL
VLNRVAGSADEMATVIRELVAENNIKQKSIDELKTQLDTLMKENNIEKAVKEKFQKKV
EELQDQLALKLPNNRWFNTPIYLGEGPTPASSPLLKAGEQFVIDFKADEPYDIKRYLS
GYTHPALIKKADPQK"
gene 168222..169307
/locus_tag="BACI_pCIXO101860"
CDS 168222..169307
/locus_tag="BACI_pCIXO101860"
/codon_start=1
/transl_table=11
/product="tyrosine recombinase"
/protein_id="ADK08221.1"
/translation="MSNQEKEKFKILIDKHKSKMPWYIIEYAEMKTALSPATLYAYIT
EFEKFLKWLISNRLAVENGKVVTNICDVPISTLENLPLNEARTFQRYLQGEGIETRAI
NRTFSALKSLFKYLAQNTENEQGENYISRNVMDKIELHKEKVDAAARADDVANMIFNE
KDDVAFLQFLANDYGEMLKDISPKKYSFFQRDKERDIAIISLILGTGLRVSEVASLTI
SSINFRQGKVKVTRKGNKRSSVLATRSCLDDVQEYIKVRPSKYNCPQDEDLLFVTNYK
GKYTQLTVRAIQKLCDKYSSAFDEKRSPHKLRHTYATNHYKENKDLVLLRDQLGHTSV
EVTSIYTNINNEKKREAVDRLERRQFE"
gene complement(169530..170987)
/locus_tag="BACI_pCIXO101870"
CDS complement(169530..170987)
/locus_tag="BACI_pCIXO101870"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08222.1"
/translation="MKKPIDLNSLVSSYKNLPEEAFEGIKKFFNFTISNAEIEQISAF
IDNLIVEDRFFGYFYVGYKIPQIDKEFDLLRFGENYILNVEIKSIMQGDAAREQLVKN
KYYLSLLGKKLKLFTYISEDDSLYQLADDETLQPVDFGVFEKLLVSQKIEHHSNLDTL
FNPSYYLVSPFNDMEKFNKGVYFLTKQQQEFKDKILKNLSQFTIIEGLPGTGKTLLLY
DLAKGFNKTNDIVIVHTGDLNTGHLKLNQQYKWNIIPVKNVKQIQQLNPQFIFVDETQ
RMYPNQLAFIIKYIKENNIIGIFSIDPKQILSIRERNYNNLNTLCSLNNYQHFKLSKK
IRTNKELGAFIKGLFNLEHMKYCRNTKNISIHYFDEISQARGFAEGMENEGWQIIDYT
GQNFNGEAIRRMQLNRGLNAHGVLGQEFDKVLVLVGSTFYYDNQNSIAVRKANYYDPE
RMFYQSVTRARKQIMLLVVNNVEFMTKIINSLNNK"
gene complement(171129..171506)
/locus_tag="BACI_pCIXO101880"
CDS complement(171129..171506)
/locus_tag="BACI_pCIXO101880"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08223.1"
/translation="MKHSIGNVSTSYIIRLILNDLDTFITAGKREFNFCSESGLSFVE
ELLADWLEWFNDYPQGISPGELKEIKREIGELMGSMSIWSHHTEEREGFIKQFRDYFG
GYIGFCKLVRDVYIEELKDDLLY"
gene complement(171503..171820)
/locus_tag="BACI_pCIXO101890"
CDS complement(171503..171820)
/locus_tag="BACI_pCIXO101890"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08224.1"
/translation="MKNHTRNSKGQLLQTNKKWSHLKQKQRETISNWLREAYIEKIKV
HNRRLKPREHEDVLESVMSKIYDREIWIPDYELEKYYKGKINKWYNKRISLEEKNDRE
ENI"
gene complement(171851..172300)
/locus_tag="BACI_pCIXO101900"
CDS complement(171851..172300)
/locus_tag="BACI_pCIXO101900"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08225.1"
/translation="MKAERIFEGTSADGIWNKAIFKVKEGSYYYISENSTIEITDNEY
LNVEVLEEVHQGEDHNLFAVKGDERDMLQQLEMDGFNFEDVDWGDLNLLDNEIMSSTD
AIEEWGIESSTLRKRIKDFPKGSIRKIGTTYAVTRFGMRCVFGSNRK"
gene 172539..173633
/locus_tag="BACI_pCIXO101910"
CDS 172539..173633
/locus_tag="BACI_pCIXO101910"
/codon_start=1
/transl_table=11
/product="response regulator, putative"
/protein_id="ADK08226.1"
/translation="MIVSVKGNEQITKMLNDWYIEIRARHVGKAHNLKLEIDQKIHNI
EEDQNLLLYYALLDFRHQYMLDSLSIGKDSFDKVDSLGVPADQFLQYYYHFFKAIHSN
ITGDFTSAKEHYNQAELLLKHIPDEIEHAEFRFKLSTFHYHIYKPLAAIKEATKAKDI
FKKHAGYETNIGLCDNLIGLACTHLKQFEEAEEHFITAINTFKKSGKEKNITFVRHNL
GLMYSGQNLSELAIRYLSEVTQELPKDYKAIFIKAREHMKIGESKETYNLIVKGLEIC
KELKNEEYEHHFLILEKLNQKVSADELEKTIKTGISYFKRENLHEYVQEYAKKLAVLF
HQENNRSKASDYFYLSHQAEEQNFEKEALK"
gene 173963..174148
/locus_tag="BACI_pCIXO101920"
CDS 173963..174148
/locus_tag="BACI_pCIXO101920"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08227.1"
/translation="MHTQEDFYNKLIEEQRLVTIFLINGVRVPGIIIAVDKFSVLVSS
HGKQQFIYKHAISTVSL"
gene complement(174454..174747)
/locus_tag="BACI_pCIXO101930"
CDS complement(174454..174747)
/locus_tag="BACI_pCIXO101930"
/codon_start=1
/transl_table=11
/product="transcriptional regulator, arsr family"
/protein_id="ADK08228.1"
/translation="MTTIQAGNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNV
TQLTELLDIPQSTVSQHLSKMRGKILRSERKGLEMYYHIANSKACQIVSVLGL"
gene complement(174835..175257)
/locus_tag="BACI_pCIXO101940"
CDS complement(174835..175257)
/locus_tag="BACI_pCIXO101940"
/codon_start=1
/transl_table=11
/product="disulfide bond formation protein"
/protein_id="ADK08229.1"
/translation="MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMA
MYPLVLILGIGMYRKDSNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCT
ENYLNLFGFISIPMLSFVGFLAIIILLYINQIKRQKNK"
gene complement(175301..175591)
/locus_tag="BACI_pCIXO101950"
CDS complement(175301..175591)
/locus_tag="BACI_pCIXO101950"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08230.1"
/translation="MLSQVPGFLKFVLAKERRYVYLAVAEKKNKRILTHIVYRFGPLE
KALEAMYEMRDDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY"
gene complement(175665..175865)
/locus_tag="BACI_pCIXO101960"
CDS complement(175665..175865)
/locus_tag="BACI_pCIXO101960"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08231.1"
/translation="MDENKRNMLLSFIISILFIFTSLLPFSNNEYVYVISKIGAAAGV
INIVMMSVFLYFQSKKTGHLLN"
gene complement(175917..176561)
/locus_tag="BACI_pCIXO101970"
CDS complement(175917..176561)
/locus_tag="BACI_pCIXO101970"
/codon_start=1
/transl_table=11
/product="thermonuclease family protein"
/protein_id="ADK08232.1"
/translation="MKIWIKAICITSFVIQMSACSSSAQTKNDSRPAQAVQNGIQQHV
EGKDIVDIPEAYKRKLKGLETVKGKVLHIKDGDTIDVNVKGQKQTVRLLLLDTPESVS
QKIPPQKMGKEASFFLKKQLDGKSVTLVYDQGPKEDKYGRKLAYVFCNGIHINELMAK
SGYGIIAYIFKPNTTLLPEMLEAEKEAKEAKAGVWSIKGFVDEKNRHYNRNDAA"
gene complement(176606..176815)
/locus_tag="BACI_pCIXO101980"
CDS complement(176606..176815)
/locus_tag="BACI_pCIXO101980"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08233.1"
/translation="MCTSNIASANVSFEKLKSQEENEKSMASICPNCKKHSFKELYND
YPKWIQFCLCCNYREVNTLESPFVY"
gene complement(176990..179602)
/locus_tag="BACI_pCIXO101990"
CDS complement(176990..179602)
/locus_tag="BACI_pCIXO101990"
/EC_number="5.99.1.2"
/codon_start=1
/transl_table=11
/product="DNA topoisomerase 1"
/protein_id="ADK08234.1"
/translation="MKSPRFRHSQKYIGSKPYYGYYENDHYIVSWCRGHLLELKNPEE
MDPKYKLFQLEHLPLIFQPSYKVIQENAEQLQILVKLLQRPDVDHAVNICDADREGEL
IYREVYEYAGVNKKQSRVYKSSFEAAELEAALNRLESASKYDGLAYSAKARQYLDYLL
GMNITRGCTTKLAQNKFLLSSGRVQMCLLHEIRQRELAIENYREQSYYHLQLITDLGL
KPVMKTEDQVLNPSPLKSLGENLKDQYLTVEEFKEGTRKQNPKLLYNLTDLYKDAHAQ
LQINAETAKKHIQNLYEEGFITYPRSSSRHLPTEQVDRVKGVMQALAKSRYSLLVQSV
DIDAIDIKHKTFDDDLVSSHFAIIPTTKQYQEEGRPEIEKQLYSLVVKRFVGNFMRPA
VYLVRDVSLIDAMGNTYQIKESVLREKGFLEVFQEEVEEESVETFKVPILQKGQELQI
YDFELQESKTKKPALHTESSILTFMETAGRKIDDEHLKELMKGKRIGTVATEAAFIPV
LHEKNFIDIEKGKIITTPIGRAFIEQFPVQQIKDPLYTAEMEGMIHRIEKNEMSYENF
IAQTNAFVQKITQEIIRIPDTVSYNLIETWKKQIEVCQCPCGNGIILDRGKFFGCSNH
PNCNKGLPKRVKEKAIPTAQVKKLFEENKTDIIKGFKSNGKEFSAYLAFVNGEVSFNL
PSVEELSLGQCPKCQKGKILNRKTFFGCSEYQNGCDFMLPAKIKGKKLSDSQIKKLVN
NHVTDFINGFSGEKGEFTAAIRLKTDLSICFEFPTTDDRTVGKCPLCQSRVIIGKTNY
LCEQYKRGCDFIVSGMILEKRITASQIKKLLEKNMTDTVKGFVSKKTGKSFDAKLTYD
STQKRVTFIYEKKK"
gene complement(179599..179724)
/locus_tag="BACI_pCIXO102000"
CDS complement(179599..179724)
/locus_tag="BACI_pCIXO102000"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08235.1"
/translation="MQKDTPTHNHSVGVSFFCLRRKKLWGKRYLLQKNQKWPMKL"
gene complement(179772..179876)
/locus_tag="BACI_pCIXO102010"
CDS complement(179772..179876)
/locus_tag="BACI_pCIXO102010"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08236.1"
/translation="MKLGKRLAHRKIMAKFKQTNRYLEVSLNNDCICI"
gene complement(180220..180624)
/locus_tag="BACI_pCIXO102020"
CDS complement(180220..180624)
/locus_tag="BACI_pCIXO102020"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08237.1"
/translation="MQQCLKYNCGTIQLEDLQGISKEQAFLKNWTYFDLQEKIKNQAN
QYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYN
IEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN"
gene complement(180765..181571)
/locus_tag="BACI_pCIXO102030"
CDS complement(180765..181571)
/locus_tag="BACI_pCIXO102030"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="ADK08238.1"
/translation="MSIAVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQK
LWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQK
TIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIK
ENNLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGACMLHKHKKKWYLSITYKSNIK
EELKFDEDLIMGIDMGKINVLYFAFNKGLVREAISGEEIEAFRKKLSIDV"
ORIGIN
1 tatttcttat tggtactttg ctattatttg gtttagcagc ctgtgatagc atcaaatcgg
61 tggctagcga tgttacagta ggaaaagtaa ttgaagaatt taaggctgca ggacttgaag
121 cagaacagcc tagtgatcta ccggaaaaag aatttgggaa tactagaaaa gatgcgaaac
181 gcattcttgt accagcacta ggagaagata gtggtggtag aatatttgag tttaaaaaca
241 aacaagatct tgaacaagcg aaaaagtact atgacgattt aggtaacggt aatcaaatgt
301 tattctctca tacttacgca aaaggtaatt ttcttttaca aatgaatggt gacatggaag
361 atgcccaatt taacaaatat aaagaagtaa tggacaaaat aattaagcaa gttaaggaat
421 ccgctttcat ttttcagata atatgatatg attatatttg gatggtagct cgtatacatc
481 ttattaaatt taaagtggtt atcaagtcga agaaaaggca ctcaaatgag tgtcttttct
541 tatggacaaa gtaatataaa ttatattata aatatatagt aattataagt aaatgaggtg
601 tatatcataa ttaatttcga gccattaagt ccagttatga atgacatagc aatcaagctt
661 gccatggtac tatttatacc gttattccta gcattaattg tcaaagttat acttatgaaa
721 tttatgaaag agtcgattgc tggcagaatt gcaagtctat ctctcttatt tttcatgtac
781 tatgtattta tatttgttac agggtaaaca ggtatcttag ggtgtctgtt ccttttaaaa
841 gttagaatca aagtgatttt ataatttcat tggccacttt tagtttttct gcaataaata
901 atgttttccc cataactttt tcctccttaa acaaaaaagg acacacctat ggcagtggtc
961 tgcgtaggtg tgtccttttg taacataata tcactatatt aatttacatt aattataaca
1021 ctttttattt ctaaaatata ttttttagcc attctttttc atcacaaaat cttttttgtt
1081 tccttttaac ttgtaatact tcatgttaag acgaatagct actatggaga ttactaagaa
1141 ccctagtaca tataacatgt ctgattctcc atttcttatt gtttagcgaa cttattgtgt
1201 aaatacttca catgtttctt ttcaatatcc ttatccataa tattcgctcg taatattgtg
1261 tgatagatat gctggacctc atcatttgtt agttgcacat cagtatatga ttcaatacat
1321 ttttgtagat cgttataata caggacatgt ttctctttag aatgaacatt tactcttttt
1381 agactgcatt ttggatgaaa tgctgccata gagatacacg gcagctgttg ttctattaac
1441 cattcaatgg cttttatatg tttatagttt tggtgaaatg gattttgaaa agaggatttc
1501 tttctaaaaa taccctgtgt ccaccttgcc gctttctcac ttccatagat ccagccctca
1561 tagttcttcg tctccacaac aaatacacct gtttcagcaa taacaatatg gtcaatttgt
1621 gttgtatcac cgtactccgt ataaaccgtc acattatgta atacatagta actttttgga
1681 tctaatttac ttagcatacg tttcaccagt ttctctccgg cttttccttt ccatttcggt
1741 acatgttttt tcacaacact attcaacgga atcagaaccg caatgagaat taattcaaat
1801 atcaacactt ccataataga atcccccttt ttacatcctt gcgtttctgc gcattaaacg
1861 aaatacatgt gtttctaatc ctaaaataaa atatgagata cataagcctt ttatcaccat
1921 ctctacgaat cctaatgcta atgaaacaag gagcccacct cgaaactgaa agggtctggt
1981 tactcttcga ttgactggtt tttcaatgac gccaaagttg gcccaggtag gcaaacgttt
2041 ttccacattt ttcacggtac ccattaatcc gtattttaac gatagaatga aacatccgat
2101 taataaataa acaacagagg aaaaatagat agatagacct attacgatgc atgtcagtaa
2161 ccagcctatt gatatagaat ttcgcaaagc aatatattct cgatttctat tcaatacaaa
2221 cagtcctttc aaaattaata aggttatttt tacttggaaa atatttacat tcacttataa
2281 gcatgatatg atacgactat attaatttac gaactagcct aaaaaggatt gtgatagaca
2341 tgttaaaact tgtagtaaat aataccggaa cagaaccaga aggtgattca gctttttcaa
2401 actatttcac ctgcaaagac tgtgtatatt atctgtcaaa atcagattct tgcagtctac
2461 aattagcagc tgattcaaat aatccccttg tcccttatga gtgtggcaac tttgaggaaa
2521 cctatgaaat cggaacggaa gatccattga attcacacat acaccagcaa cttcgtgaag
2581 aaaaagcgca aatactagct gaaagctacc cagcacaacc ttctattgat ccaattcata
2641 aagacgcaat atggtatggg tcagtaaact atggttgttg gattataaat gattcgaaga
2701 aacgttttgc acttgcagaa caggttcctt tcggtgataa taatatgtca tctaaaaaat
2761 acgcatctcc tttcccttta catgaccatg gtgcaaaaga aggtatccgg cactatatgt
2821 gttggtacgt aaacgaaaaa ggaattggcg aataccatct tcttattggt ggtgtcatca
2881 tgaaaattgc agaaggagtt aagaaacttg gattcaatta ctaatcgtat ctacaagaaa
2941 agaatgttag aacataccat actatttagt ttggtacagc tggtaccact gattgtatct
3001 accggtatca tatatatatt gctagaactt actgatacgg agtggaaaac ctggtttagt
3061 tatgaaggaa tctttgcaat tatttttctt ataacgaggt tccaggtgtt tcagaataag
3121 aaaagtatta tttctttaaa tcaacacgaa aagtggtttt caaagttaaa tattttcttg
3181 gtctctatat ttctagtatt atttgcatcc ataccaactc tattaaagat tgctttcatt
3241 ctacaaatga ctgttattct atttctacta gagtaccttt gtttgtatat tgatcgttta
3301 ccgatacata atttatatag agtaaaagag atcatttgtg ataaaaaaca actcaaaatt
3361 gaacgaatta ttccaaacaa tgaggaacac ggtactcata caattaaaac aagggatgag
3421 caatactttt tatataccgc tgtgtatttg agcggcatac tatcgccaat ttcagaagaa
3481 gtctttgaag aatatgaaag aaacaaccta atgggtagat aaaaggtact gaatgcagat
3541 tcagtacctt ttctatcttt atatacggtt ctttacatat tagcaaatag ccatggagcg
3601 agtacggcta acatacacag caaacaagat cctgttatga cacgattagc ccaacggtaa
3661 tattccggct gtttcgtact ctcatgaatt cttcttaaac gaatacctgc gattaacata
3721 aagggtgtga aaataagtgc tgttgcttta aacaggtcta aaaaatccgt aaagatgttc
3781 ataaatgaaa atacatcgga actaaacaaa aagtatacac ttagtctcat cgacatcatg
3841 ctgataaatg agaaaatcat acttccagtt gcccacttca tccattgacc attctttgta
3901 attaatgcca taaccatgac aataactcct aatacgaatg aaatagaaaa gatattgact
3961 cctactttaa aagccggcgc atacaatcct tcaatctttt gtatgattga tgatccaaat
4021 gaatcatctt tctctgttgt tttcgttcga ttgtttagtc catctttaaa tgatgacgaa
4081 acatcatttc cttttaactt attaaaatct acttttacag aagcttgagc tgcttgtaag
4141 ggtacaagta ataaaatcat caaaacaagc gtgcataaga ctcctatcat tcctttttct
4201 cgtttcatca cacatcaccc gctaattttg gtttgatgct ctttaattta atttcatttc
4261 cttctgctgc ataataaagg tctgctgcat aatagatatt tgcttttgta tatgccccca
4321 taattgcatt tgcaatttct tctttttcta ctgccacata tgtttcattt tcattgtaaa
4381 actcaatttc aattcgatta atattattat ttaatactgt aatatgtaac tcttttaagc
4441 tatctaagcg attgcctaat ccacacacta acttaaatac tttatttgca attgttggtg
4501 gtttgacata tgtcgtatta aaatgaattg tttcatcatc tatcacacca tcttcctcga
4561 cttcacacgt cataatgaaa gaatgatttt gtttttcaat ttcttgttga ctcaacttgc
4621 gatcaatgac atacttcacg cttgttgaca ggttttctat atattcatcc agttcggtat
4681 ttgaaatttt aacctctgag aattcaggaa aaatcatgta agcgtgtata ttagaactac
4741 ttttacttac acgtaatacc tggacttgtt tcttttcata gcgcaccgtt tgttctaatt
4801 tttctactac attgttactt atggaattaa tattcattta cattcacctt tcaaaattgt
4861 tattttttaa actcaaaaat attttttact tcatataatc ctcatgtttg gatttaatct
4921 attttaagca ttgtaatatt acgaagagtt ctcaattccc ctgttttaag actgttaatc
4981 acttgaatct caaaacattt caatattaca atgacgtaca atgtctcatt atagtcgaat
5041 atctttatat ggtgaatcat tctgtcccac tcatttgtac aaaaataaaa aaatatttta
5101 ctcttgtaca aatgagtgga aaaatgctgt atttcatgct ctttaactaa gaaaatacaa
5161 ctaggaaata gaattatata ttccctagtt gtctattact ccattcaact agtgtataag
5221 aataaggtga atcgacctct aatttcatat acagtaattg attttccggt aatatctccc
5281 cctctgtatg aatccaataa cgcttgttat tagacatatt tatgacacgt gttagtcctt
5341 gctcttgttc taatactttt gtagtccacc tcacaaaatc catatcttta acatcagcta
5401 ctctttgttg aacaggaaaa acgggttccg tttccggtgg aattgaaaca tattcttgtt
5461 gtggatacat gtcctcatat tctaataatt ccactggtat atcctcatca cttggaaaat
5521 gaatatcata aacagcctca ggagtgggag tatgatgaaa atcttcagca tactccactt
5581 cttctatgtc ctcatgtttt aacctgtcac tctcgacttc acccagattc ttatgaacag
5641 atgtagcaac taaatcatat atacttgcta catccttttc taaggtgatc tcttttgttg
5701 gaacagtaat acgctcttgt tcccttccga taggtttatt ttctcgtggg caccaataaa
5761 cggggcgttc caacggttta ttttccattt cttttttctt agcttcttct cttagaaatt
5821 ttttctttga attacaaact actataaaca cataacaaaa tagaccaata aaaatttttg
5881 taaacataat attcccctct cgatcatcca aataaatcga actcatactg tccatcgatt
5941 attttatttt tttgttttcc tttcttttta gaaggatcaa cttcaacaat aactgaatcc
6001 cagaatgtga tatcttgttt ttgtacaagc atacgcttat cagtattcag tgttgttaaa
6061 gctcgaatga tatcctctat ctctccatct acttcaagta cattctgctt cactcgaact
6121 ccaggtactt gctctttttt aatacattca acagcttttt gtacaaattg agcctctttc
6181 ataaatgcta cgtccatcgt tcctggtaat ttctccaccc aattcgtaaa ttgaatttca
6241 attgattcaa atacaggtgt aatgacatta ccgatgtttg ctaggacgcg tttcgattca
6301 ccagatgctg cttttgtcca ttcttctgtc gaacccttta attgatttcc actctttatg
6361 ttttgaatta atagagtctg tagatctcca gtatcaccaa gcattgcatt cagaccatcg
6421 cttgtagcct caccgttcat tgcttcagca gctttattct tttgagcaat taattgcgcc
6481 atctgctgtt ggaacgtttc tcggtatcca agatagaagg tcctacattg cttagtttgg
6541 ccaatacgac agtgtcttct tgctgcctga ttcaacgcga ataagctata tggtaattga
6601 taaaatatca atgtaggtgt tgcaagtagt cgggtaagtc agaggtgtta ccaactcttt
6661 ctcccctaag aaccgtactt gtacctttca gcacatacgg ctcaagcctc tctttatcct
6721 taacaatcta gtatttaaac tttttaaatg tatttaacat tgttctaact gcttttttgc
6781 tgttgatagg tatcttttga gattttaaat aagcttgtac tttaggtagc tgttttccgt
6841 tcccgtacca ttctaaaagg gcatgatgct gtttatgaca actacaatga agtaattcaa
6901 gattatcgta ctcatctttt ccacctataa ctttaggaac aatgtgatta ctttcaagtg
6961 gttcctctcc aactaatgaa ttgttgcaaa ctctgcattt atatttagtt tttttcgcta
7021 attttctctt ggaatttgta ttgaacctat tgaatatctt ttcatccctt tttgcgaagt
7081 attttttaag attagcgtca tctggactat tcttgtactt aatcagtaca tgtcttacaa
7141 ttggtgtcca tctcatacga atcaattgat ttttgtgatt atcagggtcc gttagtaacc
7201 atttgtcttg gctaacacct gtatggtctg gatggaaata tttcttattt atccatctag
7261 cgccttttcg gtgatgttta tatttaagat ggtgcattac cttcttatga acataactgt
7321 caatgtcgcc ataaattact tttgctacaa caggtgacca gtaatttgct atacctgtta
7381 taactggatt tagttttctg attaattgtc caattgaacg tcctctatga gatttaaata
7441 tttcgcttat cttttcttta gcttttttga cactttggtt ggatggttta atgaagagtt
7501 gtgacccttc tttagtagga tattgtctaa aattaaagcc taagaaatca aaaccatcag
7561 taatgtgtac tactctggtt ttttcctctg ccaattttaa ccctctttta tcaagataag
7621 gttgaagttt agcatacata ctttcagctt cttctttaga attacaaact ataacaaagt
7681 catctgcata tcttactatc ccaattgaat cgggatataa catagctcca tccctttttg
7741 ggaaatggta tcttactcct aattcctttt ccattccatg taaagcgata ttagctaata
7801 aaggtgaaat aattccccct tgtggagtac cagtttctgt tttgtagaag gttttattat
7861 ctatacatcc tgcgtttaac cattggttaa ttgcattact ataaggaaaa ccttctatac
7921 aggataaaat atgctcatga ttcaggttat caaaacaacc ttgaaaatca ccttcgaata
7981 tccatgctct attagtccct ctacttaatt taaggaaaag gtttgccata gcgtcatgag
8041 cacttcgttt gggtctaaat ccataagaca tagactcaaa gcgacattcc cattgaggtt
8101 ctagtgcatt tttgaccata ttttgaaata tcctatcttt gataactgga atccctaaag
8161 gtcttttctt tccattcttc ttaggaatat aagctctttt cactggaaat gccttaatgt
8221 ttctaacact ataccctttt aataagtgga acaatttaac tctatcctct ggtgtgttag
8281 tagtaatccc atcaattcca gcagtacgtt ttccttgatt gatttgcgtt actctcttaa
8341 tacttaataa caggttcgcc ttacttctca acattagacg ttgaagtttt ctcaccttac
8401 gtttattacc gaattgttcg gcacgataga ttcgttgtcg aagtttcttc acatagtttt
8461 caatttcctt ccattgtatg gagttccatt gagttacctg tggagaaaca gccgacttca
8521 tattgacagt attcataaca tgttcctcct ttataagatt cctctttccg ctttctttcg
8581 tgttgaagac cagttggaat tcagcacttt ttcaagttat gtcaaaagac actatccgct
8641 cagttatgat ttcctgctat ctttcgatat agcgacattc gctttctcca acctcctata
8701 ccctctgaag aattagtcgc accttacggt ttgattacct tattcatagt gttctcggct
8761 aaaacgattc acacgattta tgaggacttc atagggctta acaagttcca ctaataatag
8821 attcgtttaa ggtaagtgtc cttctttact ccggcagatc tatgggtcat tatacgactc
8881 tttgaccgtc gagcctttcc tatctgcatc tacgagcttg ttcaatcaca gtacactcgt
8941 tgtcggtgac gaagattaca aagattcagc tttacgctta cacattctca aactttccct
9001 agccccttca aacgtctgtg taacgttatc cgttggacac ttaactctca tgcaacccaa
9061 caatccgatt actcagatag cagcttcgag cgggaacacc tttcatgact aaggtgactt
9121 cataatgaag cactatttat tagcgacttc ttgtcgcaca atcaagaccc accttcacta
9181 attctagcga gcaaataatt acattcacac cgctattcac ttgttctttt agccattcac
9241 tacgttttgg cggagtaact gtattggtac ggagagtagc tactttcgca ccaggtattt
9301 gctctacaac cttctgtaaa cgtggttgaa cgtctcgttc tttcactgta gatcctgtat
9361 cacatacgta tacgattgtt ggacggccct cagaaatttc tgtacgcaat atactctgca
9421 actctttctc tttaggctgt atacaatcct catcaaattt gaatttatca ttagaccaaa
9481 ccagttcttt tcctgcatca tctaagtaat agttcggata atgaatcata ttgtctggat
9541 atgcattacc tgtacgaata taagaaagcc acagttttcc agcgtctggt gtacctttcg
9601 ctgcttcaat tgctttttca aacgactctt tcatatgctc ataggcttgc ttctgctctt
9661 cagacatatc aacaagaatt gtagggacgt tgactagttc cacaggattt ggccatacat
9721 ctttaaggcg tacattaatg gttgtatcca ttaaaaattg ggtaaacaca taaggtgaaa
9781 taccaggtac aaccttagtt ttatctaatg taccttgtgc tccgcgtgaa gctatattag
9841 atgtgacctc accatcatgg taatatgttc tctcgatatt tccgtaggtt tcattccatt
9901 ccatgaaaga actgtattca aaaccacttt tcaccatttt ttgagggaat aaacgccata
9961 acgtatagaa tacatcgctt gcgcgtccac caaataatgt acctgttcca gctacaactt
10021 tcttacaaac ctttgctaaa cttcctaagg cagttccttg tgccgtttca ctttttaatt
10081 cgtggacttc gtcacaaatt aaagcatcaa agaagtgttt catttttcta cgaatatact
10141 caacagtagc tacctttcga tatgctcttc ctgattgctt cgcatcatat ggcttcacac
10201 gattctctaa ctctagttgt ttttgcagcg gtttatttcc ctcttttatt gcttgcacta
10261 atttattttc atatttggtc caatctttaa aacttgcata tttcgttttt acttttggac
10321 tccaaatatt tgaattacaa tcagcacata cactgttttt atttgttttc gaatctaagt
10381 cacttcctgt aaaatcttta tactgacaga cttctttctg ttcgccatta gcttggtgaa
10441 ccatgataga agaagttttt ttacgtaact tagcaccaca atctggacag tagtagccat
10501 tcttataata tctttgcacc tcttccttcg atttcttgga aagtgcaatt tgtttataag
10561 gtaatggcat ttgtttaatt gaatcccctc gcatcgttgt aaaactaatg acaaagaagg
10621 ttggtttttc tggttttggt cttcctgtct gaatccaaga ttgatgaatg cgaattaaat
10681 cctctgtacg tttaatcaga tgtacgtctg cgtctggtat taagtgtcgt atttcttctt
10741 ttgcccactt ctcagtaaga gtcggtggaa caaatacgca ggtacgatac cctttttttc
10801 cggttaaatg gaaatatcca tctactgtcg ctgtcataat tgaacttttg ccggacgaca
10861 tttccccctg tataatgatt cctttttgta cttgtaatgc ttttgctgca cctgttgcta
10921 catgtgcctg tacagggaat aatggtcttt tgtatgtatc aaaatgagat aattcctgtt
10981 ctttcattgg ttgatgcaat ggctcatcta attttgttac cttatcaagc atgacaggtg
11041 aatattccaa tagatattca tttaaatctt gtattttatt aattttttca cctgtaccct
11101 cttgtggaaa ttgacatttt ccagagcgaa tcatttctga taaaaactct ttacaatcct
11161 tttcttttag tacgacttgt gcaatagata gagaagaaaa ttcattctta tcaaaatata
11221 cctctaatgg ctgtaataga ttttttgtta gcatctcctc ataaattggc ttcgcccatt
11281 cttctaaaat tggcaagccg tacggaggag ccattaagaa gtctctcact tgcatttctg
11341 gtgcttcgtc aattgcaaca atgtatttcg tctctaattg tttggaaaac gcaataattg
11401 ctttcttttt attgatagtt tgcgtattaa taaattcaaa ttgtcctttt gagatcacat
11461 tcactttttt atctaatgtg taatgtgatt cttccctttt tccttctcca aaatacaaac
11521 ggctagttcc catcgatatg gcagccctaa atgactttaa tgtactatca ttcgccccta
11581 gtactgcaaa ttgtatttca cgatgatgat ttattgccat agcaaagcaa aaagctgaat
11641 gtgaagcagt tcctgtctcc aattgcagta tcgctggtgt ttgttcctgg tcaaatgtat
11701 cttgtttaat tatttcttgt agcataagtt tccctcctaa aataaaaaac gcatcataat
11761 cgatacgttt catgtcctac tcatttaatt tatgttttaa aaatctataa accgtttcca
11821 ctctggtaat gattgttcgg ctgcagataa catatcgcct acaccatgga atactgagaa
11881 ttgctctaat acttccaaat gtgtacctgc acctaattga gaagcacata aacaaatgac
11941 tgtaagtaca atagcaatac gaaacatacg attactaaat tcccatacaa tcaataatga
12001 tcctatccct aatagtacag acatagcctt cttcctttcc tagacaagtt ctttgactac
12061 accagttggt gttgcggtga taaatttagc gcgacgtttt tgtaaaacaa cttctttcgt
12121 tgttttttcc aattgctcaa atgaatgttc ataatacaca ttttcagatc cacgaactgc
12181 atggagtgta tcaccttcac caagcaaacc gtctgccaca cctgttatca gcaatagtcc
12241 taattgtccg gaagcaattg gcattttagc tctttcagca gctgttttct caccttgaag
12301 taagtagcca ttccctctat ttaaacgctt ctttaatgat gcgattccct ctgattttcc
12361 aataccttta taagcatctt tataatccac gcgagatgtg aaaataagtt tgttttgatg
12421 acgcaattca ggtatagtcc aatccttatg attcaccatt tgcgctaatg tactcacatg
12481 ttttcttacg aaatcaagat cggacatatt ttcacaaaaa ttagcaaatc gatcattgaa
12541 atatgtatca tttttcgtag ttgcacgctt acggccaata aaaacacatt gcttaaattg
12601 ctcaaattct tcattttcat caccaaaacg catcaagcct atttcctcat aattctttgc
12661 taagtaataa ctgatatcgt ctctagcgaa tctgtcgtat ggaatgacat acaccatgat
12721 cccaccttct tgtaaataaa ggtgagcacg ctttaagaag ttgaactcca ttttctctga
12781 ttttgcattt tctgtacgaa gctccgtatt atatggagga tttaaaaaaa taagcggaaa
12841 atagttatga ctaatcatca tgctttcaaa gcttgagcgt actactacat ctaattgctc
12901 ttttgcttgg ccatatcgat ttgcatccag ctctacgcca tacgtatgaa actggactcc
12961 cgcctgcttc gtttcatctg caaaacttcg taaaattgta ccttctccac aacatggatc
13021 aaagcaagca taagctcgct ctgattccat ttgtaataat cgtaccaagt gttttccttc
13081 tgttagtggt gttggataaa atcctgccgc taaatcattt cctaaacgca taatcgttcc
13141 ctccaagttc ttttttacaa taaaaaaagg aagatccaag tacatacatc acttagttct
13201 tccttttacc ctctatatac tacctcgact ttattaaaac ggtagtaaat catctgcaat
13261 ctccgatagc tcatccaaac cagcgaatat atcatccgac tctttggatt gctcgtttgt
13321 ttcctgctct tttggatcgt ctaatattgt ccaaacgtta tagtttttca tttccatatt
13381 cctctatcct tcttattttt taggttcata aacaacttcc tcgtaatcaa aaaagtaatc
13441 tttcagctta cgtaggatct tacgaaactt cggttcggct acgatcttag taccactata
13501 aaaactttgt tgcccaacaa agcgccataa gatgacatag cctaccttca tttcctgaat
13561 cccttcaata tataacgcga tttcttgagt ggcttctttt tcattaagag catgtggttt
13621 gaaatattga aatttaccat ctggtaatat aatttctgct tcaaaacacc ctctcatttg
13681 atttactctt gctctggatt cagatgacat tactggtgca gcatatgact tctgattatc
13741 ttccattcgt gttttatgct cctctactgt ttaatttgtt atgttatgaa tcataaataa
13801 ccctgcctgc aaacttgaaa acaacacaaa aagggcttct tcaagtcgat taaaaatgtg
13861 catagcaaaa taagctatat atacactaat cggctcaaag aagccctttc acaaatgaaa
13921 caagacgcaa cttgcttcta caactcaacc acaacacaaa aaaggtgtgg gaataaacgg
13981 aatcaaataa actaacaata tacctatata ttacacaatt atgattatag tagcaaggtg
14041 ttttacaagt tttaaaaact taatcctcca tttccatatc aatcatgtac cctttctaaa
14101 gtaatagtat cagtttgtcc aacattttta ggctatttac accagataag aacaatgtat
14161 taaaaatagt atttgttgaa ctaatttcca tttggtaaaa taatgtagga tattttccag
14221 gaggtgtatc caaataatta gatatatgta gaattaacta cttgataatg agagattttt
14281 atacggacag caaaaagaaa aattactttt tctacaaaac gaaggattaa ggaatttaga
14341 gggggaatag ctttgaagaa tctaatgtta aaaaatatat taatttgctc tatttctttt
14401 atagtattta gcttgatatt tttcgtcatc ccaactcagc tagatacaat gacaaagata
14461 gtatttgtta tatttaatgg gctagggatt tctataccga ctattgttgc aatgagaatg
14521 caactaaaac agactataaa acttgatttt gatataaagg aaatgaaaaa ggaaattaca
14581 aaaaaagaaa ttactaactt tgtaggatta ctgaaacttc aaaaatatat tcagggtgat
14641 ttaaagagat tgtcagaaca ttacatcaac agagaatcag aaatgcatgg tctatatcgc
14701 gaatttaggg attggaaaga caaatataat gcatatatta tccccataaa tatggtggca
14761 gaaaaactca ttgatgatta tgctagctta cttaacttat tggaagaatt agatccacac
14821 attcaaaaaa tagttttatc ttatgttttt acagcctgtg aagaatacct aaatgccata
14881 ccatcactcg gtggcagttc ggaaaaggat aaggaagtag tcaagttatt atctagaaat
14941 attcaaaaga aatggatagt tttatcagct ggatttgaga aagtttttaa agaggttcaa
15001 gaggaaacat atactgaatt tacgtttctg gtacaaaaac aaaataaaag aggataaatc
15061 gcatatatcc ctatcggaat cgcctcttat gctgtaagca aacaagcata gatgtatata
15121 gaaaaagagc catttttaat atggctcttt aatatattat ctaatcatta ctgattttgc
15181 gctaaaaata aatcccttaa aaaaataaag tcattttcca cgaatttatt acaaacccgg
15241 ttcgccaatt cgaatagttc tttatcctga gcagcatata aatattttat tatgtatagc
15301 atttcttctt cagggcagta tttatgtggc gttagatcac tcacccaaac atccactaat
15361 tctccaataa ttttcctttt accaatatta tcagtttctt taattttcac atataacagt
15421 tcaataacta catcaaaata attatcaaca aaagggattg ctcgtttaat taaatcacaa
15481 tttgtttcat caatatcatc taatttactt gttaataata ttatttttga taaaagcttc
15541 ttatcttctt ggctaaaatc ttcagtttca tacccattat atttattgtg aatttccttc
15601 caaaaatcaa ttatcttctg tttctcatct acttttaact tttcattttc tatgaaacaa
15661 aatacatcaa taaattcctt tataaaatta taattccatg aatccatgac tttacgataa
15721 agggtctttt caacctcttt ctcataacct cttaaatata tttcaactaa aacctttgat
15781 aatcttgttt taatttcttt ttctttaaag ttataatcaa tagcggattc atattgtctt
15841 ttcattaaaa tatagatatc ttcattaata attagattgt tactgtaccc ttcaaaaaaa
15901 gcttcccagg atttactttt taatttaata gaattgattc tatcaattgt ccattcccta
15961 tccaaatcta ggaagtttgc cagctccatt cccaataagc tatatgcctc tccaacatta
16021 agttctaaat actcgttata aagtgcttta aaatcattat cccatttatt ttcccattcc
16081 atatttttat ttaataccga catttttaac agtgcctcta acacatttcc tttaactgaa
16141 tttaaaaaat atgaaatact attatcgttt gaattacatt cttctaaatc tataattttt
16201 ttaaatacca acaataatat ctgctttgcc ttattgtaat gtttgcgatt aaatgcctgt
16261 tctttatttt cagatcctgt aacaaataac ttgcaaataa tacttataac gactttacaa
16321 tcataatctc ttttattctt attaattagt aacttacctt gccaaaattc tgttctgttt
16381 atataactta taataaaatt caataattta tcccaatcca tagttttttg ttctttccaa
16441 acatcacaca agccaagtat tatttgatga atatagtaat aatcagtatt aataaattgt
16501 tttaagccct ctaccatttt agctgggttc tccctagaaa gctctctaat cgcttgtccc
16561 aatgaataaa cagttgttat gctctcatgt ttgctttcaa catactccct taaatatttc
16621 gcgatttcct tgttgctcat atttaaaagc tcagcttggc ttactggaga tacaattcga
16681 acgaattttg atcctatcac ttttgctttc gagcttaatt cagggtccac ttttgttatc
16741 tcttttaatt ttaaatatct tttttcaaat aaaggaatat gccttaacgc tttcagcctt
16801 ttttgtttcc atacatttat atcctgagct gttatttcat tagatacttt ttctattaaa
16861 tataataata aactttcttg atcattattt agagtttcta attgctctag tattaatttt
16921 aattccgatt ctaaataata ctcttgaaaa acaatagttc cttctctttg ttcaagtgtg
16981 ctccaaaata tatcattata gttcacaaaa tcatttccta tgacatctaa taatattttt
17041 gtgaataaaa gatattcctg attttttaga ttaattagaa acggctgcat ttgtgaccct
17101 tttttgtaat tacataagtc tttaaataaa taaaggatta actcaaaacc attattatat
17161 gagttcctag tttcatactg taagctcaac atttccttat agtttatatc aatatatata
17221 gatttaacag aatcttctat cttcgtctgc aatttatctt tactaaactt agtatatatc
17281 catttagtaa cttgctccat aaaactctct atcccgtttt cttccattgt attctcatgt
17341 ttaattatcc catgttcaac tattcgagta atatattcct tttttatttt agctatttca
17401 agtgtgtatg gtttctcacc atattcaaac tcaatttctc tttccgcttt accaagatac
17461 tctttaagct gttgcataat cttctctaat aactgcatcg aacatttttc cgcaattttt
17521 tttactgtat cattagtgaa tattttgtaa aaataatttt ttccaagttt gacttgattt
17581 ttttcaaaat caaggattac taaacattca ataatttttt ctgccttctt tatatcttct
17641 ggttccgaag aatttaaaaa cttaggtact aacttttccc caatattata agaaatataa
17701 tctacggaaa acattgattt tatccatatg ttaatcgtat caagaaattc tagattaata
17761 tatttatttg ggatttgttc taacacctca acaaactgat tccaaacacg ataattatct
17821 atatacattt cctctttatt tttatagaaa gaaatagatt ttactattcc taaaatatca
17881 tttatgtctt catcagttaa atcatgttga tttactactt tccttaagta ttcaccttgt
17941 tcccaatacg ggattctata tccgttctca acttttttcg gttgtggaac atcttcagga
18001 tcaaagaaac cagcatttgc taactttttt agccatctct ttccattaac ttctttgaaa
18061 aagtacaatg ctaaagattc actttttcca atttctttta ttactgatct agaccttact
18121 tcaaaagctg tatcatcaca tttcatcaca ttatctatgg atattgtttt actgataaaa
18181 tctctttctc cactcacttc ccctaacacc tttgaccatt catcaattat aggaattaaa
18241 ttatcgtatt tgttcttata tatattaaaa gggattaatt ctactccaaa attactataa
18301 tattttttat ataaattagt catttgtgga ttttcttcat tttctgagaa taacatataa
18361 tgtgaaatag tatggctggg gtttttagtt ttagataaca tatattctaa gatttcaaat
18421 tcttctaatc catatcccat aaataatacg acataattcg aattaaatac ttgatccagg
18481 aatacagaaa cctctgggtg actctgttta gaaatagtcc catagcgttc taaataatct
18541 tgtacagtaa ctaacatact ttcttctttt tttacactac catgaatatg aattacattc
18601 ccatttttaa gttctgcttc taataattct gtatgatcta taaatacctt tgtttcagaa
18661 ctctgctctg ttaatttatt ttcctcactt aaatccatac tatttgaaac tttttcatta
18721 tcagattgtg gtgtagttaa aacatctaaa cattcatcat aatttgtagt tatataaata
18781 gcattcattg agtatagctt ctcatatatt gctttatatt cctcattttt ctcaaactta
18841 aaaatctcat ttgccgactt aggaatgatt tctttttcat cgaacagcat tttacaaatt
18901 gttaatattt ttttgggatc ttcttctttc aacttctcat acaattcaga gtctataacc
18961 cctttttcga ttgcatcttc tagtatctct tgtgcatacc ctttccatga gggcaatcct
19021 agcaacattg aaatacctgc ccctacaaaa attataagat tacctgtttt tgcagctttt
19081 attatatctt cgtatttgta aatatccgga atttcaaatt tttttgccat atttattcct
19141 ccctaacaaa aatctataaa ttctattatt attttatagt aaagtggttt aatttataat
19201 aaattaacca cttcttgtct ctctatccac ttatctaatt tgttttttgt atcatcattt
19261 aatcgttttc ttttaccgga taacatcctt gaaagtgttg aatatgaaat atcgatttct
19321 ttcgctaact cacgaatact tttattattc ttctctttat atgtgttcat cttttcaata
19381 taaaaatcga tactattagg gttttcttga tttggtatac atattggctt ctcttcaatt
19441 actagtggct tttcttccat ctcgataact agtggtaact gttgcttact tttcttagta
19501 atcaactctt gttgtagttt aaccagttca tttgtaggag aaataattac tttcaattta
19561 agccaatagt tttcaaacca atttttaccc ttacatttct cttcatctaa ttcaggagag
19621 tatgtccact cttgaattac ttggtctctc ataagatcat ctaacgtctt ttcaaaaact
19681 tgtcttatta gacttggctt tctattcata cttatctcca taacttgtaa tagcccttta
19741 ggaccaccaa tactatatga atgagtcaaa tgttgataag attgttgaat acgccaacgc
19801 caacttagat atctggttac tcttttatgg tatctctgct gcttactgtt atattccaat
19861 gctttcttag acagtaaacc tgttagtttc tcagaaccat atagatattt tgataaaaag
19921 ctacctggtg ttacattcat actctctatt cccaatgttt tatccgtatc aatatctttt
19981 gcaatgataa tttcatccat tacaaatagc cttctaattc tttgcttttt ataagctaaa
20041 gtttcatttg ggtcctcttc atttaatatc acgatctcat tatcttcatt tacataaata
20101 aaaatactgg caagggcagc taaacgctcc ataatcttta atctgtcttc ttttcgataa
20161 taagccttac catttttgat ttgtttcata ttacacatat ctaatatttg ttcgtaatgt
20221 acaggcacaa tagtcttatc attttccgca ctctttaccc atagttcagt tacaatatca
20281 agacaatcag ccgttaaatc atccattact cgagttaaaa aagtagaatc aattaatgta
20341 ttccatcttt ttagctcttc tctttgtaac ttcatatcac catcatcatg tgaagagact
20401 accactaggc tattttgttt atcttgcaat tgagcaatac gaacattctt atcttggtca
20461 tctgtaaact tattcttagc aatggtatct gataaatggt acataaatcc tgcattactt
20521 ctttctatat aatcactctt gttctctgga tctaaagcta actctttcgc gacaacagga
20581 aatttaatcc caaattctat atataaatcg tcttttagac attcaaaaat ttcttcctta
20641 taattatcta gttttggaag aatgtctatc gctgataatc ccagagcttc ttttttagaa
20701 acccatttca ctagcctttc gaatgtctgt gatgaataag atgagttgta tatcttctgt
20761 agatcttttt ctacatcttg atagaattgt tgccatttat ttaaaactct ttcactcccc
20821 tcaactccag ttagtagagg gtatgatata tataaagtgt tttgaaatag tacttttaac
20881 ttttccacaa gtaatcctcc taattgcttc taatacaatt atatcaattg ctactaatca
20941 ttaataccat tctacataga gtttcaaaat tatgtataga ttcaagagaa tttaaccttt
21001 cttaaaaact gtaacaaatt cctttctatt accttatttt aaagcatcat ttattttccc
21061 gtgttgcgta ctctttctgt aaaacaggca acatctttcc catcttgcgt acctttacta
21121 aataatacgc aacgctaata taaaataata atttcttcac tcgcaagact taatattcag
21181 aatattattg ataaatcatt atctcacttc caattatttg gtaatgagat tatatttaag
21241 atgaattatt agaagatagt ggggattaag ttatgaaacg gaacaaaata tgtacagtat
21301 tattttctgt agctttaatg tttagtgttg tctttggagc tttttcattt ccaacggggg
21361 ctagcgctcg agtaatggat gagaatagcg gtacttacaa tgccccgccc aaaagcagtg
21421 atactattaa gtttagtgtt accccaggat atggtcacct taaagtgttc atcaaaaacc
21481 gtggccaatc taacctatat gtttcactta aacatgtagc tagcggtaaa gtatactttg
21541 aaaacaaaga gattagagta ggcgatccag cgctagaatg gaaaagtaac aaagaaggtt
21601 ttccacaggg cgttaaggct ggtgactttg aactctcatt tagtagtggc ggtaaagcag
21661 cataccttga ctgggcttac aaatcagcag acattatttg gccttagatg aagaagacgg
21721 attttccgtc ttcttttttt atatttatta aaaataatat gcaacatttt tcccatgtta
21781 cgtacttatt tctctaaaca agcaacacca aatatttaaa ttatttaatt tcaagtggga
21841 aagaagcatc atttttccca agtcgcgtac ctatcttgta aaaaaaatta gccacaaacg
21901 ctgttatttc aggtgattta cgatatttaa tcaaaaacaa tctatatatt acacaaaaat
21961 tctttcccaa gtcgcgtacc tattttccca agaaagaagc aacatctttc ccaagttgcg
22021 taccaaaaaa caattgaatc atctataaag tattgatgct aaaggatttt cctttttctc
22081 aataagtagc atcacacaca aaaagagcaa cattccttcc caagtcgcgt accaaaaaat
22141 tttttgaact ttttttcaat cccttgtggc tctaaggttc atgaggtgtt gcttttttta
22201 aaaaactctc ttaaagggca catttttaca aaattcgttt tgatataatc aaaattggta
22261 tattttatat tcttttggca tatatttctg aatttgtaga acggaggtga aaaagatggg
22321 gaaatcattt gtgatacgta atcaacgaag cttaaatggg gaaacaacaa acgcagtttt
22381 agtaactcta aaatcttggc aaaagtttgt ggaaacattt gaggaaaagt attacagcta
22441 taaagataca tacttggaag atattctgca gcacatgaca tacgaagaac gtattgctga
22501 cgtagaagga tttgtcgaaa aagccaaacc atctttttca cgtcgcgcaa tgtctacaat
22561 tgcagaaaaa acaggaagaa agcataaatt atatggcatt acgaatgctg atctcgaagt
22621 gttcttgtac ttacataaaa aatgctatac aaatggcgtc attccaaatg taacaataca
22681 tatgatgtgg gaagattaca agcaatataa agaagagctt gcatacattc agcattctca
22741 attctatatc gctttgaaaa agttaagctt acataacatt atctctattg aaaatggctt
22801 agatggccgc tatacaatca aactcactca ttttatgaac gaggaaacag aaaaagcaaa
22861 tccttacgta tatattagtc ctgttgtatt tacaaaggct ttctttaagc tatctgtagc
22921 agctaagaaa ctattcttag acatcgcaat gcaacaacat acggaaacaa cattaaagcg
22981 ttctttggac aagcaggacg aaagaggaaa caaaactcac ttcggtggga tgtatcattt
23041 cttacataaa aaatatccgc atcagatccg tacggttatc gaggaattaa caactgcatt
23101 accatgtacg gggaatcccc tattcaaaat ttgcaaaatg caaaaagggg taaagcatac
23161 aaaacgatat acgacattat atctgtctat ccattcagac ttcttatgtt cgaaagaagc
23221 tggagaagaa caacataggg atccatttac accaaaagct acctatgctc gaaaagcgaa
23281 atttatagaa acagtcctac aagagatgaa tatcggtgaa ttgtctgcag acatgaataa
23341 gttcattcat gtattaaagc atacttgtca tcgtcaaatt cgcagtgtaa tccgtggact
23401 acgtgacatg gttgatcgaa aagaaggata tccaacgaaa attgtatata cattgaagaa
23461 actattacat caaacttctc aatatcaaat tctcgataca gcagcaaaag aaggtatcta
23521 ccctcttatt gcgcaacata taccaaaaga gagaaatagt gaccgtgaac aagctgtctt
23581 taattttggt ctacattatt ctatgtactc tcttcataac attaagaaga tgtttaagaa
23641 tgtgcatgca ctactgaagc agaagtttgc ggtaccagtg acagaagagt cttatcaccg
23701 taattatcta aaataccagg aagaaacgtt atttagaaaa tatgcatatg atcagggcgt
23761 aaatctccat gcatatatcg ctttagaaat cgaaatgcgt gaaaaactaa aagttcgtgg
23821 ccataaagac cgcacgattc caagtgatgt acgtgaatgg tttattgaag aaattgataa
23881 gctaccgcaa gaacagctgc gtgtgattga gctaccaaaa cagtttaatt tactagagtt
23941 tatgcgtacc ttcgaacgtt tagtacgtgc tggtgtaaca ataatagctc cagatcaggt
24001 gctacacgca atggaaataa aataatagta atgagctctc tatttttgaa aaaatcgaaa
24061 gtagagggct attcgtgttt gtatgattag taatctattt ctgctactct acttataaat
24121 accaaatcaa aaggacttca tataaaatgg agtctttttt tatgcaactc tatacaaatt
24181 cgattctagc aatatatagc tctccacata acaccaggga gtattcttct aatgtattaa
24241 aacatatcct aatataccta caaaaaatca taaggaaaaa tataaaaata gtggatatgc
24301 ggataaatat ggttcaatgt gaatataatc tttctaaaat cactgtaatt actaatgttg
24361 ttgtatatat ctaataaaaa tcatcaataa taatgtgagt tatgtgtaaa tactgagtaa
24421 tgttaacaaa tagcagccta atctgaataa tatgtggata atcggacgat aaatacctat
24481 tgatttacca aaataaagaa aatagcttct atttacagag ttgaataaat ataatgtgat
24541 cggtatcaat ttcttttcga tttcatgtag aaacatatta tttctttctg cttttttgta
24601 gaattgcaag tctaacaatc cttgaatcta cggatatatt ttttactatt tatgattttt
24661 taggttctca catctaattt tcccttgtgg gagtaagtct attccctatt tttgataacc
24721 tataaaagtt ttatctttat ttctttttaa tatataagat atatatttat aatagatttt
24781 taatacagct cgtatccttg ttaataagat gtccgaccta attgaaagta tttgtaaatt
24841 acattataat aatggtaatt aaacatatca ttacccacat acaaaaggac aaacctacgt
24901 atccctacca gggcgaggtt tgtccttttt tcattttaat aaacaattaa caagtggagg
24961 attaaacatg gtcgtacttg aaaatacaac tgatataact gtgagtacaa ataacgaagt
25021 tagatttttc aaaggagttt tttggggatt aatattcgta gttccttttt ggagtattat
25081 aatagccgta ttcatttggc tgtgtaaata ataatcaaca tatcaaaaac gcaaagggtt
25141 gtttgtccgt ttgcgttttt gatatgccag caaccgtgcg tagcaaaggg cggtagaagg
25201 ttttaatcct actttctgtt ataatatatc caaagaaatt aggtgattat aatgaacgag
25261 acaattagct tagaagaaac cttagaagat ttttctgctt atttgaatga aaaaggccga
25321 aagtattcta cgattcaacg ttatgcatac gatattaaag atttttatag atggttagaa
25381 attaataaga tgcttttaca tatcaaatca tggaatgaat tatctcaaga aatttatcaa
25441 gcttatttct ctgagttaga acataagcgg aagtattccc agaaaacaag gcacagaata
25501 tgggtcgttt taaagaagtt acatacgttt ttaggaatag ttagcccatt agatggtatt
25561 cacctttcct taattccgga tcaatcacta agtgatagtg attttattac agaattagaa
25621 gaaacgcttt taaaacaaac ggttctatct acaaaagggc taacagaaag acaagctaaa
25681 tatcggcctc taatcatgga tagaaatgct tgtataatta atttaatagt aaactacggt
25741 ttgtctctac aagagcttgt atcgcttaat atgagccata tacagtttgc tagaaacatt
25801 ttaattgttc caggggaaaa taaattaact agatctgttt ctttaactat ggaagataca
25861 caacagcttt acaaatatta tacgactatt ccggaacccg taagacctca acaacacaca
25921 aataatcccc tatttgtggc atttgatttc aatcgaggta cctttcgatg ggtttacgaa
25981 aatgatgcgc ctaaggcttt gtctgaggtt gctatacaaa agatgattcg acttgaagtg
26041 aaacgagcag aattagatag gagaatttct gcacagcaga tgagaaacac ttttattctc
26101 cgtcttatta ggcaaggagt aactgaaaaa gatttggtaa gtatgatggg gtttaaaact
26161 aaaatatctt taaaaagata ttatcaatat ttacagtgac ctatattaac catactaaaa
26221 taagaagacg tgttctataa atagaatacg tcttcttatt aatgtacttt tctttgatta
26281 cttcttactt ttcctcatct atctttttaa ttgcagcttc gttctgactg attatatctt
26341 gaaaatgctc ttgcttattt tcttctacaa actgtataag ttcttcgaat ttcattatta
26401 tcaccttatt tcattaactt tgattacttg ttctaattcg aatacagaaa gtacctggat
26461 gtgtaaaaat gtctttaggg cattcccaac ctcgttatat ccaggatttc cttttttaag
26521 gcatgcttta tgtatagtaa acgaaaccgg atcagttttt acatcttgat atagtacaag
26581 tgtaggaacc caatcaattg gagtatatag gtgcataaga ttctccaaac atttctttag
26641 aacgctattg tctcctatgc aatgtatttc acagaactaa gcttcattcc tcccacttct
26701 ttagaggtgg gaggaatgaa gtgttttttt ctttatagaa catacgttta tattgtataa
26761 tataaataat taaaaagaaa ggagtgacgg gcaatggcaa aaccaaagaa agattgtttt
26821 attatagaac tgaaattaat tgtggataca tggcaaaagg atattttact caaacgtttt
26881 gaaattgctc gtaaactcta taacactaca ctatcttatg ccatgaaaca atatacactc
26941 atgaaagaag ctaaagctta tagaaaacaa ttgcattgct atcaaaaggc aaaaaaagca
27001 aatcatccaa aagaatggaa agaaatatca aaagatttag atagcatccg tcaatccttt
27061 ggattaagtg agtatcaact tcatgcttat atcaaaaaac accaacacaa ttacaaaaaa
27121 catatagata gcaatacctc tcaaaaaatt gcttctacgg tttggaaagc tatgcaagac
27181 gtaatattta aagggacgaa aacccatttt aaaccattcg gaatgctcca ttctgtagaa
27241 gggaaatcca ataaagcggg tattcgattc aaagaaaaca gggtctattg gaatggatta
27301 caccttcctg ttcgctttcg caagaatgat ttatttatag aagaatcact cgctcttcat
27361 aagataaaat attgtcgtct tgtcaaaaaa gtgattcgtg gaaaagatac gttttatctg
27421 caacttatta tgggtgggat gcctcctaca aagagaatca ataaaacagg agcctttcga
27481 cattcctacc aaaagaaaaa gcgagtaggc atagatattg gtccttctac gattgccatc
27541 gtttcggaag aaactgtttc tattcaacaa ctcgctcctg atgttccgtt atttgagagg
27601 gaaaaaagac gtttattacg taagttggat agaagtcgta gaagtacaaa tccaaataac
27661 tttaacacaa atggcacaat aaaatgtggc atcaagcttc attggacatg tagtaaaaac
27721 tatcaaaaaa caaaaagtct attaaacgag ttgtaccgaa aaaaagctgc ttatatcaaa
27781 gaaaaacatg gtgcattggc aaatagcatc ttatccttag gtgatgaatt gtatattgaa
27841 acgatgcact ttaatggatt agcaaaacgt acaaaagaga caaaaacaaa tcaacaaggc
27901 aagttccaat ccaaaaagcg ttttggtaaa agtattggga atcatgcccc tgccatgtta
27961 gtggaaatta tcaatcaaaa attgaagtat gggaaacaag agatacaaaa agtaaatacg
28021 ataactttta gagccagtca atataaccat gtaacaaata gctatgaaaa gaaaaaactc
28081 catcaacgat ggagtcaaat tggaaattat ctcgtacaac gagatttata tagtgccttt
28141 ttattaatga atagtgatgc aacattaaaa caaaccaatc aagaacactg tatcgaaacg
28201 ttcgatacct ttgtaaagct acatcatcaa cacatagaat ccttacaaca aacaaataaa
28261 aaatacccgc tgagcatggg tatcatataa ataaggaagt attccttcgt aggtagagct
28321 acctgccttc gttaaagctt atcgccaaca caatattggt tgtgtagata agaaagtctt
28381 atggaacaga agataaatca aagatgttgt acacagaaca tagcaacacc atctgtggag
28441 agctttgtaa cgcttctatc aagtacataa gaaccccact gctttagctg tgggagtagt
28501 cagtcggatg tatctctcta acgtaaaatg gtacttgttc ttcataatgt ttatatatcc
28561 ttttaaatgc ttctatggcc ttttctattg atgtcgcatt aataaaactg attttatgtt
28621 ccgtagtaat ttctaatatg tataggcgca taattattca tcccctatat tttctatata
28681 ttaattgata cattgtatct tcttactttt aatttaaaga aagtacctat tttaatggta
28741 ctctctttaa atatatctcc tatttatata ttaatctatt ggaaatgact cgtttcctaa
28801 ttccttaagt acttttgcaa agagatggtt tgtctcttcg gatagcattt cctctgtttc
28861 tattaatcta gaaagtctat ttgtaaactc tgcagcatac aaaagcttcg tactggcttt
28921 ttcatcttct ttaaacaatt gttcattctt catggattga attaagatct gaataagcat
28981 ttgtttatgt tgttcgtttt tctttccttg gtacatatcc attcctaacc aatgacggac
29041 aattcgttca gcgtttcttg cttctgttac atcaactcta gatacaacaa aggttagctt
29101 gttccaagtt aattttgcta cttcatttga ataattggaa ggaaagaaga aaaagcttcg
29161 gtgtgtaatt ctttgccgtt ctttaatcca acgaaatagt tcctgctttc ctagatgaat
29221 atctatttct acaaaaaata cgggaaacgg tgacgttgtt ttttcctcat ttattgtaca
29281 atcgggcttg aacaccaatt cacctagata tgcgtggtat acaggttcca attcatctcg
29341 atatactcta attccatctg tttcatacca agcttgaaga atagcttcga tctcttcttc
29401 agatataaga atcgtattca tctcttgctg cgtaaaaagt aaatactcta aaagcattct
29461 tcgacctttt acagtaagtc ctcctggtgc ataatctcct ttttctgtgc gatcaaacat
29521 aatatagtcg tattcagcat gattatgaat tgaaaataag tctgaatccc ttttattttc
29581 gtttctaagg agtgtttgta gactgcgtct attcattaca ttccgataac gaatatcgtt
29641 tctaatggaa tgtaagaagc ttttccatga ttgtaggtaa gcataatctg tatacccctc
29701 acttattaac tgggttagca ttttatcctc accattcatc atcagacaag tccaacaccc
29761 actacgcgaa tttgcagctc cacaagcatt tccttgctgt tttccacctg tttttatgcc
29821 acattcaaac atagcctgtc catactgtat gctcatttct tctacatcta cgccaaaagg
29881 caataatcct ctatctaaaa gtaacatcca tacttcatca ccggttaaga atttgaccgg
29941 gttaaagcag agaatattct tcatgtcatt atgacgtgaa aataaggaat cattacttat
30001 ttcatgcttt tggatactgt gtcttcttcg agcgctctct tcattacgaa cggccagcat
30061 tagcacacca tcatattcat caaagcattc tattacattc gtagtttgag attctattaa
30121 tatttctttc gttttacgct gcataggttt tactttgagc gaatcagtac accatctcaa
30181 tctactatta ccactcggtg gaagaacacc ccttcctaga acggaagatt ttgtttatct
30241 gcattctctt gaatctttcg taatgtacgt gagatataag cagtcatagc tggtgtttct
30301 actccaacct ctgatgttaa gatatgaatt ggtttcgtac gctcctctat tggcaattct
30361 gcaattgcat cccatagtaa ggtcaacata gcagaactat cttttccccc gctgtaacct
30421 acaaaacaac aatcacgaga taaatagact tttttcattt cctttttaat ttctttatgt
30481 atatccatca ttatattgtt atccccatag caaagtatca tttcatactg ccatggagca
30541 ttcctcctct tttttagata gaaaaaaaga gtccctattt aataggcact ctcttttatg
30601 tatatcctct atttttaatc aaatgtgatt tcatgtatat tcaacttgtt taacttttcc
30661 ttatagaaat tcattacttt ttgagcatgt tgtatagcca ttaatccatc ttgaacagta
30721 aatgcttcaa aatacggata acgaatgtct gtagcataac cattcagctg cacgcactgt
30781 tctaaaatca atgagaattc ctcatctaat ttccgacaca atttgtgcag cattaaaagg
30841 ttatgagttt ttgggactgt tctaccgttt aatgcaagaa atccttttag aagtttttcc
30901 acacattgtt gactatgata acaaataatt gcagtaggga aagggttcat gtgagttaag
30961 taactagcag aatctaaatc ggattttgct ataaacaccc actctttaag atcctcagta
31021 tttattgtcg ataggtaagt gtttgaagct atctccaact tttcccccga tccgcacggt
31081 acgtgccact ttcacggcat accgcggtcc atctatattg tagttttctt ttcatcaaaa
31141 taatgataag ttctaagcga acaacgctag ttgttcatgt ttcatttcca cttcattttg
31201 tgattaaata cagatttcct cgtttttgac taattttcgc aatttattga gtttgcctaa
31261 ctgttcctca ttgaatttga gttcattgag tagttggttt atggtttcta tcttggttgc
31321 gtgtattagt ctatggacac ttggtttgat gatggtaaga ttcttgtagc tgtcgtcctt
31381 tgtttcactc cataatcgct tatggtgaca atgaatgtcc caaggtaaga gtttctcacc
31441 tgttacactg catttgcctt tttgtgcgac ataaagagaa attcggttgt cattgtattc
31501 tacggttgcc cgttcattta taactggatt ttctcttaac catttcagtt ccgcttcggt
31561 tatgtctgcc aagtttttat gtatcagggc tcgtccttct gcggtgtact tgttaatggc
31621 ttgctttttc atcatcgggt ttttgtgttg aatataggag attggtagga tgggacgttt
31681 catgagaaat ctcgtcattt ttgactttag atatggttta atacctttgt cttttccttt
31741 atattctcct atattcgtgt atccatttgt gttgctttta cctccagttg ttgacttagg
31801 gaatctgtta tacattatgt ggtcaagatt atggttcatt ttactgaaat cctgggaggc
31861 atgcgtagct attttataat agttgtgctt accaatgacc atgctgttgt atatgctgat
31921 tctcttaatt gtttcattag agtttggggt tttctgtatt cttctcactt gttttgctaa
31981 atcttgtttt gttttttcca gtgcttttgg ggaaacgtgt gttactgcaa tgtatcgtgt
32041 gtcgccgttc ttctttttac ctttctttac agctttgagg gtgaaaccta agaattcact
32101 ttgttgcttt gtcagattgg ttactttaga cttttcggct gagatagaca gttttagacg
32161 ttcttctaac cacatttgag tcgctttgaa aattttctcc gcattactac gtgtgtttgt
32221 gaagatttta aagtcatctg cgtaccttac gatgtacatt ggtttcatct tggaagtttt
32281 ggtgagttgt gtcgttacaa cgtcattgca ccaaattccc ctcatgcatc tcggttttac
32341 ctttttagct ttgaatgtct cccattgtct acttatccac cagtcgaatt cattaagatt
32401 gacgttggca agtataggac taagaatacc gccttgtggg gtgcccttag tcgggaacat
32461 tgttgtgccg tcaggcattt gcactggggc tttcagtatt tttcggataa tgaccagaag
32521 ttgtttgtca cggataccca atgtccataa ttgacgcatg agcttgacgt gatttacctc
32581 gtcaaaaaac cctttaatat ctacgtctac tacatatgta aggttttgtt tatttactcg
32641 cactgatgca tctgctaggg catgttcagc acttctgttt gggcgaaaac cataacttcg
32701 gttactgaag tgcgcttcgc agattggctc catgacttgt aagatgcact gttggattat
32761 cctatcccac atagccggta ttcccagggg tctggtttgt ccgttgggct tcgaaatttc
32821 tttacgtctt actttctgcg gttggtagtt ttgaaagcgt cttttaactt cattcaagaa
32881 atagctttgt tccattccct caatattctt tatatttaca ttatcacaag ctgcagttct
32941 acttcctttg ttccccttaa tattgcggta ggcgagaagt atattttcgt ctgatataat
33001 gatagacatt aggtttttga aagaatttcc ctttgttgct ttttggtata agttatctag
33061 gacaggttga ataccgtagt attcgttgtg tcttagtttc ttcccctttg gcgcggactt
33121 agaattgcca ttcatggtct atcacctact ctcaaattga tttttggtga ccttttgagt
33181 cttaccagaa tccatgcaag attagatgaa atttcagttc ctactatata gacttgtggc
33241 tgttcctcca gttccattac agaaccttca acggtcgtgc cactactctc accactatta
33301 agaatacttc ccttggttgc ccatttcgta ttcaactgta tccgccgata gagattactc
33361 tcaacgttgg tggctttcga cgttccattc agactatcat tgttttaaag gtcattttga
33421 cctccgattt aggtgcttgc tataccccgt gtctagctcc attgcctata acaacgttag
33481 gattgttaat tatgagatat tcccaatcca ttagacaagt cttgttttca gactccgaat
33541 catttctgat ccgtgtcctt ttcgaggcgt acattcgcaa gttcgtcaat ggtttaccac
33601 attctcacca tgtcggttga cagcatacgg tacttggtta gttccaaccg gtttattact
33661 cctgttggct ttcggttaca cagttgtgca ctacgaaccg tgaccgtata ttttaccctg
33721 ctctccacat cacgctatgc ctagtgtatg cagttgggaa tctcactggg gtagtttcgg
33781 ggcgttactc cttcattcct accacttatc tgaacagtta tcctgttctt tattgctttg
33841 attgtttttc caattaagaa cagtcctcgt tgtcgcttat acttccgtat tgcttactcg
33901 agaacgtctc gcacctcata taggaccttc ccttctagtg caatcttatg ttccatagtt
33961 acagtacggc tagcacgttc ttgaaactct tctggcccat acactaaaat atcaactggc
34021 gtttccatta catcataaat cccccaattg ataagattaa tgacttccct ttttctttct
34081 cctacacctt ccacaacaat acagagatca aaatcactgt cttcatttgg tgtgccatat
34141 gcatgagagc caaaaaggat gattttttgg acagaagaca cagtttcacg aatcttttgc
34201 accaatagat ccaattccct ttgtacttct tcgttaatcc gaatcacccc tcggataatg
34261 taattaaatt gacgtttaag tatattatac atgcgtttct ctactccctg ctattacata
34321 tttattttta tatttttctc ttgtttttca acgttctgta atgcttgata acattcgtat
34381 acctacttga agtcttgtac aggtctacag tctgagatac tttgagattc tttctacaca
34441 aatataagag atttgtttta tccctagtta aaaaagaatt tgatacctct atgacctcga
34501 tacaacatcc ggatttgcag caaatatttc aacatttaat ttaaaaaggc ttataatttt
34561 tacaaaacgt tggatattta aactcctatt ttctctttta cctactaagg caatatatgg
34621 tacaagaatt ttcccttctg cattatcgat atgaatgctc attttaaatg ttctcctagt
34681 tttattttga aagtgtattc tctaagtttc ttagatatga aattgataaa tttgtaatcc
34741 tatatacggt gtacaagtca aatgaatgcc gatgcagcag gaataactcc ttcctcctgc
34801 acaatggata taacatattg aagtaaattc ggctgtttaa taagtgtatg tatatataat
34861 ggatgagcat ttgaatccat ataagtatca ttcctctggc cttcaagtgc ttcatatatt
34921 tgatttatat ttgatttatc tctaatttgc acataaattg aaatagctta tagtcatgat
34981 gtggttcctc taatattggc tcagcctttg taagcagaaa catgtaatgc ctaatatttg
35041 taaacattgc gaattggata gttttaaatg tcatcataac aaaagaaaga gacatcaaaa
35101 tatgcctcct ttacgccccc ttttatattt ttctagaaac ctaaccccac tggatttata
35161 cactttgcta attcttgtta ctgattaatc acctgcaaat atgaactttg gatgaataca
35221 gtaaaagtta attaccctat ttctattttt cttatctcta tgaatttatt caaaaaaaga
35281 cattgaacca ggtcgttcaa tgtcttctct cttcttacat atttgtgtac tcgaagtaca
35341 atttctccgg ttttccatac ttattaattt catcctgata tacagcagct aattgttgtg
35401 acatctcaat actctccata taggacaatg aagtaactgc ttctattttt tctttaatgc
35461 tattaggaat aactgaataa gataatctat ccatcttact ccctaattta gtttctgtag
35521 cagcctcgta ataaatctca gtaattagaa cttcattatc aactggatcg tacatatacc
35581 ctcggttaac tgtaatcata ttatatgact cctctctcgt ttacaaatcc taatctctag
35641 tgtttttagc attgcaacaa gtaccctaat tctatataca ttctctagtt tttaattttt
35701 atattccact ctgtatctag tttactatga attagaaata tatgttacac aatcgcagac
35761 atgatatgtt tctgttaaat aaagactcat tgtttcatag taattatgag tactaatgac
35821 tcttatattc attttcttat gtcaacattt gtaaaatgat gtataatctc tcctctaaat
35881 gaaacaaaaa agcacaatag atgtactttt tttatttcgc atattattag ccccgaaggt
35941 ctatgtacaa gtgattccta acttgaaagc aacacaaaaa gggcttcttc aaatcgatta
36001 aaaatgtgca tagcaaaata agctataaat acactaatcg gctcaaagaa gccctttcta
36061 aaatgaaaca agacgtaact tgcttctaca actcaaccac aacatataaa gtgtgggaat
36121 aaacggaatc aattaaacaa taaaatatac gtttatatta aactaatttt ataatatctt
36181 caactgtttt taatgtaacg aagataagaa gggactttct atgcagctgt tatatgtatt
36241 gaagaatagt gccccttttt tccctactaa aaatcccttc ttattttcag ttcttgatgt
36301 tacttcatgt actgcagttc aaaatatagc ttttctggct tttgattttg atctagataa
36361 caaagtattt cttgaatagt ttcctttcca actgcaacac tttccatgta ggacatattt
36421 tcgttttcct ggattttttg caaaatagcg ctaggtagtt taacagcagc aaatacaccc
36481 attttacttc ctagtttttg ctcagaaaca gcatcgtaga aaatttcgtt cacaattacc
36541 tcattatcat ctggatcgta catgtaacct ctttgtatac ttagcaatgt cttactccct
36601 ttctgtatat tcttttatac aaataatata tattatttgt atatgttatt tatataagac
36661 ttatcaatta atattatttc gtaaaattcc tgctttgtat agggggcgat atttatctta
36721 atttagctaa gtatttttta tgtattttaa taagtgtctc ctttcgagtt atacttaggc
36781 ctggattttt ataatgatat tccataaaat tcatgagaaa ataaataatt gagatatttt
36841 ttatttataa aattcgattt atacaatgct attaaaatgt taagaataaa aatgggggat
36901 actatgtata taaattctgt acaggtaatt aattatggac cacttgaaaa ctttaaagtc
36961 aattttaaac caaactgctt aaatattatc gaaggctcat ttggacatgg gaaaacgcaa
37021 ttatttggcg ccttattgat accgttagta ggtgaaaaag tggtgcggaa acataaggat
37081 tcagattctc ctaatgctac tatatctatt tcaactacac acaaaaatat tacgcaaaaa
37141 aacgaattaa attatattga agacaatttc ttttataaat tcagtagtat tggccccttt
37201 aatcatgaaa accccatgga acatcaagag gatatttctt actatcatac ctttacacct
37261 ttgtttttaa gtcctgaaga aacaaaggta aatctatcta ttgatgttaa agatattgaa
37321 ttaatttcgc accttataat ggatgatact gaagctttaa aaatgtggaa tgatattgtt
37381 aatacctatc ttattaaata cttaagtgaa tgggataaaa actttataca tgtttcacat
37441 ggtctagaac aaattttaaa attaattaag gtagtttgca ttcatgctaa aaataaactt
37501 aattcaccaa ttgtaattga tggttcattt atgacattaa gtagtgatgc ctcaaaggtt
37561 attttttcaa tactatctgc ttattcaaaa agcacacaaa taatactttt tacgctatca
37621 tcactagaaa tagataatag ctatttagta gctaaacttc ctgaaaatag ggggggatta
37681 tactcatcaa tttcttatga tactcgacat aatagcagtt ctttgttaat gcctagtaaa
37741 aaatgtggag aggataagtt ggatgatgaa ggccctgtaa ttgtaagata tattaaagat
37801 tcaatattag atgcagaaga atatcgatat atggagttta aggaggttaa aggcgatcat
37861 tctataagat ctatcttaag tgttgttgat caatatgttg ttgcatattt aaatgaacgt
37921 aaaaagcaat ttcctggaac aattatctgg ggaataacgg ataaagagag aaaagtagtt
37981 ggtacaaaat taattcataa agaacgcgat gagttaagga gaagtattgt ggaacgcctt
38041 gatcaaattc agccaccaat tccacctagt tcttataaaa tagatataaa agaagtgtac
38101 gactctagtt taaaacatat agaagatact tatattgttg aggtaattgt tgatacggtt
38161 actggtaatg atttatttgc aacggctaaa aatgaagtgt atatcaaaac tgatggtggt
38221 aagaaaaagt taaaccatat ccaaattcag caagaaattt tattacgcaa tcagcataaa
38281 agatttaatc ttaagtaacc tttcatactc tgttgaagac aaactaagcc accctttaga
38341 ggaagatagc tagcatgggt ggcttagttt gttgcaaata gctttgtatt taattgctta
38401 atctctcctt ctgcaagggg ttggtaaaat gcatgctgta atccttgtat gtgcaaggtt
38461 tcacctatac ataacaatac tttaccaggg agcaggtcga gtaatagttc attattaact
38521 tgctttgatt ggttttcagt agaaacatat ataactaaga ctgtaggatt atttccaaga
38581 tctttcataa taacatctct tcctgactct acgaaatctt tccattgagc aataattcgt
38641 tttaagcgat cctttttatc tgttaataga gtggagtata caacgaaatt aaatttatga
38701 tctactccgc cttgcacagc aaaacttaaa ggaggggtaa aaaccccttt actaatagat
38761 gggtgcataa catgtcctaa aaacgatggt gcataacgca gatggcagat taaatctaga
38821 tcgtgccaat atcgtaggtg aacatattta ccatgattat caattcgttc tggtgcaaag
38881 aagaacatat ttccttgcca gtattttaat agcttataac cattatcgga taatgtatat
38941 gtttcttcaa agatctccat atcaaaactc tccacttgcc atttttcaat tagacgatag
39001 taaagtaatc cttgaagtgc atcatttatt ttcttgcgtg aatatttatc cttgaataaa
39061 tataataaat gattaaaccg aacggatgta tgaacaccaa tgaaagtaag tactgtatac
39121 tgttcttctg ttaaacgctg cttaaactta accaattcgt cataagaatg gaatacatag
39181 gttttatcca gttcatgtat tcgatatatt tgaagtcctt gtacatcctc atttgataaa
39241 tgaggaatag aagggacata agtagacaat tgtttctcta ttgtacgcat agtcatccat
39301 taaaattgga aaattgacga attagatttt ttactttgtc cctgcggata atttaggata
39361 cgcactgttc ctcttctatt tttagcgtcg atattaagca gctcacatgt aacgattgtt
39421 tgattaattg catcttctgg agtcggatta gcaagatttc ggctctttag tcctttaaac
39481 tgaatacctg gtgcaacctc aacgaaaatc ccagcgatgg catctacacc tacaatttta
39541 cctacaaagc ggtcacggcg tttgtttagt tctaatagct tgtccattgg atctgtttct
39601 aatatttttt tatttcctct aaactcatag cgcccattct tttctactac cttatcaatg
39661 ataagctcta caacatcact aataataata tcctctgagc gaacgaatga atgggaccat
39721 tgcgagtatc gtactcctac tgttacgcca tgaatttcaa ctaagaccgt ttgtgcagat
39781 gggatatgcc ctgaaacggt tcctgtgtat actttatttc cttcttgcgc tgttacttct
39841 tcatataatc ttttttgaag tgctacctcc cctgctgtga tagatacaac ggcaaagttt
39901 ccttcctcag ttttctggaa gtgttcaata ataacaggct tagttctacc cactaaccat
39961 tgaggatttt taggaatgtt tatacctgcc tctgtaattg gacaatatgc agtcgtatgt
40021 gtaccaattt gcattgtaag cacttgtata cgctcagact ttccgttttt agtcggaaat
40081 agcttttcgg atacgactgt aatcaagcct tttcctacaa tacgctcacg tttcatacga
40141 gccaattcct ctagttcatg ttcacgtact cgctcaaatt gattaaagtt tgtttctaac
40201 tgtgtgtcac cttgtgggtt ctctgattca aaaaccattc caagttcttc tacagtttga
40261 gtgtttgtct tatcttcagc cattatattt tcctcctaga acgtaaaaaa ggacacacct
40321 gtaccgttgg gatggtacgt aaggtgtgtc cttcacgtaa attatgattt atttatatag
40381 ttgttaatac aaatataatg gtatttctgc tcaaatgcaa gaataatttt taaatcaaaa
40441 gtttgctata agttagatca aaatctggaa tgcagtctta ctaggggtac tgccacatgc
40501 ccatcaactt aagaaatcaa tcacccccaa aacgaaaaaa acgagttgaa ttcacataaa
40561 taaatgtaga aaagtaaaaa tttcgtttag ggagtacttc aagaccatgg cttgatgggc
40621 atggggtcat ctccacattt atctagataa aaaagcttga ttacaatact ctctcaaaga
40681 gtttataaaa tggatcgttg cattctttcg ttcccagcga tttttataat tggacttggc
40741 ttggactctc cctctaattc taagtgcctc atgaagaatg tcagaatacc ttaaatcaaa
40801 gtccttgatc acttcttcac aggccagttc ctttgatgta atctttcctg ttttcaatgt
40861 atagtacact cgacataagg ttaatacaat gaactcaatc caaaaatcaa ataaaaacaa
40921 atagcttcgg gaagctttac tcgctatata gtgattaaga ttgtactcca tctcctgcat
40981 aacatccttc caatctatat ttgagtaata agtagaaaat ttcggaccgt aaacagcata
41041 tgaatcatga acaagctgat aaaccgcaat tttcataagc tttctttttc ccttacactt
41101 tgtaccctca aaaaacggga aagatttatg taaatgtaat tgattctgct catccaagga
41161 taagtactca cattcaaact ttttgaccaa tggacattta gctctaacct tcttatgaag
41221 gtgcgatagt tttattaact cttcgcccgt caattcccga ttaaaaactg taacaaaatc
41281 aatatcactg ctttcaggat gaaaggcacc tataacgttt gatccatata aatagacacc
41341 aagaacttga tttggaaaca tttcgttcaa cctgctacta tagagcatca ttactttctt
41401 gacttcgtta tggatcatgt ctctttaact cctttatgtt tcaattagct taactccttg
41461 ttttacaatc ccttcccata atggatattt ttcaggctca agcataatca tcgtaaatcc
41521 acttaggaaa gataaataag cccacgtttt atcgcgaagc tcttgttcgg tttcatttaa
41581 actagagcgc ttcttcaaca attcagtcat tctctctaca aactcataag tgatgaacac
41641 tgcttctttc tctagctccg gaaacctacc agattgggaa aacagatatt gtaaaattcg
41701 taggtttgat ggatcttcac gatattgcct cacgtgatgc ctcaccatct gctctaattg
41761 ttctgacagt tctaggcttt ctggtaaata cagttgtcct tttctagtct cttgaaatgc
41821 ttctttaacg gtattctcaa acaagtcctc cttgctagga aaatacagta aaatcgtagc
41881 aggattaata cctattgcct gccctatact agaaagggta gtcttagaaa aaccctctct
41941 tggaaattgc ctttttgctt cttttaatat gacatttcgc ttcactagtc gctgttgatt
42001 gttgactgtt cttgccattc ataatccctc acaatatatt aaataaataa acgtttattt
42061 atttaatata aatgaattac atatggaagt aaatactttt taacgcacag agttggtttt
42121 catctattag ggggcaccat acatgcccct caatttaaaa gatttaatac cctcaagtac
42181 aaaaaaaacg ttattctttc taaacaagct agattagaaa ggatgacgtt ttttatgaat
42241 ctctcaattc aagatgaatt acaattattt gctgaagaat tacatcaaca tcttactcct
42301 tcatttttag aaaagctggc tagagaacta gcttttgtaa aacgaaagcg taaattttca
42361 ggtcatgatt tggctgctat ttgtgtctgg ataagtcaac gagtagcgag tgattcttta
42421 gtgcggctat gtagccaact tcatgctatt acaggaactc ttatgagtcc agaagggctc
42481 aataaacgtt tcaataaaaa agctgtttgc ttgttaaaac atattttctc tgcattatta
42541 aaaaataaaa tttataaaac atcagtgatt ccaagctctt caatcgctta ttttcaacga
42601 attcgtattt tagatgcaac gatttttcaa atgccaaaac atttagcgaa tgtgtatcca
42661 ggatcaggtg gttgtgcaca aacagcgggt ataaagattc aattagaata tgatttacat
42721 agcggacagt ttttaaattt tcaagttgaa ccggggaaga ataatgataa gacctttgga
42781 acagaatgtt tagcgacatt acggcctggc gatctatgta ttcgggattt aggctattat
42841 tcactggacg atttagatca aatggaccaa cgaggcgtgt attatatatc gcggcttaaa
42901 ctaaataata tggtgtatat caaaaatgag tttcctgaat actttcgaaa tgggacagta
42961 aaaaaacagt ctcagtacat caaagttgat ttagaacaca ttatgaatac cttagaacca
43021 ggacaggtct atgaaataac agatgcttat attggaaagg ataaaaaact atttacacga
43081 gttattatat atcgattaac tgaaaaacaa cttcgagaac gtaagaaaaa acaagtgtat
43141 acggaaagta aaaagggtat tacgtactca gagaaaagca aacgattggc tggtatgaac
43201 atttatgtta ccaatacacc tttggaatgg gttccgatgg aacaaataca tgatttttat
43261 tccctccgct ggcaaattga aattatcttt aaaacttgga aatccttatt tcaaattcat
43321 aattggcaca atatcaaacg agagcgatta gaatgccaca tttatggaaa actcatcgct
43381 atttttctat gttcttctac tatgtttaag atgagacaat taattttaca aaagaagtaa
43441 agagaattaa gcgaatataa agccattgga atgattcaag accatttata cagtctttat
43501 caagctatac agcaaaacac ccgaagaata acaaagattt taatccgcct gttccatctt
43561 ctacagaaga atggacggaa atctcacaga tatgagaaga agacagtctt tgatattatg
43621 ggtgttgtct atgagtataa tggattgaga aaacaaaaga aaattgcata attaaaaaag
43681 taaaacccgt tagggtttat ttggtatgcg catttttaag aatatacttc tattttcaga
43741 atgttttaac cctcctgaac aagagttcag tttgtttaca ctcttaagtt gatgggcatg
43801 tggcggtacc cctataatga gttgaaatca aagaataaag tatagccccc tattttttat
43861 tagttatata agtttggctt gatgagcatg ggatgttacc ccaataagag cagtaaaatc
43921 aacaaccggt aaactaatca ttgtacaacg aaaaaacgaa gtttgcttgt tacaaacttc
43981 gtttttgttt atataatagc actttttaac tacttattcg ctcatatact cagcacttac
44041 agcgatacca gatactcctg tccataatgt ctccgccaca acagatacaa ataattttac
44101 atttagaaga ctagataaat ttttcataga catctctccc gtcggtaatt ttaagctgat
44161 agttcttaat acaaatgcca acaggagtaa gcacattgct actggtttag atggggctgt
44221 agttgcacct gtaagtgctc aatatacgaa ttacttaaca ataatcatat cataaaaatt
44281 cagaaaacta aacctagaga gtcaattttg ggtaaatatc acatggttag cttttttgac
44341 aaaataaaaa tgtctaaaac aaaccaacga gaaaatgttt gttttagaca tctttccttt
44401 aatctcgatc gggctgttac ccccatcaca agacgacctt tcggaagggt ctttcgtctg
44461 tatataaata taccatttgc tattttttaa gtcaattttt ttagctgttt ttttgggtta
44521 tattttaaca gctatatcta ataatcaaac gtccaaataa caataaaact tcacctagtt
44581 ttttagattc tgtatataga tgcttctctc tctttgctct tcgaaaaaca gatttcattt
44641 ctttctttcg ttctttacgt gttctagaac ctttcacata attatcatgt agatataata
44701 aagcgcatag atcatgtact ttaatatttg tcatatatgg tttcaccaac ggtataggta
44761 gacccacatc agaaatatat tgtcttagtt tcggttttgg attactacgt cctttaaatt
44821 gccctggttc tacaatattt aaaagaattg gtctactatg tgctgctgaa tcacgtatat
44881 ttttcgaaaa gtgcatcaca tcacttgcat gttttaaatc attacgccca aacttccctt
44941 tttcaacata aaacttaata aaactggata attgaccata agacattagc tctatcaaaa
45001 cccatatatt cgggttcttt tgatatttct catataaatc cctatgatat ccttttttat
45061 tttcagagtc cttcaaaatt ttatccgaaa catgaacaaa gtttccttta tccgcaatct
45121 tatttaactg atagctatta tattcttcaa taatagaata tccatcttca tcactattag
45181 taattagatt cattaacttg gtttttatag aatgctctat atccaatgat agttttatca
45241 gcaaatatct taaatgcata tctataactg ctaaatcagt taaattggcg aagtccaaat
45301 tttgatattt ctgggcctta tttttagaga aattctttct atatgcggta agtttataat
45361 aatacgaatt ctctataaga tagttcttcg catcagattc atttatgtag ttaaaagtta
45421 cacctttgaa actcaaatag tctatttgtt cttcaattgt catcttttct ttatttctag
45481 ctttttttat caattcatat tcaggttgat ctttaaatgg atttaattca ttttgttgca
45541 attcctcttt tttatcctct ttaaatgtct tcaaccgttg taaatcttct agtttaatac
45601 tacacataaa atatttctcc taactttaaa atatatttat atccgaatct ctttttatat
45661 ttaatataca tatataacat ttctagtgaa taaacaaata aaccaattac accatatata
45721 gttttttctc tatatctata ataacctccc tcacgattaa gagacaatac tgtccaacat
45781 atatagaaag aaaataaaag ggcattatgc ataatgatag aatttagata gagcaaatta
45841 aataactcta attgaaaatc ttcatacaaa agaaatttaa agattttatt tacaaatata
45901 tctaaatcaa aggaagaaac taaaaaagtt caaatccccc aaaaaacggc ttcttatttc
45961 cttctctaac gaaatttaaa ggaacaataa atacaattac atcaaaaggg tctatccttc
46021 tttattcaag agaatagacc tttttaatcc gattacataa atttatgtgt ttttagctaa
46081 ttaataaaat aagcttcctt ctttattttt aaagtttact gagtaagctt cagaatatgt
46141 aacatttgtt ctcttaaggg gtaccgccac acatccatca acttaagcat ttaggctatt
46201 tttaaagcta aaagcacgtt gctatttcct tattgttgac gaataataaa agtaagaata
46261 ttcagatgtt attataatta agaaaagttt tatacaaaaa atactattgt ggggtgtaga
46321 gtaaaatgct aattagagat tatcaaaatg atgatgagca agggtggcta cgttgtcgtg
46381 tactagcttt tttaaatacg gcttactatg acaatgtttt aaataaaaaa gaagtatata
46441 aaaatccatc aattgaactt gttgctgaaa tagatggaaa aattgttggt ttaatagatg
46501 tagaatacga aaaaaaagag aagaccgttt gctcaagagg gactggactt ggaggaatga
46561 tttggcatat agcggttcat ccggattatg ctcgtcaagg gataggagaa agtttattga
46621 aggctgctga aaaacgagca attgatctca atcttaaccg atttgaagca tggactcgcg
46681 atgatggttg ggttcgaagt tggtatgaaa aaatgggctt caggctaacc gagtcatatt
46741 atcatttata ttttgaagga aatgaaatga acaatagaat ttcaagcaat attcctaatt
46801 tgtatcctgt tttcacattt gggcattacg atggcgagga gacagaacaa tttaaagaat
46861 taactcgtag acatcagtgt gtttgttatg aaaaatactt tgagtaatat aggtagttta
46921 cttttattat ttgagtaaat aacaggtttg tcataactat ccaactttta aataactttg
46981 ataccctcct atcatctgtt tgatgggagg gtatcatgtt tttaaaggta aattcaaata
47041 atttcatgat atttttacac ttaggttaat gagaaagggt gagatatttt ttatgaatat
47101 gaaccaaaaa aaagaattat ctttattggc cgaagagtta tatcgatata tgtctcccgc
47161 taaacttaat caattagcta tagaagcagg cgggatgaaa cgaaagcgta agtgccacgg
47221 gcaccatttc ttatctttgt gtgtatggct aaatcaacaa gtcgctacta cctctcttac
47281 ccaactatgt agtcaattag aaacttcaac aggagtttta ttaagtccgg aaggacttaa
47341 tcggcgattc aattcggctt ctgtagcctt ttttcgtact gtatttacta cacttctaca
47401 ggctaagatt ggaggcgtat ctaagatttc tcattctctt tcttcctact ttgagcgcat
47461 tcgcatcctt gattctacaa cttttcaagt tccagatcga ttcgcagcta tgtatcctgg
47521 tgccggagga tgtagtcata aagctggtgt gaaaattcaa ctagagtatg acttgttgag
47581 tggagagttt tctgatgtga aaattgaacc aggaaaacga agtgatcagg cgtatggtgc
47641 gactcgaaca gacatgatac aaaagaatga gctgtatatc cgtgacttag gatattttcg
47701 tctacaagac tttaagtcta ttcaagataa gcaaggatac tatttatctc gccttaagtt
47761 accaactaaa atatatagaa aagaatgcga aacagtggta tttaaaacaa aacccgctca
47821 attaagagcg gtatatatac aaattcattt ggaagacatc atgaaacaat tacaacctgg
47881 ccaagtatat gaattacatg atgtgtatgt agggagtaaa gacaaactgc ctactcgtat
47941 tgtggtttat agatgtaccg aggaacaaaa acagaaacgc ctacatgatc gagcgattcg
48001 agaaaagaaa aaggggatta catatacaga gcgtacgaaa cttttacaag gaattacggt
48061 atatatgaca aacattccta cggaatgggt accaaaagag aaaatctatg atttatattc
48121 actacgctgg caaattgagc tgttgtttaa aatatggaaa tcttggtttc aaattcatcg
48181 ttgtaaatct attaaacaag agcgcttaga atgtcacctt tatggacaac tcattagtat
48241 cctattatgc tcttctacta tgtttaaaat gagagaactc ctgctacgta agaaacagaa
48301 agagctaagt gaatataaag cgatgtacat aattaaagat tattttttac tttttcacca
48361 agcattacac aaaaacaccc aagagctatc aaaagttctt cttcgtctgt ttaacctcct
48421 acagtacaac ggacgaaaat ctcatcgata cgagaaaaag acagtttttg atattttggg
48481 tgttgtttat gagtatgcca cttctactca taaagtagca tagtaaaaaa aatgaaatcc
48541 gtcagggttt atttgatatg cctactttta taacatctat aaaagataat aaaaaaacta
48601 aatggaaaga tcgcattttg taaaaaaata tactttaagt tgatggatgt ggggtaccgc
48661 cacatgccca tcaacttaag aatgtaaaac ttcgccttca ttcagcccga ttaaaacatt
48721 ctcaaaatag aagtatattc ttaaaaaata cgcataccaa ataaacccta atgggtttca
48781 cttttttgat tatgcaattt tcttttgttt ccttagtcca ttatactcat aggcaacacc
48841 cataatatca aagatagttt tcttctcata tctgtgagat ttttgtccat tcttctgtag
48901 aagatggaac aggcgaatta aaatctttgt tattcttcgg gtgttttgct gtatagcttg
48961 ataaagaatg tatagatggt cttgaatcat tccaatggcc ttatattcgc ttaattctct
49021 tttcttcttt tttaaaatta attgtcgcat cttaaacatt gtagaagaac atagaaaaat
49081 agcaatgagt tttccgtaaa tgtggcattc taatcgctct cgtttgatat tgtgccaatt
49141 atgaatttga aataaggatt tccaagtttt aaagataatt tcaatttgcc agcggaggga
49201 ataaaaatca tgtatttgtt ccatcggaac ccattccaaa ggtgtattgg taacataaat
49261 gttcatacca gccaatcgtt tgcttttctc tgagtacgta ataccctttt tactttccgt
49321 atacacttgt tttttcttac gttctcgaag ttgtttttca gttaatcgat atataataac
49381 tcgtgtaaat agttttttat cctttccaat ataagcatct gttatttcat agacctgtcc
49441 tggttctaag gtattcataa tgtgttctaa atcaactttg atgtactgag actgtttttt
49501 tactgtccca tttcgaaagt attcaggaaa ctcatttttg atatacacca tattatttag
49561 tttaagccgc gatatataat acacgcctcg ttggtccatt tgatctaaat cgtccagtga
49621 ataatagcct aaatcccgaa tacatagatc gccaggccgt aatgtcgcta aacattctgt
49681 tccaaaggtc ttatcattat tcttccccgg ttcaacttga aaatttaaaa actgtccgct
49741 atgtaaatca tattctaatt gaatctttat acccgctgtt tgtgcacaac cacctgatcc
49801 tggatacaca ttcgctaaat gttttggcat ttgaaaaatc gttgcatcta aaatacgaat
49861 tcgttgaaaa taagcgattg aagagcttgg aatcactgat gttttataaa ttttattttt
49921 taataatgca gagaaaatat gttttaacaa gcaaacagct tttttattga aacgtttatt
49981 gagcccttct ggactcataa gagttcctgt aatagcatga agttgactac acagtcgaac
50041 taaagaatca ctcgcgacat gttgactaat ccagaaacag ataatagcta aatcatttcc
50101 tgaaaattta cgcttccgtt ttacaaaaat tagttcttta gccagattct ctaaaaatga
50161 gggagtaaga tgttgatata actcttcagc aaataattgt agttcacttt gaatcgaaag
50221 attcataaaa aacgccaccc tttctgtata tttctacaaa aagaatagcg tttttagggt
50281 cgaattaata tgagattata ttggtttaat aaaatccttt atagagttta atctttgggg
50341 aaacgtatta taatttataa ggattatttt tcgttaaatt tttcaattcg ttttcaaggg
50401 aaagcttaag gtttttcttt ttcttttcaa tggatgtgat cttatgaaaa gttaacaaag
50461 ataacataga gaataattta taatatatct ctgtagatcc gttcttattg tttaaaataa
50521 tttgctccat agtatagaat ctcctttttt aacacagtcc tatttctaat ttcaatactt
50581 gcttattatt ttaccaattt ttattgaaat cttctacttt actaattatt atttcttgat
50641 aatttatatt ctaattctat atttaccttt aaaagtgcaa ttttttcatt tgggggatac
50701 ttcaaaatat taagttgatg ggcatggggt actgccagca tttcggaaaa cccctaagct
50761 aagagtatac aagattttat acagtttttc ggcaaatcca gtaacaaaca agaaccctaa
50821 aaccgcgcta gaataggaat gtataaaaaa atttatagct ccatagaaca aaaaagaagg
50881 ttcccttgtg agagtagggt tccctccttt ttctttgcta ccgataatga tgcgttatgt
50941 taacttaacc tgtataggat attcattacc ccaaagtaat taaaatatgc tttgggtttt
51001 gtattttcca agataaggtg taaatatatc tttacattta tactgttttt atataatcta
51061 ttagtaaaga tatctttaca ttgcaggtga aatgatgact gtaaaaaata aaattaagga
51121 actacgagta caacatgaaa ttacacaagt acagatggca aaggacttac aagttacaag
51181 acaaacgatt gtagccattg aaaacaatca ctataatcca agtttagaat tagcattgaa
51241 aatagctcat tactttaatc taaaaatgga ggacattttt acacttgaat aatcttgaaa
51301 taaaggagta aaagaataat gtggatacaa aagcaagacg aaatggaaaa acatcatgta
51361 gcaaaagcca gtaaaaatgg gttcatggtc tatactgttt tattactcat ttggtcgtta
51421 tacgataact ttagaaatgg tcatttagga aatgcttttt tgattttatc aatagggaat
51481 gcagtgtatt tttggacact cgttgtacaa aaaagaaaaa tagaacgctt tgaagaaaca
51541 gatgactctg atacaacaat aaaatttgta aaaagaaaca aacattttat tatatgggta
51601 gttatcttaa ttgttataac tgttattgga ttacttacaa agtaaaagga aaaagtaact
51661 tctgagaata ggacgttatg ttaaccaacc atgaatatta tatacatcca aaaatccaaa
51721 caaactgtta tccttgaatg gtacaattaa aaaaaggggg agaaaaaatg aattggttaa
51781 tgttaaagga ttcaaaaacc atgtcgggtt tcgtacttgc aatattacta tcaatactat
51841 cagttgtttt agctgtaaaa ggaagcgact attggttagt acttattgtt cttacaagtg
51901 ttctgacgtt ccttagcgta aatagagcag acaagattta caaagcaaga ggttaaaaca
51961 gtaaccttct caaaagaaga agtttttccg ataacttcca ataacgataa ttatgtaaat
52021 aagctgtcca tctgaacagc ttattttttt tgcttagcgt ggtttttttc cgaaatgctg
52081 gcaaatactc ttactagatt taatttgagg cttaccaact attaatcaaa gaaattgttc
52141 aattctttac tcattacgtt cgatgttttt tgcttaggtt tctcaatatt attaaccagc
52201 gactgcgatt tgttattttt atttttttgc tgatatttta agtgctcctg gcgttctttg
52261 taactcatag gtttatattc tggttgcttc acatcatttt tcaaatgatc ttctctattt
52321 ttttctaagt tttcttgaac cgtaatacta atagattcgt acacttttgc tacatcttca
52381 tctagcttgt tttcttcggt atgattaagc gtttcttcaa tgggaatcgt gttgatttct
52441 acatgtgttt cttccggctc tgttattgta acgggaattg aagtagattc tatacttgtt
52501 tctgcagttc ctatcattgt aacgggaagt ccatcagatg ggaattcttc aaacagtggt
52561 tcagtctcat caggaatcct ggaatgaatg atggaatccg tattccaatc ttgctttagc
52621 atagtaatag acaattcttt gtttagttcg gatacctcca tgtttatttc atggcattca
52681 tccattaggg gtgattctat atctatgact tcctctatta cttcgtttat gactggttca
52741 gttattgcag tgcttacact ttctatatgt gtttcctctt gtacggttcc tttgtcttcg
52801 cttggaatcg ccacttcctg tgaaatagta ttgtcagatg aatgagtagt attaatactt
52861 gtttcttctg ttattctact attatttgaa attaatactt tacgattact atcccctgtg
52921 taagaactta caactagatt ttgttctaac ttctcaatat attgcatagc tttcatatag
52981 ccaatcctga attttctttg cagaagagat ggcgagactt gttgtgattc aataataaat
53041 tccttaatat cttcatacaa cttattttca gcttcatcat caacatctcc ctgctgattc
53101 atagttgcag gttcattaga taaggtttca ttatgagact tgtgttcctt ataatcttcc
53161 aatgatacaa tgtgctgttg ctcttcagtt gtttctacag agctattttg tttcatctca
53221 tcctcttgta taggcggcaa agtttgaact tttttcatgt tctctgcgtc tacatgcttc
53281 ataggatttg cttttgcaat agattcatta ataaggcgaa gacgttcatt ttcccaatat
53341 cgtcctatct cttcatctac ccgtgtaata gcttgagaaa attcttcttt tggtacaaag
53401 ttactcgtaa tttgttggac aggttgcaca tggttgtctt gtacgatacg agcagcacag
53461 ataaatgcac cttgtgccat gatatcccct ggtgacataa caacttcttt tgtttttttg
53521 taggttgatc ctagtcgact aacaggatta tcttgcatag gagaaatacc ctgttcggat
53581 tccgcctctt taaattcttc tttttcaccg aacatgtcag agaaaatttt tgcatcatat
53641 ggcgttacat ctccaaatat cattttgtta cggaatgaac ctagtaaagt aaacatgtat
53701 tgttctgtaa agtcgagagc taattgagat agcgtttggc tagcaattgt taaaattact
53761 ttatatttac gggattgtgc agggaattct ttaaacggct tcaccacata atctgggaac
53821 tcatcgacta ttatgtggtg gtaaggtgag acgtttggtt ctctccggaa taccgcattc
53881 tgcatactta gcaatacaaa ttttcctaat acgtttgaaa ggtcggctaa ttcccctttc
53941 gcagtattta caagtaaaat gccaccttgc tccaaatgga catcgaaatc aaaatcggat
54001 ttaccaaata aaacacgtcg tattaaaacg tttgaagcta aatcttttaa gatattgcgt
54061 aaacctttta catattcttc ttctctgtca taatgcatcg gttgtccgcg gtattttcca
54121 gatttataaa ctgctggttc accttgaaaa tccatctttt cacgaatcgt attattaaac
54181 cactcttcaa ttccttttat aatcttatat tcgttttttt ggtcacgtga agcagctccg
54241 gtttgaacaa aatcatatag cttttcgacc tgtattttta atagtttgtg catacggtga
54301 acacgttcta catcatcata catctcaatt aagtcgtcga aggtaacatc tttttgcggg
54361 ttgtgaagct ttaataaata gatatgttgt ttaaggtggt tacgctgggc ttgttcaaag
54421 aacgcattgt tagattcaga taaaccttga ataaccattg cgaaaacctc tgctacttta
54481 tctaccggtc cacgcagaat gtttatattt ttggtatcgg gattggttgg gtcaatgtag
54541 taaaccgagc ttgctgggat cttatgtgct tgtaccaatt taaatacttt ttgacataaa
54601 tcattactcg gttcaataac agtcacacca tttaaaaatg ttccttttac ttcttctgta
54661 tcataatcat tctttttata ggctgtttca aacttattta taaaacgtac catccagtgt
54721 aaatcttgat ttatcatagg aataattaag cttgatgttt taccagaacc gattggacca
54781 ataatgattc catttagcgt tctatctttc cccttaatac gaaccatctc tttatgctca
54841 atatgcggtc caatttctac gtcagggtat atttgttctt cttggctatt aaaccatttt
54901 tgtaacttgt gatttttata ttcgtatttt tgtacccact ttaatatttc ttctcggtaa
54961 cgaacaatat gaccactata ccaaagtgta aataaaatca taaatactgt aggtaaaaag
55021 acaaaaatca tagtgagtgt gtgaaaattc cctgttaaaa catgacctat ggcctcatac
55081 tcaccaaaat taacatgttt tgatttatcc gtaagatacg ggataacctt tgcatggatt
55141 ggagcagttg caaaccataa aaattgaata tcaactgcaa tatgagagac aatcaaaatt
55201 attaatttcc cattttttac atgcaaagca ggaatacggc tataaaacct aaagctaaat
55261 tctcctaata gcaaagagaa gaacatcaaa ataagcggta catatgtaat ttctatagga
55321 taagaaggtg gttcaaatgc atagtagagt aacttgatgt agtttactaa accgaatccg
55381 aatgaaagaa taaatccact aattaaggtg attgtagtaa ataacggtaa tcgttgttta
55441 aatgtctcca tataggctca cctacctctt acagatataa ttgagcttta tgatggaatg
55501 tgaagcgatt attgaattct ggttgaaata gtccctttga tttttctaaa aagaatttcg
55561 ctgcgtcttc agtttgtttt aaatataaat caatactatc tctttcacag agctggttat
55621 attcttcctg agaaagtacc gcaatattta cttctatctt tttatttgtt gctgtctcaa
55681 tgattacatc ataccaatag taattcagtt tacctgggat ttggatatct tgtagagaaa
55741 cactaaatgt tgccccctct tctgtcatat gttttaggac aagttctgga tttgtaaatg
55801 cttctcttgc agagagcact cccccattcg ttgttgatgc aaattgtaaa ttcattatcg
55861 ttttccacct ttctccatat aaaaaaaggc aagcgacacc cactgtaaaa acagcgtgtg
55921 tcgcttgcct taatttcata tgttctgatt tgattgtagt tttaattata tgttcaatcg
55981 ctattctaac accttaaaaa ataaaaatca ataaaattgc atagaagtat ataaaaaaca
56041 atagattaat ataattctac aagtttacgt cttttcgggt gtatgttatt tgcggtacgt
56101 accacaatct gttcatctgc gtctatagtg acatcttcat ttttgaggga taacagtagt
56161 acattgtcat aagtgtccat taaaagtata tctctagcct ttttgcgctt tggatagatc
56221 acaacaagtg gcaccccctc atcaccttct cttcttgaaa atacaacatc gtctaatcta
56281 gcaatcattc ggtaatcatt ttcattgcca aaaataaaga agaaatcttg catagcgtct
56341 ttatctcttc tatacgtgcg tctaagacca ccatctatta tttctttaaa ggtttgaact
56401 ttttcaacaa atgcgtaacg ccagtctgca tcgcctactg tacgttgaga taaaggtaaa
56461 aggatatctt gttcaaagtt ttgattatca tctatttcta gaatgatatc tgaaataaca
56521 tctccagctt ctttcaaaga gcagatatac atatttagat ttggttgatt cattaaaagt
56581 tcatgatgct ctcgcataga aaataagaga tttttcatgc gtacgtatgg tggttctgca
56641 tcttctacaa ggaacatcga cttgtcatac ataacaaaaa caacagttat attcttagtg
56701 tttttttgtg catattcaat atacttcccc accttttcaa ctaaggtagc attggtttct
56761 ttgcacatat ccatttcaat gtaaatattt ttatctagat atgaaatgtg ttcatcagga
56821 attaagagta aacctgcatc ttcaatttct gttttctttt gtttttgatg atatgagcga
56881 atatctagtt cacttaatat cttattcgta ttggtctttt tcgaggtttc taaaagtgtg
56941 cgtactaata tttctcgtga gcagagtgta tgcagtgaga ttgaagaaga atatctacgt
57001 tttgaagaac ctttaggaat tcgtcctatt tcttgaaggt aatcaaccat tctatctttt
57061 aaggagaatg tcgcgcgtct ggttatacta tcatctcttt tatcaatttt tttagttagg
57121 atagcaccat attttgaaaa acgattaagt tttgtaaaca cactatcctc agaaaaatcc
57181 ctaccttcaa atgcactata aagctgagta atttgtcgtg tagtaagatg ccttttgtaa
57241 tataaaaatg tgaatacaaa tatatcagcc tcttttaaac gaaaagattt ctgtgtgcct
57301 ttacttgtat atttatacgt tttacttttc attatatgca actccataat tcgaatttat
57361 tttcaataaa taacaaccat ttctatatat cttattacag tgaaatttcg ttgtaaatta
57421 ttaaaaattc taactgaatt tgcgctatcc tagatactaa aactcgtacg ctgaagtttg
57481 gatcatttct cttcttaata atttgctaaa aacattgatt tatatagtct tttggtactt
57541 ctaaaattgt tcggacggaa gacatatttt aaccgaacaa ttttttaagg attaggtatt
57601 ggaattaaat tgttcggaca gcctaacaat ttattgaaac aattacatta tataaaactg
57661 tgttaaacat gcagaaaata taatagatat cttatttgtt cattgtggtt ttttattgct
57721 attgaaatag aaaaagaccg acaaaaatta tatttgtcgg tcttttgttt agaatgataa
57781 tttcttcttt gttggttgtg aatcgtcagc aacttctact tcaggttcag caccaaaatt
57841 taattttttc tttttaggct tttcttcttg tactgaatca tcgaatgcaa aaagcttatt
57901 taaaacagca tttgatttct tagaattagc ttgctcacgt tcttctttaa ttctcgtaat
57961 ctcatcaata atatcactca cacgttttgg caatggtagt cccgcaacaa ctgaatagaa
58021 ttttactata tcctcttctt ttttcgctgt atgtttatta acatatggag ctataggacg
58081 ttcatctaca tatggagttc tatcttttaa gaagttttcc atttggttaa ggaaagagaa
58141 gttatataat cgactcgctc gtagcggtga tgtaacgata gaaagtgcgc tctttttagc
58201 actttctagc tcttctcttt ctgtatcata taaaacacct ttttctagtg cgttccctaa
58261 ttgagtcaag taacctagtg ggttttcagt gtctaattga tttgatttta gttctagttt
58321 tgctaatgat aaaacgcctg gtgtattaat tacttgagca aattcactcg catcaaaatg
58381 tgtatctgaa aacggtgtaa atgatgaagt aactagatta atctcatgta atgcatcagc
58441 aatatatttg ttactatagc tagtatattc gtttgctaaa gcacttggat tttcctcttc
58501 aaattttcta tatagtttag cgttatctat taatacaata gaaccaaaag cttcttggtt
58561 catagcaata ctacgaatgc gtgaagttgc gttttctaat acttttaaag cctctgcatc
58621 acgtggtaaa gtcagcaata atccaaaatt gtaatcatgt tcatatagca tttcaattgc
58681 ctttaataga gctccagttc ctgttcctcc accaagacca caagtaatcc aaatgaaatc
58741 acgatcttca aattcctgct taaccgtttc gaaaatcttg gtttcatgct ttacaaatgc
58801 ttcctcacca acctgtggat tacgagctgc accctgctca tatccttcta actgtatttt
58861 acgtacattt cccgcgtttt taatctcaat cttgttaaaa tcttgactat ttgtattaac
58921 aagaatcgca cgatatggat atttgttatt tttaatttga gtttctttat ttgcacactc
58981 tgctgcgatt gcgcatccac ccatacctag tcctaagaat ccaaatttca aactaatatt
59041 tccttggctt tcgatttcag aaaaattgcc tgccatatgt atagcctccc tcaaatatat
59101 attttagttg tttttctcaa ctcgtttttc tagttcttta attaaaacat tacctagatt
59161 tgttacttcg taaactcgaa cgcgtccaaa tggtttaaaa gatatcagcc ctgctccctc
59221 aagtcgtgca gtcataatat ccaaagcata tcgcgaagga agtatctttt ttccttcata
59281 atccttttca ttctcaattt gatattcttt atgatattgg ttgatacaat cccatagctt
59341 ttctttgtgc attgcacctt cagcgtatag tacacgtaga gcccaaattc cttcattcaa
59401 attctcacag agtacatcaa taatttcatt gttactcatt gatatattag acactaattt
59461 cacaccacct ttaatgaaaa ataaaattta tgcatagtta caagaaagtt tacttaatat
59521 tacggaattc aatcccgcta tatatgccgt aaatacttcg gaatatactt ccgaagtatc
59581 gtatgtatta actataatac atctatacta attaatcaag aatcttttaa tatcaaggtt
59641 tttaatactt acgaaatata acccgtaata acaaccgtat taattacggg ttattattac
59701 gtacttattc cgacaattat taccgctgtt tttatctaat aactatcagg tgcaactgta
59761 attatgtgaa attctttttt ataggagttg atttatttac ggtttactga gctgttttct
59821 tatatattga ggtgttacgc acgctcatcc gactaatcac cgcttaacaa catgggcaat
59881 tttgatacaa aacttataga ttgagcaatg attggttgag taatcagata caaaaataca
59941 caaaaattca cgtaatccgc aaaggtatcc ttttagtttc tatagaattt ctatataatg
60001 tattatagga caggcatcat atagttaggt ggtgagcaaa tgattgatga gcagttaagc
60061 gatggttatt atcgtgtatc tgaagtagca accatgcttg atatacctga aagtactctt
60121 cgaagatggt tgaatgattt tgatgagtac ttgaacataa aaaaagaacg acaacttaaa
60181 tatgttcacg aggatagtat cgatacagta aaaaaaataa aacattatta ttcagagtca
60241 aagaaaaagc acgaaatagt agtgctttta gatatggatc cggctgttat tcgtaacgtt
60301 tatgctgaag agattgatga cgatgatgag caaaaggaaa catcgctagt taaagcacaa
60361 cagatgaata caaatttaat agaggcttta acagaaaaga ttactgaaga agttacagcc
60421 aaagtgacgg ctgaattaac aaaacaaaat atggaattct tcgctgctgt agccaagcaa
60481 agtcaggaca atttcgatag aattaataaa cgtctagagg aacgtgacga aaaactaatg
60541 agcactatac gattaattca ggaacaaaaa agtgcaaatg ctcagagaca agaaaatact
60601 gaacaaaaag gcggattctt ctctaagctt ttcgggaaaa aataaaagag actatcattt
60661 tgatagtctc ttttattttc taaatcctta ggacacttaa tatctttatt gaggtaaaac
60721 tcattaatag gtatcgtgat taattcaaag ttactatgtt atcatttcaa ttttgtatag
60781 tataatgtga attctttata tatagagtta aaatatattt acaggagttg atacatatgt
60841 ggaataagat taataattat aaatatcact taaaagattt aaaatttatg acttggctat
60901 ttcccgttat tggtttgtta tatgcttatg aattcttctc tggcataatg ttcggccaag
60961 agtttcgttg gctcaaatta ttatgcacga tcataatgat tctaggattt atggatatta
61021 gaaagaaact tagaaacaag gactatagaa caacgttatg ctaaaggaat ccttataggt
61081 tcctttttat tttttccaat ctttgaaatc ggcatacttc atatattctt ttttaatgac
61141 tcctttatgc catctactct tactttcagg tctagtaggt ttattgttat attcattaat
61201 atctccgtct acactgagcc attgaggatt ctcataagca tatttgtaga tgaattgaat
61261 tctcctaaat gcaactttgg tttagcagtt ctatatccat atacaaaata agttgtatca
61321 cgtttcccta aagtttcaaa aaatggtttt gctaccaaat cattttttct cattcaaaca
61381 tcccttttat aataactata ggtttattat aaaaattaag cactattagt ttattattct
61441 gttaatcaat ttgcattaat tcttagaaca ataacctaat aatcatgttt ttcactataa
61501 ctgtatagtt cgctttttgt ttgaaaattg attttgctgc taaaaatcct acaatcacct
61561 ctcaaccgcc caatcactgg ttacccatct ttagaaatac gaactaaaat catacagctg
61621 actggtgatt aattgactga gcaagactag attgaatata acaaaaccaa ccactcaatc
61681 accactcaat ttatatgagt gattgcaact taaatatatt aactgaccgg tgattaggtg
61741 agtgcgatga atgtgattgg tttcttgttc gtaaggggtt ggttattgat tgagaggcga
61801 tcatgtgggt gattaataca cagtttttcg ttcgtattaa gttcagcacg tttatatttt
61861 aaaaaaatca gcttgcaacc atgaaaaaaa ctatttatga tgtagatact ttaataattt
61921 tatattcttc tagatataaa ttaattaata attaaatgtt tatataacat aaaaataaaa
61981 tataataaag caaaaaaagg ttcctcagcc caatgaaata gcgccaacta cttcattgtg
62041 gttcaccgca caaaaatccc aaaagaaatg tgtcaaggac tgcggtaaac aaagccaata
62101 aacctttttt aattgcatga aattataaga tgattttact gtatcttatg tatttgtgca
62161 acttaaaaag gggatttctt gcgtaatttt aggcattgtt taccgttgtt atacaagtat
62221 tacttttttt aagagagtag tatttttgta tccgtggtat gacagtgcct ttttctgctc
62281 tttcgaaagg agttagcaac attatgcata cgcaaatggc tttttcccaa cagaacttta
62341 aagttcatgg ggttaaattt tttgatggac tattaaacat cgtaaaacta gaaaatgaaa
62401 gaaaagagtt accatcttca gctttagcta cttacatctt gcttcacttt gaatgcaatg
62461 atataggaat gctaccacgt gaatttcaaa taatggatct tgctaaggaa agtgggattc
62521 cctacacaac aatttataca gggtttcaaa tttgtttgga gcgtagactc ataaaagaaa
62581 cacctgtcgg aaatcgtact gtatatgaaa ttgtagatta tgcgttgtat aaccacacta
62641 ctgcagaaac tgtaaacatg acaggtatat cgctatcgta tttccgtatt ccatttcacc
62701 taattcaaac agcgataatg agtagtctag taaaggctcg tgataataga gggattatgt
62761 ttcttctaga tttaatcaac actttttcca gaaaagtagg tatggaacat cataaacata
62821 aaattgagga gttccagatc acaagaagaa tggctttctt gaaagaaaga ttaaagcgta
62881 atgcaaaaaa agtaagacaa tatatagaaa ttataaaacc aattgtgcaa tttactgcaa
62941 ttgattctaa agagaaaaat tctaatgaaa cacgaattac aagtataaga aaacaggtaa
63001 aacaaatcat cattaagaag tttagtgtgg ttttttcttc aaactgcgta atagagaatg
63061 atagaaaaga attacataaa ccagtagcaa agtgcagaaa agaagcggtg tctcgcttaa
63121 agcatatggg gcaatcatta cgaaaaaaag ataaagaaaa tattatgact gcatttagac
63181 aagaaattgt tgattatgca atctatttac caacaaatca aaaacaaaat gaattactaa
63241 tttacgcaat gacttatgca ttagataaag ttgaaggttg tacgaaagag caagaaatat
63301 tttctatacc agcatttatg cgtgtacagt ttagggaatc atggatgtat tttaaggaaa
63361 aaagcttgtc cgtagaagaa agacacgatg caatgataaa ttatcataag aaaaatggtg
63421 tttatccgga ctttatgtga ttttttaaaa aataaatgca gcagcccttg ttaaaaaatc
63481 acgtaaaagc aagggttatt tggcatgttc tttactttga agacatgctt ttttatttag
63541 gaaaatgtat ctacgagcat ttttacgtaa gtatataagc tgcctatgct atgtttggat
63601 acgattcagt ttgtctataa ttcgattcaa tacttgtggt tatcttaata atattatttt
63661 aaacttgtga atcctgagta atacggtatt taacttctta atttgtgatt tctatgatgt
63721 agaacttgta tgtattgggg atattacgat aggtatttta gtttactagc aaggaacgta
63781 tgtaatacaa ggctttagag gtatttgctg catctcttta taattaataa ttgagtttag
63841 ttatatatat ttcttgttgt ttgtatataa aatacttgtg attatttata tttaattact
63901 tgtatttttt tagattaaat acatagaaaa atagaaaaaa ggaataaata taaggtccca
63961 aggatctaat taatctattg acttttaaaa ttcatagagg tattcttata cgtgagcaac
64021 aattaattaa gagaaatata caaattaata gatttaattt ctagctaaac ggacacaccg
64081 aaggcacata acctgccatc ggtgtgtctt ttttttgtat aaataacaag aaaagggaga
64141 atttgaaact atgaacgaaa ttgtgaacat gagtaaggaa cgatttaaaa agtattgtga
64201 ggacaatgca gcatttgagg agaatattaa tcgtattatt aatcactact ttttattact
64261 agggaataaa gcaaaaatct tacaagaaag agagtttaat aatgagattg aggaaaaaac
64321 gtttaaaaat aatgtgaagc gttttgaaac tctattccct gcagccgtta agaatgcatt
64381 tttaaaaggg tatcaattat gtcttgagtt tataaatcat cctgaaacac aaattccaga
64441 caatttatat actgatccga actttataaa agatattcct tttgccttag caaatgcatc
64501 tgaatttgaa ttgtacgaaa tcattcgaac agatgaaaca caggagttta gtgtgtttgc
64561 tatacgaaca tacgagggga ttcgtccgtt attagagcaa gtattctgtg aaatcgcatt
64621 cgctggtgct gaatgtgctt ttgaacatga gcgattggaa aaaggttttg aattagagaa
64681 aggtgatatt accccgttaa ccaaagctcc tgtagatcgt ctttttgcta ttacgccttc
64741 aattaatgga gttgttgtgc atgcagaaga gcattgtgaa atctggaatc taaattggaa
64801 tagtaaagta acaattgacg acccttttat tgaggttgct gaggttacat ttatttatca
64861 aacaaaggat atgattcaaa aaaatattga agatggtgtt ttatactaca gcattcttta
64921 tcttgataca cctttacatg agatacaaga tcgattagaa atacgagtaa aactaaattc
64981 tgattttggg gctccacgtc caatggaaca agttgaaatc gagtatattc tgaatgagat
65041 tattgggaag gttcatcttc aggcacagat tccaattgaa aatatgattt taatccaacg
65101 ttagagtttg taggaggtta actatgttga aaaaaatcgt tttagctatt agtgatactg
65161 tatatacgtc atatttacgt gaggatttta ctggtgcggg atttgaagta gctgatagtg
65221 atgtgatgca catcaagtat cttgatgaaa tcctagatat ggaacaaccc gatattctat
65281 gtattaatga taaacgatta aatattgatg cgggacatga agaaaaacgt gaattgatta
65341 tcttacagaa actaagagat attcgcttta attgggatat tcgcattgtg gtatttacag
65401 agcgtgaaaa tgatgatgag tttttggcga aactgattta tctaggtatt tatgacattt
65461 ttaactctcg taaaattgat attgataata aggttatccc acagctgctg caggaatcgg
65521 acattaaaaa tgtagcagaa atcgtaggag caagtcaggc gccgcaacaa acaaagttgc
65581 ctgaggttcc tgttgataag gaagaagagg aaggtggtaa aagtgaacca gcttctagtt
65641 ccaacaaact atttaaaaac aaacaaaagc gtaagactat ttcagaggag acgccaaaag
65701 cacctattat aaaaaaacag tataaattgg cttttgagcc ggtatatgag aaacaaattg
65761 gtattgccat tccaagaaaa acaattgttg tggccagtat gaatagcaga agtggtgcta
65821 cttttgtttc acatctttta gctgcttact taaatgaatt acagattgat gtgaattata
65881 tagagaatct ttatgatgat ggctatacgt atccgttact aaagggatat acggaagcac
65941 cagaaaacta tcgtagtgaa tttatgttgc agcgatataa agagatgcta cagaaggaat
66001 ctgatatatt atcaattcca aaatggaagc aaggaagaat aaattatatt gtaaagaatc
66061 ctatagtgga tcaagagctg aaaaacgaaa cagagcagga ctttgaccat tttattaagg
66121 ttttattggc taaccaagaa gcacctatat ctattattga tgcagggagc gattgggata
66181 aagatttata ccatgaaata tgcgagatgg cagattatat cttctttgta gcggaaccag
66241 atctacatca attgctaaag atagcgcatc ctcttacaca aagggagaga aagcttgttt
66301 cttacttagc tttagagaaa acgagaatca ttgggaataa gttttctcct gcacttttaa
66361 agcatgaggt agtagaagaa tgtttcggag ataaggtatt aactgcttta gcatcatatg
66421 agatagagga tgtatttgaa tctcaattga atagcagtac gttactatct agtcggaatt
66481 attataaaga gctagaagga atattgaagg aaatagctga tctactgcta ccaaatcaat
66541 tgttgaatca aaagaaaagt tccattttaa gtgggtttcg atttcggaag tccgaaaatt
66601 aaggaaggat gaagagggat gcaaaaattt attataggtg ctgcctcact attattattt
66661 gttggctgtt tattcttaat gacagatatg attattggag atacaacaca cacagataat
66721 aagtctgcac tagaacgtgc tggaagtaca gcaatggata aatccgtaaa agtaggtgtt
66781 ttacgagcgc aagaagaagt tgcaattgaa ccagaaatcg caaagaaaga atttgaaaag
66841 tcttataaac aaaatgcaac atttaaggat ccggcatcaa aacgggagtt ttctgtacat
66901 gctgtacaag aacaacctgc aatgattgcg gttgaaggag aagccgagac tgctagttat
66961 actaaacaat ttgatgaaaa aaaaggcagc attaaaagta acgcaaaaca catatttatt
67021 tatgaagcag attctgacaa caagaaagct ggaggaaacg tgaaataaat aagaaaaagt
67081 aggtgtgtaa gaaatgcaaa atacagtaac aacagcgctt tttctaacgc tttctttatt
67141 attgataact cttataccag agggtgtact gtatggaatg cagttaataa aggcacatga
67201 ttttgcttct agtacagtag agttagcaga acaaacaggt ggttttcagt acacatatga
67261 aggaaaaaac gtaaatctaa ttcctgatat agagaagaaa atgaaagagc aaaatatgga
67321 tggatggaaa tatgaatata caaaagggcg cgtagatcat aatcagccat tgaattttaa
67381 gataaaagct gagcatcact tctttatttt taaaatgata gggattgata gtgtgaaagc
67441 accaatatgg gctaacaaag atggaatggg acaaatctat ttccgttaaa aatatcaata
67501 tgtataaaaa gaggtaaaaa ctatactgaa aagtgtagtt tttttgccag aaaaatatat
67561 ttaaaaataa gtatataaaa atactttaca agtctatttc tatatggtaa aattttccat
67621 atagaacagc ggttataaaa aacttaaatt cgttaattta tatgttaaag tatctggatt
67681 ttatatttaa attcggtaca ataaaggaat ctatgaaaaa actaatatat ttggaggaac
67741 aaacaatggc taataaattt ttaaaaacag caacagcact aacaattatg ggaacatcac
67801 tattaggggc gggggcattt actgttaagg ctgataacac agactcatta aaattcaatg
67861 atgttccagc aaatcactgg tctacaaaag caatctatgg tttagcaaac cgtaaggtag
67921 tagcaggata cggaaatgga cagtttggtt ttggtgacaa tgtaactcgt gggcaagtgg
67981 cgcgtatgat ttatgcatat gtaaaaccag cggatgcaga tgctagcttc aaaaacccgt
68041 tttctgatat taaaggacat atgtttgaaa aagaaatctt agcacttgct aaagaaggtc
68101 ttgttgctgg ttatggtgaa gggaaatttg gaccagatga tattctaact cgtgaacaaa
68161 tggcgcaagt tcttacaaat gcttttaaat ttaaagctac taagacaaca tcgtttactg
68221 acattgataa aaactcatgg gcattaaaag caattagtgc attagaagaa aatggcgtta
68281 ctattggtac aggagataag ctgtattcac catatgcaca tgtaactcgt gaacaatata
68341 gccagttctt attcaactct attaatgtac tggaaaaaga aacaaaacca gagactaagc
68401 cagaaacaaa gccagaaaca aagccagacg ttttagatga caaactagta tcaaatgaat
68461 tcacttttaa taaagaatgg tatgaatcat caaaggtaat taataattca agctccattc
68521 aagcgcaatc tttaatcaat gaagtaaata aaaagtataa tactaattta aaatacgcgg
68581 aagtaggtgg cgttataaga ttagtggata atggaatgta cttaccagaa ggttcattaa
68641 aagctcaatt ttatattgtt ccaataaatg aaggcagttt caaagttatc ttcttagata
68701 ataatgatgc gacagtagaa ttggctaaga aatggacgac tttattaaaa tcagatttaa
68761 atttagatga agaaattcaa ggaacagttg aatctcataa attaaatact tttgaaaaag
68821 gaaattataa agtacgtatt ggaaactcaa cggcagatca catgatgtat gttcaagtcg
68881 agagcaagta gtagaatata tattgttttt ctaagtagat aatgataaca tttaaatata
68941 atataaaaat aactaaatga tattgaattt acgtaaagga cacaccttac gtaccatccc
69001 aacggtacag gtgtgtcctt ttttgtgttt aggaggagaa atgtaatgaa attaagaaaa
69061 aaacttataa tactgtgtac ctctgctatt ataggtatgc ctactttagc taatgctcaa
69121 aataaggatg taccatttta taatggtaat gataatacat ttttaaggtc tggggagtta
69181 cagatgccag gtaaatattt tcgtgcaggc agtgaatatg caccagctgg tgtggattta
69241 atgtataaag gtgaccttca ttacccagct gtatataacg gttcttttga ttttgataat
69301 ccacatgata atctggtgaa aaacgaggat ctttctgaac cttatgttcg aatctcgaat
69361 gaaggttatt ggaatagcgc aattccagta ggtgaccgta tggtaacaga agtggagcga
69421 atgaatgaaa ccattatttc tacaaagtat tggggtaatc cggaattcgt attgcataat
69481 ttatttccac atccaattaa taatgatgca ctccctataa attacggtat gttttattgg
69541 attcgggatg tagcctatct ttctggtgga tatgcagggg caggaggagt aagtggcgta
69601 aatagatata gtttgtggta tgtgcgtaca agtaagcctg aaataaaaga atttaaagtc
69661 tctagtggta agaaggatac acctgttaag tttctattca atggttttga gtatgtaagt
69721 aaagataagg gatatacaga acgtggtccc aaacttgata taggtaaccc ttattcagat
69781 atagcagggg aacgaaatcg tgtaaaatgg atgctggata ttacaaaaag tggagaaaaa
69841 gttcatcacc aagaagacta cttacgttca acaccacaaa aagataatca aaaaccaaat
69901 gaaggcgatg cagcacgatt tacaaaagaa gatataagtt ggcaacctca gatgtgtggt
69961 cgttatactg caaaattaaa aattattgat ggggttcaaa gggattcaaa tgagaaaaca
70021 gttgatttta ttgtagatgg taactgtggg acagaggtaa cacctaatcc agatccaggt
70081 aatgaagatg actataaata taaaattgat ttttcggctg atcgaattga aggagaaaca
70141 gcacgggaag gaaagaatat taaaacaaga gtagatgtat cacgtgataa ttttaaacca
70201 gaacgtgacc aatatagaga aaaggtaaat aataatatta ataaatctca gcaggaagta
70261 tatagttctg aatccgctag ggatagtgcg cagtctagtt taagctattg tcgtcgtaat
70321 ccaattcatg agaaagacga agaaggtcat gattactata ttgatagaga ctgctcttgg
70381 gaagaaaata gattagatga tgctgcaagt aggctagata cagcaagaca aaaactagaa
70441 aaagagaaga acaaaattaa aaagttagat gcactagaag caaaatatgc aaatccggaa
70501 acagtagtcg tgctaaaaca taacggacag caagtagcat tagaaaaggt aagattaaca
70561 gagggagaaa agaaaacctt gaatcttgac tggcaacata aaggtaaagg aacaattcag
70621 gcggaaatta accctgctgg taatcgtata gacatcgagg aaactacgta caaaaataat
70681 cctattaaaa cagcgattta tgaaccttca aaagaaaagg caatgtgtgg agtaacgaat
70741 gtaaagggtg tagtagaaac agtaagtgaa cgtgtgtcaa aagaagatac agtaggagaa
70801 atgtattatg aaacattgag tgggagtgtt gatagcttat caccatctaa gctccatgcg
70861 gggtatggct tttcttatga ggtaaacgga aaatacagaa atgattggaa tgccaattat
70921 ccaggtgtat ttacaaaagc aacggcacaa tatccatttg cagatgaagg actaaaaacg
70981 acacaggatt tagagggtgt ttctaataat ggcttaacat caaaattcct accgaaaaat
71041 atgtacttgt ctgaagtaac aggacatgtc ttcgatagta aaagaccaac taagtcttta
71101 tattgggatg ggcaagaaaa aattattgat ggccagcgca aatggtatgc gccattaaaa
71161 acgaaagatg ggaaatatgc gtttaatgtt gaaactaacc cagcaggtgt gaatgaaatg
71221 agcttgtgcc tgacaaatga agtggaaatt aaaggtgtag cgtacgatga ttttaaaaag
71281 agaagggtac ttgcagatct tccgttccct gtacaaacac caggttggaa ctgggttgga
71341 aaggaacata ttattactga tctgtcaaac tggtactata tgaagaatag gaattagtta
71401 aatagtattg tataaaaact tgaatcgaca aaagtatata atccttctta aactagtagc
71461 tgaatggata aaccaaaggc acacccctta atggggtgtg ccttttttcg tagaaagggg
71521 aaatctgagt ggataaaaag aaaaagcagc gtgtgagaag agctattttt attggagtaa
71581 tcgcaatgat tgtatcgtta tacattggaa acgaattaca agatcgaaat gggaaaagtt
71641 atgctcctgc aaagtatttt gaaacaggaa cgaaattgat ttcgtattaa aaatactttg
71701 tttcatttca ctaactatag tggatgaata cacatgacat gtacgatagt tggtgttata
71761 atatgtgtag aagtattgta aagatagttt tcgcataaac taaagaagac gagatgctcc
71821 aacatctcgc cttatgtaac tgttaccgca aggtggctgg ttgctaaaaa gtttattttt
71881 tcttagaacc gcccttcaaa cgcttgccgg cattgtgggt ggttcttttc gtttttcgtc
71941 gctgtatttg cttccaagac gttgatagtg atttccctac tcgttttgcc acaaatacag
72001 cgacttctct agcaattact tttagaatct caattgctaa cgtgaaaagt atatccattc
72061 gatcacctcc tttctccata aaatgaaaga gaaaggatag caaccgacca ccctgaaata
72121 ttcagttacg ttagattaat tataacatat ttacagttgg gttgatagct taaaaacatt
72181 gatatgacaa cgtttttaag attttttaag ttttgggatc agagatttga aatggtaaaa
72241 ataatatttt ttttagaaat gattgacatg aaactctata tatcataata ttgaaattgt
72301 aatattaaag aaatcaaatc caacattttc atatagactt tagattagct aaaaggacac
72361 acctaaggcg cattatgcca taggtgtgtc ctttttttgc gtttaaaggc tacataagga
72421 ggaatacaaa cattgaagcc atctaagttt caaaagaagc agattgctgc ggtaggttta
72481 gctgctgcaa cagtagcggg tatctatggg tacaatcatt tcgcagtcga aaatgcagta
72541 aaaccgacaa agattgttgt agccgcaaag gatatacctg cgcatacaga gattaaagaa
72601 gacatgctag tggaacgaac attacctggt gatgcgattc cccccaatgc attacgtgca
72661 aataaaaaag aagtggtagg taagtggaca aatgatgggc agcccattac agaaaatagc
72721 tatctcttta aaaacaaagt agtaaagaaa gaagagttac cggactctgc cattttaaat
72781 ttgaaagatg gcgaagttgc attcccgtta ctcgttgatt tggaaacaag ttcagggaat
72841 agtattattc cgaacacgta tgtcgactta tatttcaaac aggttgtaaa agaaggagac
72901 aatgaaaagg tagtattcgg tggtcttttc caacgtgtac gtgttacggc cgcaaaggat
72961 agcaatacgg aagatgcctt cgtgctagaa aaaaaagaat caaaagagga acaagaagga
73021 aaacaaaagc caaaggtaac gcgattatat acactggctg tttcacctga acaacttcaa
73081 tatctaaacc gtgcgaaaac gcttggagat gtcattccag ttgcagttgg acaaaaagta
73141 gaacgaacag ggaaagaact agaacctgct gaaggattct cgcaaatatc tgatcaaaag
73201 aacattttag actatgtaga gaagcattcg accaatccca tatctaaaaa cgtaaaagag
73261 tatgtagcgc agtatctgaa cgaatctaag taagaaagga gtttttaaga tggatcggcc
73321 agtaagaatc attgcctttt atgccacaaa tgaaaacgta ggaaaaagta cgttaagtat
73381 tacgatggca aatgagttag ctcatctagg gaaaaaggta ctttatgtag aagcggacca
73441 agtaagacca agttttgcgg ttggaactgg tcttagccat gagagtaaaa acatgttaga
73501 gcttgtaaga aaagaaaatg aatacaatct cttgcagtat atttgtacca agcaagattt
73561 actagagaga aaagtaaatc taaggttgat acaaaaatta cacgataaga tggattttct
73621 tgtatttcca tcaggctata acctagctca attccctgag attcaaaaca aagaattgtt
73681 tgtaacgaca tttattgaat cacttgtaga cacagaatac gattatatca ttctatcggt
73741 gccgactgaa ttatcggagg tgttgagtta tccaatccta taccaggcag accttgttgt
73801 tcatgtgcta aatggcaatc ctcgtggtgc attagctatc aaacgtgaat tacaactaat
73861 agaagatgca aagctaacaa tgcctcgtat gattcatgtt ttgaacatgg cagatgaaaa
73921 ttatgtagaa gatattgaaa agctttcttc tcaaaaaata gcagtaacga ttccgtatga
73981 cagagatcgt acgagttacg aatggggaat gcaatttggt tccccacaaa ttaatacaaa
74041 ggtccatcac attatggaag cagctggtct tggtattcca tcccagcaat cctctatgaa
74101 aaagggtctc tttggtttac gaaattaaaa gggggacaag gagtatgtgg ggctatttac
74161 aggaaaaaca aatcgcctta aagcgaaatc gagtggattt atatcacttt ggttacatga
74221 ttcgttccaa atcagctcga aagttaggaa caactacagc tcaacaaatt aaagacatta
74281 cagatgaaat tcgtgcattt ttagtaaaag accatcgtga tatcctaagt gaatccttta
74341 tgaataaaga aaagagagca gctgtagaac aaattattaa aagctttcta ttaagcaatc
74401 aagtcgtcat ttcagatgta ccttctgaac agttactgaa tatggtgtgt gacgatattg
74461 tgggatttgg gattatagaa cctttaaaag aagataagga tgtaaccgat atttatatca
74521 atgggacaaa agaaattatt tacgaaaaaa ttggagaggg agaatgtacc ttcccttacc
74581 gatttgagac agaagaagaa gtgaaagctt tagcctataa gatggtaaac agtacatcag
74641 agtcattaaa tacggcaaag ccatatgtgg actgcgtgtt tccgtatata cgtatcaata
74701 ttgcgctaga tgaacttggg ggactcggaa caacaataac gattcgtaag aatgcggatc
74761 acctccgtgc ttctgaagag cgtatgctat ctactaatca agcgtcaaaa gtgatgttgg
74821 actttttggc tgcagccgtg aaatctaaaa tgaatattct agttgctgga gctacgggta
74881 cagggaaatc agagtttatg aaatatcttg cctctcatat tccgaaagga aagaaaaaag
74941 aacgtactct ggtagtagaa gataaccctg aattatattt gcatcgcatt tttccagaac
75001 atcattttgt tccgatgcaa tgtagggcat cggaagtaga agaaaatgca atcgactttg
75061 atagattgtt aacaaatgct ttacgtcaag gaccaaagcg attaattgta ggggaatcga
75121 gggggaagga agcgttaaaa atgattaact tcttccaaac aggacatcct ggtttcacct
75181 ctgtccatgc aagaagtgca aaagaagcag ttagacgttt aatgcttatg tgcctgcaaa
75241 gtggtgcgaa tatcgatgcc cagtatttat atgaattgat ttcacagaca tttgatgtaa
75301 ttgtcttttt ggaaaagaaa gatgatggaa atcgttatat tacagagatg attgagttat
75361 tggattatca aggtgatata caatttaatc aactttctca gtttattacg acatacgagg
75421 aacatgatga aatgaatgaa agagtaggaa agattcatgg ccagcataaa attacagcaa
75481 gaatgtcagc cgaaatggag aggaaattcc gttcttcttc tgtaaaccca gctctttatg
75541 caccattcct ttcacaacag gaggtgcagt atgcatagtt tgttcgccta tggatgtata
75601 tttttaattt ttattagtat agtatttctc gttttacttt ttgcaaaatc taaaggttct
75661 gctctttctc aatttgtaca agaaaacgag aaagaagaaa gacgcttgga attaaggaat
75721 attaaaggga tacgaatgta tctgccacaa tctgttatcc aagaagccca aaagtacgag
75781 tggaaattaa cgaaaagcat gtactgggta tatacgattc tttccggaat gagtattgca
75841 gcggtattct atttttcctt tggaagagat ccttttacac tgattaccgt tttatctgga
75901 tttttagttc caaggttttt tctctatcga agaaaaaaac gttactactt ggttgtcatt
75961 gaccgtcttt ccatctatat gaaggcagta gcaaatgcac ttcaaattag taataatgct
76021 aaacgcgttt tggtacaagt aaagccaatg atgcatgaga gcattcaaga agaaatagaa
76081 aaagtttctc ttttattaga agggggaact acaatgtacc gtgcatttag aggattcaat
76141 gaaaccttta actttagaga attggtattt ttccatgaaa tgttggaagt atgtagccga
76201 gaaggcggag caaattcagt acaagtccta ctagatattg cagaagattt cgaaaaacaa
76261 aagctatacc tggcaagatt gcgttctagt ttgtcgcaag cacagcgtgc ctttgtacag
76321 aactgtttaa tcgtcattgc catgccgatt gtgattatgt tgatgtcaaa agaagcatat
76381 ggatttttag caggttctat gatggggaaa attgcattag cggtaaatat gttcattgtc
76441 tttttcttag caacccgtgt agaaaagatt gcgaattata atccaacaga aagaggggaa
76501 taaagtggct gcgattttag ctgtagtggt attcgttgtc atgtactggg tattctctac
76561 ctttctacaa agtaaaaaag acagcggtag cctacttaca aactatgtag aaaatgcaaa
76621 acgaattgaa aaaaagaatt taaatcaaat gatgctcgct cctttccagt cattatcaca
76681 taagtatctg acagaagaaa agaaagagca gattcagaaa aaattagaag aagctggttt
76741 ggatacgaaa ccagaagaat atttgaaaat gaaagttgcg tatcccgtca ttttcacgtc
76801 cgttttcttg atatgtacgg tgtttcatga ttactactta tttaaagtag gcgttttgat
76861 ttcaccactg ctttatttct atcctgatta tctattaaag aaaagaatca agcaggcgat
76921 agaagcaagg aagttcgaat taccagagta tctaattcct atgctgcagt tgttaaaaac
76981 acatacaaca ttagaagcag taaaaaaggc gcagatatat gctgggagac atcttcgacc
77041 gtatgtatct acacttacag cggaattaga aatgtatgcg ggttcggatc aaccatttag
77101 aaacttcgca gcagccttaa atagtccaga agttaatacc tttacgattg cattgcaaca
77161 agcacaaaaa acggacaagg tacagagtct tcgtattatg gatgcacaga ttaaaatgat
77221 gcgtgagtta aaacatgaga actataaccg tctcattcaa aataagccaa tggaaatgaa
77281 taaatttaac gtagctgtta ttggatgtat tgtgatgtat ccaatggtta ttgttattca
77341 atccttaatg caaggatttg caagtatata agaagctagt atcccaaatt gaataagaag
77401 aggagcaata cacatgttaa caaaaatgaa gaattggtta aaaaatgaag actcacaatt
77461 atcatcagaa aacggtatgt taattgcctt ggcagtaatt attgtattag tgattggccc
77521 gtttgtatgg aaagcaattc aaggcgggta tgacacaatt ctagctcgat ttacaaaagc
77581 atcaagcaat gcagatgtga atacttggaa caaataatag aagttttaaa ataatgatgt
77641 ttattacgta tagctcaaat aaatggataa gggagattca atcatgttag caaaaatgaa
77701 aaattggtta aaaaatgagg attcacaact atcatcagaa aacggtatgt taattgcctt
77761 ggcggtcatt atcgtattag taattggccc gtttgtatgg aaagcaatcc aaggtggtta
77821 tgatacgatt ctggcaagat tcacaaaagc atcaagcaat gcagacgtaa attcttggaa
77881 taagtaatta aaggtttaaa tagataagtt ctaattttag tagattctta aaattgatat
77941 ataaaggaga taaaatgaaa tgttagcaaa aatgaagaat tggttaaaaa atgaggattc
78001 acagttgtca tcagaaaacg gaatgttaat cgctttagcg gtaattattg tattagtaat
78061 tggaccattt gtatggaaag caatccaagg tggttatgat acaattctag ctcgattcac
78121 aaaagcatca agtaatgcgg atgtagattc ttggaacaaa aaataaattt tgattgaaaa
78181 taagaggggg cgtgttttat atagctccct tcttttaaaa cataaggagg tactatgatg
78241 agatttagta aagtgatgat tcccacatta gcaacattag cccttggcat gtcactaatg
78301 ggtacacctg caagtgcagc aacaacagct gatacaaaac taaatcaaag tataacaggt
78361 ggggaacata atattactgt tacaccagtt agtaacttta acgcggtaac actaagtgga
78421 gaaacacaaa tgacacatgc aaatcctggt gtgctaacag tgacagatgc aactggttca
78481 gggaatggct ggagaatcaa tgtaaaagca gatcaattta aagtaagtgg agatacaaag
78541 tcaaatcgga cacttccaaa gggttcctta gttttgaata gtggtggtgc tactattaca
78601 aaagtaggag ggacaagttc accaaatccg gagtttaaaa cgactaactt tataattgat
78661 acagataatc aagttacgat tttaagtgcg aaaaaagatg agggtatggg gaaatataat
78721 gttagtttca atgataagtc tctagcttta acgttaaatc cacatagtac gtatgttgag
78781 aataaggctg gtgctacctc atatgaatca aaactgacat attctattgt aacaggacct
78841 taaaagaaac ttattatata gaagggaatc acgtatgtat gattctcttc tgtacataga
78901 aagaaggggc agaatgaaaa gctatgtata taaaatttta attagtactt tggttgtgat
78961 tatattcatt ttaagtataa gcttaaaacc ttttaaagta gtttatgcgg aagaaaaaca
79021 agatagttta ccgtttgatg taagcattca tgtcccggat aatcaactag gtgatataaa
79081 aaaatatttt aatttacagg tgaaaaagaa acagaatcaa acagtgaaaa tggatgtaca
79141 caataaagct aatactccaa tcaaagtcaa tgtaaaagtt gccaacgctc tcacctctac
79201 aaacggtggt attatgtatg taccaactcg tgaagtctca caaagcatat taacagatac
79261 agatttctat atggatcagt atgtacaagc tcctgacgct gttaccttag aggagaatca
79321 aacgaaaact atagaggtac atttaacggc accaaatcaa ggtggagtgt ttttgggtgg
79381 attattattt gagttagcgc acgataccca aggacagaag cttgaaaagg acggattgaa
79441 cttttctgta cataatcgca ttgaatatgc ggtagcaata caattgaata gtgaagagac
79501 tgaaaattcg gtcaataaag cgcctcttaa actaaatggc acaactgttg aatcttatcc
79561 aacacagcca caagtccatg cactttttca aaatacaaat gcaaatattg tgagggatgt
79621 ggcagtttac tatgaagttt tatcccagga taacgttcta tttcatggta atattccagc
79681 attcaatgtt gccccgaaat ccaaggtagg attggctatt ccctggaaag caaaagagta
79741 caaagatgga aagtatatgc taaaagtcaa aataaaagaa aatggtgtat ctaaaacata
79801 tacagaagaa ttccagataa cggcttctaa tgtgacaaag tacgcggaac aaaatggtgc
79861 agtaaaggta ttaccgatat attcaaatca aacgtatatg ataatggctg gtgttgggat
79921 attaatcatt tcaatatttg tatttgcatg gtggagaaag aaaaatgaaa aacagagaga
79981 agaactaaaa gcttcttaaa tacgaaagag gtgaaaggag aggatagggg tgaaacgggg
80041 gaagattttc acttcaatca tgcttttaac tgccacatgc ttgtttatag gtacaaaaga
80101 taacactatt ttagctgaag aatcaatgaa aaagcagagt gatattccaa cactcactgc
80161 aagtggaaac gaaaatgaag tcaagctaga atgggcgatt gatatcttag agcaggacgt
80221 attatggaaa attgatttta ataacccaaa agacgtcaat ttgatgagtg gttggggaga
80281 gttttacgga aatgggaatc aaagtttaca atctgaagtc ttttatccag gtggtacaga
80341 tactagtgga tacaaagtat ttgatacaaa atcgggaggg aatcgagtct tatatactta
80401 taaagtaaga gagagttcca ttgctgtttt taaacgatta aacgtaccta ataatgctta
80461 tatttcagca acatttaaag cgaattcaca aggattaggg agaattagtt tctatggtga
80521 tggaagctgg gaaacaggga gagaatttga ttattataac gctactgttt taaaggatgt
80581 tccaggcggt tcaaaagaaa tagaaattag taatatctct ttgtttccag agagggaacc
80641 cggtaccaac ataccaaggg atagaagaca tataacttcg gatataaaca aagatgtgta
80701 tcaagattcc cccatgatag aaaaggtgat accatatcag gatggttctg gaaagggcaa
80761 gataatatta aatagtccta tcgtgactcc gatgaaacaa ggtgatcgtc taaaaacaag
80821 aaaatgggca gcacctatcc aattgccaaa taatcgtacg gtcacaaaga atgattctaa
80881 taaggacata aatggatggt ctacatttag tatgaatact caagttgcaa ataatccgtt
80941 ttatattacc gagcaacgag gcgtaacttt ttatatgctt gcgtattcag aagggattac
81001 ctatgtggat gagttaaaag tagggtatgc atcagaagca gaagtataca gggggaatca
81061 gcaaatatat aagggcagac tctctgacta tgtagataaa gaagcaaaag atcaagcagt
81121 accaacaaca ccagaaagct tccaaattga aaatagggaa ctgaaagaaa ctaaagtaac
81181 gtttgcccct acgaaagatg acgggagtat ctatcattat aaaattcgtg gagttggcag
81241 gaatgacgtt tcggaatttt caaaggaagt tcctgcaact gtaacaagtg gcgtaaaggg
81301 atatgaatat gtagtgaatg ataaatctga cacatcactt gataaggtag gtggtgttca
81361 gtttacaaat cagactagca ttcagtttcc aactgattat gccaaaccac aatatgtaca
81421 tatccgaaca gtagataaag ctgggaataa aagtacgacg aagcatattt ctaccacaca
81481 aaaaggacga gtagacatgc ttactgttcc taaaagtgta gagtttactc ctattcaact
81541 aaatggagaa aagcaaaatt catttggtac attagggaaa ctcatgatac atgatagtcg
81601 aaatcaagcg gatggatgga gattgaatat gactatttct ccatttacag agtcgaacat
81661 tgcaagacaa ttgccaaagg gttctctatt cataaagact caagtgagtg taacaaaagt
81721 aaagggtcca gagacaggga aacctattgt acagattcca aatacacctg ttgataatgg
81781 ggcagcacac actattatcc gggcttcgaa agatgtagca attggagaat atcaactcga
81841 ttttggtcaa aatggattac aactgcagtt agatccaggg acaacttatg tagggaagaa
81901 ccggcaagct acttatactt ctacagtcac ttggtctcta gtgagtggac cgtaataatt
81961 cattaaaaca ggaaaaaata aggagaaaaa attatgagta tatatgcaat aggaatacta
82021 ctaggatata tgtccctgaa tgtatttact gatttgaaat atagaaaaac gaaaaatata
82081 tggcatttgc tatttttaat tgtaggtata ggaatcacgt attttgctgg aataagaact
82141 ggaaaagaga ttgtgattgt actagctatg gcattagcgt gtggtttgtt gttagagaca
82201 tttaaatttt cttcatcagg tgatacaaaa atgcttattg ttgtagcttt atatatcagt
82261 aatgtagtag aagaaacagc tatccttaca gctattacat taacagcttt ccatttacta
82321 ttcttttgga ttgctagtgt gtatcgatta attaaaattt tagggtttgt aggagcattt
82381 aaagaccaat tggagcatgc tgcttctata tttggggcaa aactaccaaa gaaagaaata
82441 cagctgatac agagcttccc gggggcttgt tctatattat taggagcaat tgtgtatatt
82501 actttcacta tttatcaaaa cggaggtatg ttagcttgaa tagtagaatc attcatcaaa
82561 gagaaacgta tatttatttt acgatattcg cactagtagg agtactgatt acaaatatgt
82621 ttattaacat ggtatttata ctagcatatc cgttacttat cggattaatt gtacaggtcg
82681 tcttgcttca gaagataaaa aaaccgtttt atcggagtgg aaaagaatta acggaacagt
82741 taaaactaaa aaatatgttt ctagtagaat caaacatttt aggagatgaa gaaggaactg
82801 tatatgaagt gcatcaaatg cctttttcat tttctaatgg attaattaat aaagataaga
82861 gttataaaat cataaaacaa gagtatgata gaaaagtcaa agaggattta acgaaaattg
82921 caaaatggca agttacaaca agagctagac tagttacgac aacgcatttt cgtttatata
82981 caatttggca gaaaaatagt acaggctatc aattaaaaaa aatagaggat tgtgttgatc
83041 catatgccaa gatgaaccta attcaatgga tgattgcttc attctgtacg actggtcgta
83101 tcaagtatga taaaaaacca aaagagtggg caagttatga atgggttact ttaaggtaat
83161 aaaaaggcag aagaaaaaac ttctgtcttt ttttatttac atattaaagt tttttaggaa
83221 gatgagtata ttgtatgtgt aatgtctaca atatttgaag gaggagattt gattgacaaa
83281 tttaccaata attttaggaa tgctattttg tttaggatgg gctttattct gcttatgact
83341 gtgttagtaa ttaagatggg tggatattaa tagaggatgt atccagctga ttttctatta
83401 taccaaatta gtagttttgt tttattaaga aaagatctcc atataaaaat ggagatcctt
83461 ttaaaatgac gatgagatat gactcaatat ctcatgtagg acaatttcat tatacattat
83521 tttctgaaaa aataaataag tatatactag ttaagtaaca taacattatt gaaaatttga
83581 tggaaattga ttaatataaa tgtatattta ttgtttaatt gattccgttt attcccacac
83641 cttattgtgt tgtggttgag ttgtagaagc aagttgcgtc ttgtttcaat tgtgaaaggg
83701 cttctttgag ccggttagtg tatatatagc ttattttgct atgcacatta ttaatcgact
83761 tgaaggggcc ttttttgtgt tgtcttcaag ttaggaatca cttgtaaaaa ggtatttaga
83821 tttaggtata caaataaaaa acactgtgag aaaaacacaa gatttgtgtt tttttgcttt
83881 ggaaggggat cattataatg aaaatgaatt atgaagtatc tatattttgt tctgcacatc
83941 cagctgattt tatgccaaat ttgcgtgcat tacgaatgaa ggttacaaag gaaggagcat
84001 tttgggaacg agattgttat cagttttcca ttaaaccatc aaacttgtca cagcgagcag
84061 ccaaacaagc aggggaaatc tatttgtatc atgtctattt caatggatgt atacgagatt
84121 tccttttttt attggagcga tgctttagag ggacaagtta tcgctttact gcaatccgtg
84181 gtttcctaga aatagaaggg tattccttaa agaaatggaa gccaatttta cgtagtcatc
84241 atataaactc tactgatgta gattctattt tcaagaaaaa tgatcttaca atgattgtac
84301 atcaccatgg agctttagag gtagctaagc atgcggagaa aggcgagcaa ttaaaaaaag
84361 taaacttttt aaatgtagat agctggttac aggcgcttaa tccgacgaaa gaagatctat
84421 tctctttaac gggtgtgagt gtatcttaat gagtaatttg caaaactatg taaaagtgta
84481 tatgcagagg gaatgacaga aatctgtagt taaaaacgac tatgaatttc tgtcttttta
84541 ttttattgat gaacaaaaag aatatctaaa tagaagtata aaaagtttaa tggaagtatc
84601 tgttccatat ataataaaca gtatacaagg agtggggaat aatgaattat aacattcaaa
84661 aaggtcaatt tcgtttaacg agtgcttatc caagaggtag ctggtgggaa ttttaccgtg
84721 ttacgtgtcc gatttgtcat gatacaggta attgcatgct gcatgtgtca caagagaagg
84781 tagcatgcac acgtgtagaa agtaaatgga tttatggaaa aaacacgggc aacccaagct
84841 acattcatta cataaatgga aaagataagt atcaattgcc tgcggcggat gaagttcaga
84901 ttcatgataa gaaaagtaat aaagaattag atgtgtttaa tcgtaagtta atggatttca
84961 taccattaca ggagcatcat catacacatt tattacgaga tagaaaaatg actgaagaac
85021 aaatacaagt acgtcaatat cgctctttct taaaacaaca aattgagtta gaagaggata
85081 atacatatac gacagtttgg gaaaaactat ttaatcagat tgggaataaa aattgctggc
85141 aggggattcc gggattttat gagatgaaga aaggtcaact ttctcttcgt ttgatgtcag
85201 gttctcctgg tatattgatt ccttttcgaa accagtacaa tcaaattgtt ggatggcagg
85261 ttcgtgtgga tgaagtgaaa aactctgttc atgtgaaatc ggcacctact ggaattcaag
85321 cggaattaat cgagcagcct aatgttgtaa agataactaa agatggtgat tgtatctttg
85381 aaggcgaact agaagtgagc aaaaaggtag agattccatt tcaagaggga caaattgttg
85441 taaagattca taaaggacaa aagtatttgt ggctctcatc agcaaacaaa aatcaaggga
85501 ctggggcagg cggtagtgaa aatccacttc ctgtgcatgt agcggtacca agttctcatt
85561 tgaaacattg gaattctggt acacttcatc aaacgaaatc agtaatgatc acagaaggac
85621 ctatgaaagc cgatttgatt gctgatttgc ttccagagag atttaataaa ggggagattt
85681 ctgaaatagg aacaacggtt cttgcgattc ctggtgtaaa tgcttggcga attgctatgc
85741 ctgtattaaa ggatatgggt atagaaaatg tctatttagc gtttgatgcc gatttagtag
85801 aaaatcaaaa agtaaggaaa gctcttatag actttgcgac agagttaaag cgagtgggct
85861 ataacgtaat tatagctgca tggaacccaa cgcaaggtaa ggggctggat gatacaatgc
85921 aagcgggatt taaacctgta tttcagagat tgtgaaagtt ataaagtagg ttgatatttt
85981 tataaatagg tagattgaaa aagatagagt ttttaattct atctttttct tatatccaat
86041 taactaaaag aagggtagaa gagaatatga atacatctat gaaaaaaaat ctagtgaatt
86101 tacgagttga ctttgctttc aagcgcttgt ttggagtaga aggaaacgag gagatactca
86161 ttggttttct taatgcggta ttacaatcct ctttagatga ggaaatcatt tctttgcatt
86221 tggatgatcc acatcttcca agggaacaaa aggatgataa attgtctatt ttagatttgc
86281 gagctactct gaataatggt ataaatttaa atatagagat acaggttcgc gacaaaaagg
86341 acatgattga gcgatctttg ttctactggg ctggcatgta ttattcccaa atgactcagg
86401 ggatgaagta tacagaatta agaccaacca tatgtattaa tatagtggat ttcattctgt
86461 ttccaggaga agaagacttt cataatgtcg gtgtagtcat gaacaaaaaa tcggagcaca
86521 taatttcaga gaatatgcaa ttgcactttc ttgagattcc aaaagtaatt cgagaatggc
86581 aagaagatcg aatggatcca tgggaggata tattagcacg ctggctatta ttatttcctg
86641 catatgaaga tgagaaatta actacaatcc tggagggaat cgcgatggaa aaagatccag
86701 ttttgaaaaa ggcaatagag gattgggagc gcttaagtag cgataaggac tttttacgct
86761 tatatgaagc gagagagaag gcaataaaag atagaatatc agaaatagag acggcagaag
86821 aaaaggccgc ggaaaaagca gcaaaagaag cagcaaaaga agcagcagaa gaagctagaa
86881 tagcaactaa gatagagatg attcataatt taattaatgt cggtgtacct atagagaaag
86941 tagcggaagc tactgaatta agtgtgaaag aggttaatga aattctaaaa aataaagagt
87001 aaatataaat gatataaaac aggtaattgt gattacaaac aattacctgt ttttttattt
87061 ttgattgatg ctcattttgt gattacaact atattttttc ttgctttagg atttcctcta
87121 attcataacg aaattcatta gtcttcttaa catcatttaa gattgcctca agatcttctt
87181 tttcaacaaa ttctctaatg gaatggttaa ataccattaa tctaccgtat ctttgttcaa
87241 tctctttaaa ccacgtctct tttttcaata acttaaaatt ttttcgaatc attttttcct
87301 ttcttgaagg aatcgacata acgatgcctc ccaatacatc actgattaag tcacccatga
87361 acaagtctcc tttttccttt attttaacat tttaaaaaaa cgatatgtcg tacgaaattg
87421 aatatatagc tagttattta gaataaagtt taattcaaaa tgttatatct gcacttattt
87481 ttttgtggtt agtcttggtt tgaatctaca cattttttgg ctacaaattt ggatacgtta
87541 taataaaagt tattgaatag atgtaaagga agaggtaata aataataaag aagttagaag
87601 gatttgattt gtattatgca aaagaaaaaa gaaggttatt atgtacatgt gtatacactg
87661 agagacaaaa gtactaaatc aataaaaata aaaccatcgc gctcattgaa agaggaaatg
87721 aatgttttag gtcttaagga cagtgatatt tttcaaattc aaatggtatg gtacgatcca
87781 aaccaagagg ttaaaaaata ataaaggtgt aaataagggg ttgtattttt aaaatcgtat
87841 tgctataata taaacgtaat aagattttac aataaaatat aaaattaatc agttcgcata
87901 taagagaaga cctcaatatg cgccatgtcc ttaggggacg tgtgcgtata ttggggtctt
87961 tttgcgtttt gcgagcaaaa tcacccggag gtgcaggaat tatgttgaat tggttgtctg
88021 caaaacttat gacaacatca gtaggagatt tcttactggc aaaagatagt tttacgggag
88081 ggcttggtaa gaacagtagt ggttcgaatg ctgcaactgt ccaagatagc atgaataccc
88141 ttgtaaaaac attaattggt tttggaggta tttgggtagt tgcttgtgtt gtattcgcaa
88201 gtatcaaact ctcaggtgcg caagggaaga accctgaaaa ccgtacacaa gctatgattg
88261 gtttagcttg cgcagcaatt ggaggctttg tcatgatcaa agcgtacgac atcgcttcat
88321 gggttacaac aatctaacat aagagttcgt acaagctctc ctccatttgg ggagagcttc
88381 tcttatataa gggaggaaac aatatgagaa aagtaactgt tcctgttgac atgacttcgg
88441 aacaaaaaac gctgttaggt gtattaagta aacgccaatt gatttatcta ttaggtggcg
88501 gggcagctct ttatttatat gtaccatttt tatggcggct atttgcaccc tttgatgcgg
88561 tagtagcgtt ttttatttgc ttaattttag cactaccaac ggtagtaggt gtaatagcgt
88621 ttgcttttat ttataaagaa aaacaacaca tgtacctaga tagattttta cttatcaaaa
88681 tgcgtagccg ttccgaaaaa gggaagtgga gaaaagggta cgagccaact acatgggtaa
88741 aggagaattt atagatgttg gaaatgatat attttgcggc gatagccatt gtaggatttt
88801 tcttttatcg gaaaaccgct gtttgggtct aagaaaaagg gggaaaatca aggcagagta
88861 gagaaacaca ctgctgaaaa aagtggaaag aaaaataaaa agaatatgtc tgctgaatca
88921 gaagttgatg aggataatgt tgatttcttt agcgcttttg tagaagacat taaggaaatt
88981 gataatcata tgattcgtta tcatgatgac acatttgtct tgattgcgga agcgcatcca
89041 gttaattatt acttactctc caatatggaa caagaagcga ttgatatcaa aattgaatcc
89101 tggttaacca cattagagtt caatacaaaa gtatatattc aaagtaagtt tgtagatttg
89161 acagatcctg tacgaaaaat gacagaaacg atgaaaggtg cgaaggacct tacaccagag
89221 acagtactat atgggcaaga agttatcgat aacttagagt actggcaacg ttcgcaacct
89281 cgatatgaac aaaaacgata tttaatttat ccatacaagg tggatattag tacgattact
89341 gctgatacag aggacgagtt agaagaaaag attgtagata aggcatttaa cgaattatat
89401 cgtcgctata acgcttctcg aaatctatta tcgaaagcaa aaattaatgt agaaatgtta
89461 acgaaagata aattaataga actcttatac gtagcgttta accgtcgtaa agctgtaaaa
89521 gcgcgtttcc aggacttaat tgaaaacgag aatttctcct tatattcaac aggtgaaacg
89581 aatgagagaa aattagagtt actaaagaaa gtgctagcgg aagaaaaaac agaaaaatca
89641 aataatgggg tggcgtaaac atgaagttat tcggaaaaaa gaaaaaggaa aagaaaaaaa
89701 tagaagcaga agaaaaagat gaattggaac tagaggagga agaattggaa gatgaggaaa
89761 taccgaccca attagacaat caaacaactg tgtttgatgt tatcgctcca gaaggaatga
89821 aaattgacgc agaagattat ggagttatta aacaatcttt aggaagtaat acgttcttcc
89881 gtccgtttta tattcctcgt gatgggtacc cacgtatgat gcaaaccaat tggctaaaca
89941 tgttaacttc agctggggaa gtggatgtca tgattgatat tcataaagaa ccaaaagcaa
90001 aagcaatgcg ctcattagat atgcagctta cgatgctacg ttcgaacctt tctttccaac
90061 gtacacgagg aaatattgac caagaaaaag acttagatgc aaaaattcaa gatacaaaca
90121 atttaatgga tgaaatccag ttcaatgaaa acgactccta tatggtgagt acaatgggtg
90181 ttgcgtatgc cgaatcaaag aaagaattgg acgttttatg tgagtatatt gaagatgaaa
90241 tgcaagcatc tcactttaag atagcgagta cttggaatcg tgtgaaaagt gggttgaaag
90301 ctgttatgcc actaggtgca ccaaatactc tgcaagatac ctatcgaaat attgatagac
90361 gtgctctatg tacatttgcc ccatttgtat caggatccgg aagatttaac ggtgggatac
90421 caataggaaa gaacaaaatt actggacaag tagaattttt aaattcattt ggtaacgcag
90481 attatcgtcc gccaaactat aacattggtg tgacaggaat ttcaggatcc gggaaaagtt
90541 tacttttaaa aatgaagcta gctcgtgaaa catcacttgc agatacacat gcgatgatta
90601 ttgatccaga gggagaattc gtaaaaatca ccaaacgttt aggtggtatt aacttaaata
90661 tttcacctga aagtaatatc attattaatc cttgtgcaat tgcagtaaca gaacttcaga
90721 ttacggataa agatgaagaa ctagaagcgc ttgaacaata tgataagaag gaactcgtag
90781 agcgtgatgg cgtgaagtat gtaagatttg taccgatttt agaaaaaatc aatgaaatac
90841 taggattctt tgacattatt attcgtgggc aagactttga tcaaccagga ttaaatgtat
90901 tccagcgtac gatgctagaa gacgcgattc gtgaagtgtt tgataaacat ggtattacct
90961 cacatccatc ctctttatat acagatgaag tgaaaaaggt ggatggacaa ttaattcagt
91021 ctcaagtgag aaagccagag ccagagttaa aagaaatcta tgatgtcata gtagaacgtc
91081 atggagacga tgtgaaggca gaagagttaa ttgctgcgat tcgtccattc ttacgcgatg
91141 gttcaaaacc attatttgat ggacaaagtc attttggccg tggtgtagaa acacagttaa
91201 atgaatctcg tgttgttaat tttaatatta gtcatttaga agaaggattc ttaaaaccaa
91261 tcgctttcca cgttatcttg aactatattt gggagcattg gattaagagt ccagaacacg
91321 ctatcaagcg aaaagtatta tatgtggatg aaatgtggca gtttatcgac tatgaacaaa
91381 cggttaactt cttagaaaag gtagcacgtc gttcacgtaa aagaaatgct ggtatgtgtt
91441 gggccagtca ggactttgtt cgtattttag aaaatgtgaa agcacgtggt atcttgcaat
91501 ctactttctc ttatttcttc ttagaacaaa ataagattga taagaaaaaa atccaagaga
91561 actttaattt aactgctggg gagttagata ttatcctaaa caacccagga aaaggagaag
91621 gaatcttccg tgttggggat agttcggttt ggattcaaac agatccatcc gacaaagaaa
91681 tgatgttcat tgaatcaaat gaagcggtac tacaagagct tttaaataac atgaagaaag
91741 tacaagggta cgcaggataa tagcgtacct ttgaaaagga aggtgaaatt atgcttgaga
91801 aaataataga ttgggtcggt ggccttatta tccatatggt aaagactctc ctagcgccta
91861 tttatggatt tatggatact attccagttc tagtctttgg tggagataat gctaatctag
91921 attttttata tgaaaagaat gcggttacga atgtattaga taccggtatg cctgtcatgt
91981 ttaaatttgt tgctttttgt gtcctcgtca gtgtagtttt tacagcagca aaatattcag
92041 caacggctat aaatccaaat aatcggacgg cattaattga atatgcaaaa gacttaatga
92101 ttatctcgat ttgtctctgg catttggatt tcttttataa ttttgtattt aatctaaaca
92161 attggattac attggaattt aaagaggcga taaatggagt aaataacggg aattttaacc
92221 cggatcaaca aatacctttg ttaaagtcgg ggctgtctga ctataaaaca attacagagc
92281 tctcaatgaa aggtcatgaa aacgattata tgtttatcat attcggacta ttcattgaag
92341 ctggattaat gatatgggca aacttttatt atttaatgcg tgcggtgaca ctgtacgtat
92401 taatgttact aggccctgta atggtaggaa tgtggttgtt cccacaaaag aaacaacaga
92461 cgttatattg gattcgtgag tttatgggag cggtattaat ccaagcgatt cacgcaatta
92521 ccttatggtt agtcattaca ctgattggag gtgcacaaaa tcctattata aaattagtat
92581 tgcttgccat gtttatcccg gttggtgaga ttgtaaaaag ctttatcggc ctgagcacca
92641 atgcatctgc aggtattcat agagcgggta cgatgatggg gatgggtgct ttagcaagtg
92701 tggctggttt agttaaaggt gttcgtgatg attatcgtaa ttcaaaagta aaaccagatg
92761 ataaagggga taaagaaaag acaaaagaag atgcagataa cccaaaagat gcattaggag
92821 cgaatttagg gacagatatt ggcacaacat ctcgtgcagc tcgtatgtta aaagcaggtc
92881 aagttggaag cgcacttggt aaagcaacga caggacttgc aggtatggca gcaggtgcag
92941 gtcttggacc aggagcgatg gtagcaggat cgcaggttgg aagtgcatta ggtgctgctc
93001 ctggagcagc ggctggtagg agtgttgctg cagtgggtga aggagctgta gccttaggaa
93061 aacatattgg ttcgagtata aagaagggtg cggacacgta ttcaaatcta aatggtgaat
93121 cgtatccgga actaaccgat gaagatatcg cacaggattt agctacaaaa gattttgaaa
93181 attggaaagc ggataatcct aattctgcgg tggcaagccg cttaaaacaa gcattcccta
93241 atgcttccga tgcagagatt gctaaaaaag tagcgaaaac aaatagtgat caaatgtctc
93301 gtttcacaaa tcagcggaaa caagatttac aaaatatgaa gaaaactgct acaccatatg
93361 gaaatgctag agatttagtt aacgctgcaa cgaatgcatt ccaaaaggga tatgagggag
93421 accataaaga tacgtttatg agtcaattac cagaaaatat gtcagcggaa gagaaagaga
93481 aacaatggaa tgaccatcta aacgcaaaag tacaaggatt tagaaaccac gcagaacagg
93541 cagcgacaaa agcgggagcc atgccagttg atgcgaagga taagcaagga aataacctgt
93601 ttgataagtc ctatgtcaat aaagatgcgt ttgcttctca acttgcgtta ggaaaagtgg
93661 gaaaagcagt tgagggagta aaaggagaaa cgttagaaag tgaccatcaa aatatggggc
93721 aagtcggtgc tcttgtcggt gcttctactg ctgcatttaa gaaaggatat actgcagacc
93781 ataaggctgg attcatgaaa caattccctg cagatatgtc gcaacaagaa aaagaagcag
93841 catggaataa acatttagat caaaaagtac aaggatttaa aaattatgca caacaagcgg
93901 cagaatcggc tggtattgta cagcaaaaag atggtacaaa ctatgcgaat aaagaagctt
93961 tcgcttctca tttatcacaa cagttacaaa aaaatcctga cttaaatgca atggggatat
94021 ccagtgcggc aggcattcag aaggcagtca atggtgtgaa aacacacggt ttgacaagtg
94081 gaactggaag ccagcaagca aaacaagtaa gtaatgttgg gaacctggta caagcctcta
94141 cagagtcctt taaacagggg tatgcagcag aacaacaggc aagctttatg aaaaacttgt
94201 ctccgactat gtctcaacaa caaaaaaagc aagcttggca gtctcactta aatgaaaaag
94261 gaaatgaatt taaggcagtc gcacaacaag cggcagtaca agcgggagcg atgcccgtac
94321 aggcaaaaga tacgagtggt aagagtctac ataatcaatc gtatattaat aaagatgcct
94381 ttgcttcgca attaacgaaa ggtttacaaa gccatgcaag tcttggaacg gtgagtcaac
94441 aagtaggttc tggaattact agtgcgattc aaggtgttcg ttcacatggc gttgcggcag
94501 gaggcgcgat taataaagct gtatacgcag cgacacaaac gcaagcgagt atcgcacgtg
94561 caggagatct ttctgttgcg gaaattgaac gctcttatgc agatgcatca acaagtgtag
94621 caaatattgc acaaagtgcg ggtaaaatgt ctatcccaac ttccgcagtg ggacgtataa
94681 cgcaacaaag tacaaaactt ggcatgagtg taatggaagg tgcgaaacac cttatgcttg
94741 cggatcgcat tgatacggta tcaaatgcat actttagtgc cgcgagtgct gtacaacaat
94801 ctggagggaa tgcagtacaa agagtgataa gcgggaccac tgcggctgtc aatacttcat
94861 taggagggaa tgcggcagag cgtcactata atgtaacaaa aggactgagt tacgccgcag
94921 gcgttattgg tggtgcgggt gcttatcaag caactgcacg tatggtaagt aaacataatc
94981 cgtataacag tgcagttcgt acagaagcaa aagagattca ggaaattcaa cagatggtac
95041 cgacaacaac agatcataca ggcgcgcaat cggttgtaaa aggtgcagta cgtcttgtga
95101 cgacaaataa taaatcatgg attgaagcaa aagatgctag tggtatgacg caggttgtat
95161 ctcgttatgg tagtggagat agtagtattc gttctggaca agtggtatat caggatttaa
95221 atatttcaga cggacaatta acgcagtatc gtaatggtac gaaagcttct ccagcctata
95281 tacaagattc aagtggtggc aaaatcaata ttaatcgctc gatcaatgta aatccaaatc
95341 aattagtagg aaatccaaat caaagaccgt tacaacagaa actggtattt aatgaaccac
95401 cacttacggt aaatcacaag gtagacaatg gtcacttcta tatgtctgat ttagaccaag
95461 gtggctataa gaatgtacaa atggtggtag aaagagatcg tagttacatg gttgcgacaa
95521 caacagatgg tacagtgtcg cgtatttcgc cattcggaaa aggagatacg cgtttacaag
95581 caaaccaaag gattgaaaga gcttgtgaag tgaaagacag tagtattaag ccacgagaag
95641 aaattttagt cacacataca caggacgaag tcgttcgtac agagacgcat ttgaatttat
95701 cagaacatga cccacaaaat ctgattccat ttgcgccaaa ccctcgctta gcacagcgaa
95761 gaggaagaaa ttctcaaaat ggaaaatatg gtgtgataag tctatgagtc acaatcctaa
95821 tgatccaaat gaacagaaaa aagtaatcct ttaaaagatg tagcttccca ctttattaag
95881 aaaaaaggga tgcaagcgcg cgggaagata gcgaaattag cagggaaagc aggaaaggcg
95941 gcagcgaaag ctgctgccaa aatgctaaaa gcaggtatat taaaaattgt gggtgctgtt
96001 gtggcagcag ttggagtacc tgccgctttg attatgggag tcattattgc tgtatgtgta
96061 atcttagtct ctttggtacc ttttaccgat gatgatacga aaacagagga acaagttaaa
96121 aaatatatgg aagtctcaat ggctctgaat gtggattgga aagaagttgt cgcttttgat
96181 atggcgcgat atgataatga tttgactggt aaagatccgc atgatgctat atcatatttc
96241 ttggatatcc aatatgaaga atatacggaa aaagaggtat gcgaggcagg accgaatggt
96301 ccttgtgaaa aaaagaaaaa ggagatgcaa aaaaccaaat ctgaaagtta ctccggacca
96361 gatgtaaaaa agatattagg agatacagat tttaagaaaa aaatagatga gattaatgcg
96421 agtggaagta aaaaagtgac aacatcttct catgggctag agaaagcgat ggaactcgca
96481 aagtttagta agagtcaaaa agagcgtgct cgtgagatat tagaagctgg gttgttagag
96541 gcaacgtatg gacatctggc cccttctagt aattttgttg gtggtatgtg tgtaggtaat
96601 gtgagtcctg gcggggagcc tgttaacctt aatgcaaaag ttacaggata ccttcctaaa
96661 attaaggaaa tggcagaaaa acatggtgtt gctcaatatg ttggtatttt ggctgctcaa
96721 atgatgcagg aatcacaagg agagggaaat gacccgatgc aagcagcaga agggcattat
96781 ggagatttaa gttcatcttg tataggtcta aaaggaagtg ctcgtatagg gtgtattaaa
96841 gaccctaata tttctattga agcaggcgta caagaattta aagatgtgtt agcaaaggca
96901 aatggagata tagcacttgc cttacagagt tataattacg gtcctggatt cattagttat
96961 gcattagcaa aaggtggata ttcagaagaa acagccattg cattttctag ggagcatgct
97021 ggtgaaaatc cagcaggttg ttctgaccct aataacttcc gaaccaaagt tggagcgtgt
97081 tacggagatt ttacatatgt ttccaaaatt ttaaaatatt acaaagactt gggttgtgtg
97141 acagctggtg atggagaatg gatttctgat aaaggttgga aatggccaac gaaatcaggt
97201 cgtattacag atacatttga tgcagttcgt aatggaaagc aacataatgc tgtagatatt
97261 ggagctatga ccgctggaaa accaggggac cctgtatggt cgatggaagc aggagtagtt
97321 acagctcaaa caggatatgt aaactacggt ggtctaggtg tctatattga ccatggaaat
97381 ggcattgtat ctcgttattt acacttgagt aagatttcag ttacaccagg aactatggta
97441 acaaaaggac aaattatcgg agaaatgggt ggttctaact atgttggcgg cgttctgaat
97501 atgcttggat acgctgtcca tttagatttc caaattcgta taaatgatca accgacggat
97561 ccaatgaagt tctttaagaa aaatgatgat ccagggttat catctggtgg ttctcctacc
97621 atgacaaatg ctaaacgaca aaaggtattg gaagaagcga aaaaatggct agggcaagga
97681 aaggtcagat atgtattagg agaccgtaat ccaccaggcg gtacgtcaga ttgctcagga
97741 ttcacgcagt atgtctttag aacaagtata ggtgtccaac ttggagattg gacaggtgct
97801 caagttgggc aaggtaaaca agtacctgac attaatcatg cacaaccagg ggatcttatt
97861 ttctatgaaa atccagggca cgttgcaatt tatatgggga atcaaaaaat gattcatatt
97921 ggtgataaca aaggtgtaac aaattactgg tctaaactat acggcaagag gtcaacatat
97981 gacgcaaata cgtaatgtta tagactgata aaggacgaga gtagatgaag aaaataatca
98041 acattttatt caatatgcct cgtaagtact tagttatatt aggaattata gtgttagtag
98101 taggtgttgc tacctataat actattcatc gttacatgat gaaatctcaa gtacaagagg
98161 aagagcaagt aaatcaagat gaaatcgaga tgcttggaga taaaccaaag ggatttgata
98221 caaaagagga cgaatatatc gcaaagacaa aaactgtaga ggacttacta cgaaaaattt
98281 ctaatagtag ttatgatgtc ccatatttgt ttacaaaggc tggatttggt attgaaccaa
98341 tgaagatgac aagcaatgag cgtatgctcg ctacagaagc tgtacaacga tatttcctaa
98401 atggagataa gttttacaat gcgcgaatta ccaaaattga ccgtgggaaa aaagtagata
98461 cctttcatat tgaagtttta attcaacagg taaacttctt agaaccacga caatttaaag
98521 tgcaggtaaa caaatatgca caaattgtaa caccaattgc acaaattcca catggacaag
98581 aagaagtacc tgtggattaa gaaaaaatga gggttgtgga agaaaaaaca caaccctttt
98641 ataaaaaaga aagagtacct aaatttattt attgaatatt cataattttc cgatataata
98701 aaaccatagt taaatgaaat ttgtatatag cgctaaaatg aatatggagg aatacaaatg
98761 agaatgttaa ttggaacagc tgcgaatttt gtttcagggt attatatagg acgaaattct
98821 gggttattag gaacgttgct tggatgggct tttttgttgg gtggtggcta tttgttaata
98881 gaaaattggg atagcatcac agcatggatg catagtttga atattgtacg agggttagat
98941 ggttatgaag acatgagcaa tggttttgtt ttcatctgtt tggtagtaag tggctttatt
99001 ctcatcttgt tgtctccgct tttcattatt ttattaatag tttgtttcgt tttaatgaat
99061 attgttgctt gtacacttgt gttattaaca tcaccaagta catatataaa gaagaaagat
99121 aaggagaatg aatgggaatg agtacaattc tagttttagg tggatcaaat ggaagaacgt
99181 tagagaagtt ggccaaaaaa agagactgcc aggttatttt ccatgatggg aaaaatcacg
99241 gtggcgtaaa gaaaacgttt cgaagtgtga taaaaaaatg cgatgttatt gtcattcaaa
99301 aaggtgcatg tggtcatgta tctattgatg tagcaaaaga gtacgcgaag aagtatgatg
99361 tcccattatt atttaatcag ggatttggtg gaaccggtgc gcttgaaatg ggattaaagc
99421 atttgaaggc tgcatgaggt ttgatacata tctaaggaat tataattgta aaattaatat
99481 ataacattaa aaaagagaat gaaaagcgat gctctactta ctttaccggt cctccagaag
99541 atatagatca cgtttgcttg gattatatga agggacgttt tgcaaatgtt agaacaaaga
99601 agcaagttga attcataaaa cgtagatata aagaagcata tcaaacggta attggtgtga
99661 tggacggatt aaaggtaggc gacaaggtag taatacacac ttgcttagag tcaaagcgtt
99721 atgacggaaa agtatggact tgtaggacaa atcagtttac agcagagagt ggcacgcaag
99781 tggtttttct agaagggttt agagggtact ttgcagttaa gtttttacaa cgaattagtt
99841 tgttagaaaa ctaagcagaa tagttttgtg ggagcgatta gtagctgaaa tgctagttat
99901 ctagcctttt tgtgtttatt gtttttgtaa tgagcggtat caaaaagata aagaaagtgg
99961 agggtggaaa taagaatatg agtagtggta ttagatataa atcgggtttc gttattttaa
100021 tttattttgt tatgacacaa tttgtaggga taataggtgt acaattacta gcgaagacag
100081 gttggtatga tattcaggga aatcaacagc aagcaatcca acaacttctt gtgcattggg
100141 acctaattgg gttttcactt atgctgataa tcatctttct tatatatggt aaagagataa
100201 taaatgatcc aaagttatcg attaaattat caagaaattc attcatatgg attttagttg
100261 ggatcatatt cgtatttctt gcgcagatag taggtagtat gttagataaa agtatatttc
100321 agttaactac tcaatcagca aatacgtcta atatagtcgc tgctgcagca atatctcctg
100381 tggcacttat ttcaattgtt cttcttgcac cgttagtaga agagtttgtt tttcgttatg
100441 cggccataaa cattttaatg tctaagttta agcaaacttg gagcatacta ataagctcat
100501 cgttcttttc tatcatgcat tttgattttc catttatatt tggatacttt ttaattggag
100561 ttatactggc tttagtatat gtgcgtacta ataggttact agtatcattt gttgtacatg
100621 ctagtatgaa cttaattgtt gttatactcc agatttcttg atgaaaatgc agtggattcg
100681 cgcaacttac tagagattta ggttttttgt ttaagaattt taaaatgtgg gttcaagttg
100741 ctgtatcgac tgaattgcac caaaaaaccc aattccatta cacgggaatt gggttttttg
100801 gtgtgtgttt tgttagcata atgattgacg gcctaaagga gagttgtttc tttgtagttt
100861 agtataactc aactacaaag aaagttcaaa ataaattgat aaatatttac atattttaaa
100921 aatacaaatc aaaaatgtta ggatatggtt tataatagtg gtgaaacact ctcctatgtt
100981 tctagtgatt ataactttta tctgttttgg tgcgaaatct gttgagggat tttgcacttt
101041 tttatttgtt gtttaatagg atttaaatta tatagtgacc actatttctt gtaaactcct
101101 tttctccata cccactcaat aggaccatag cggaaatatt cactccacat tttgctgaat
101161 atcatttgta caaagataat caaaagcccg aaggtacata gtttccagta atatacctgt
101221 gagacatctt taaagtacaa cgaaagtatg acaagagtta gtatactttg gctaatgtaa
101281 ttcgttaaag catacttacc tacgttcata aagggctgca gccactctat atatttttta
101341 ttctcacaaa ctctaagtag agtacaaata tagaatatag ctagcgtttt ccctccaaat
101401 agaatccata gttgtacatc cttagagtaa tagacatcca tttttataaa atagtagata
101461 ataggacaag agagaagaca tgaaatgcat aacgaactcc actgtaaaaa tctaatcttc
101521 tttattaacc ccggtatcct tttaaaaata tttttcttac cagcccataa ccctattaaa
101581 aataagccta tatattccgg aattcctatt agtagttgct ggaattcctg ggtcattaga
101641 aagaaaagac gtgcttttac ttgatgagaa taatgtataa atagatttac ggtgtgattg
101701 gtagtgttac ctgtaaacat atattgatag taatttggta cttcagtaat agtagaactt
101761 gctcgcaaaa atacaataat atgtaataca taactaacca gtaagaaact acaaccagct
101821 ataaaaataa gtttagtaga tcgcttataa aagaataata gaataaatcc agctaaagca
101881 tacgcatgta gaatatctcc aaaccataga agggtgaagt ggagtaaacc gaagactagt
101941 aagatataca gtctccgggt aaatagctta tacataggat atccttttgc ttctgtattt
102001 ttcataaaga tataaaatcc taccccaaat aagaatgcga aaatagtgta gaactttgct
102061 tgtataaaca aatctactaa aaaacgaatc gctttatctg taccggtgta acctgcttga
102121 ttaaaggaat ctagtcctgt catagtgggc agattcgcaa aaaggataca tagtatggcg
102181 atacctctta ttatgtctaa agaatgaata cgggcgtttt gttgcatgtt aattctcctt
102241 tcttccaaag aaaaacgagc actatactag ctagcgctcg aattacgtct tgcaaagaat
102301 ccatcatagg tagcagctga cacggctcct tctaaacgtt caacttcttc acctctgtta
102361 taagctacaa caactggagt gcctggaatg tcgaactctt gaaaggcact ttgattttct
102421 gaggtagaga tatcaatacg atagatagtt ctatcatgct tttttgacat acgattgata
102481 tctggtgcag cctttttaca ataatgacag gttggttgat agtaatacgc aatgaactct
102541 tcatgggatt gtattttttg ctttaattct tcttttgaaa tatcttttat attttcaggt
102601 aatcctttta catctgcagc agatacaatt gttttttcag gtgttactat ttctgttttg
102661 actgattcat ttttagttaa agtaaagatc gtgataccaa taacacataa agttgttata
102721 actgctccga ttttgtagat ttttttcata gtaaattcct ccttaaagta aaaaaaggac
102781 aaacttcgcc cgagttaaca gggcgtaagg tttgtccttc acgctacgta caatagagta
102841 taaacaatgg aaacaaattt tctatctata taataccata agatttatat agaatgctat
102901 agatgataag aatccaggat aaaaaattga taacataatt cctaatttat ttgtttggtg
102961 ggagaatttt atatactaat aacatggtgt gaataacgat tttattaact gtatatgtct
103021 aaaaagatga tgattatcct attttgtata attaagaagg aattagaaat agaaaggaaa
103081 ttttataggt taattgttac aacttatggt tatgttagaa aaatagttgc tataacatta
103141 atttgtgtat ttaaactaat tgcagtgatt tctttttata aaaggggtta aaaatcgtat
103201 ttataaaaat agtaaagtaa ttgttaaaaa gttagagcgc aatggggaat agtattaaaa
103261 acatagggag cataaaataa tacaaagctt aatatacttt aaatagttat tagttccatt
103321 attatagttt atgagagaat aaaattctaa attaagtata gaattttatt aatatttcag
103381 tgcactgaga tgataagtaa ggagtatata gaattaactt attagtattt atattaaagc
103441 caaccttaag gactatagaa aacccttaag gttgtatact aaataaaaaa gtaatttatt
103501 aaaattatta atggatttaa tagaaaatta acttttttaa ttattacagt agtaagctat
103561 ttctttattt aacaataggg aaaacatttg tatcaaagaa aattcgaata tcgtatgttt
103621 aatcataaat gactggaatt ttcacatgta ctttactatc tagaatattt aataagttat
103681 ctacttcaaa ttctccaata cgtgaatttt cctgaatatt tttctccaat acggctgttt
103741 ctacaaattt attccctttt ttgatttgta aacctttaat ataagaacta ctgtttacct
103801 taaatgagat atatttttta ttatttttaa ctgttaaggt tgctggtgat tttacatagc
103861 tgttcattct agactcatta tcattactac tttgcaatac tttaaaatta acagtatatt
103921 tcccatctgc tagtagtgta tcggctttag ttatttgtaa tcctaatgtg gttatagaaa
103981 ttaatatagt aaatgcaaca atgatttttt aagtgtttta acatgttata ttcatcacct
104041 ttcaatattg tttattaggg tggaatttgt taaaaagtct ttgtaataag cgtttaatat
104101 ggcattgcat aaaatttcac aaagctatat ccaactatag tcactatata gacataataa
104161 taacctttaa tattgtaaag aaaccaagga gcttaaaaaa tcgtactcat gtctataaat
104221 gtaattccaa acaatgatca atattgataa tcattatcaa ttgtagttaa aaaataaaag
104281 gtattacctt attacctctt tgtgcacata tcttttactt gagagactat tgacgaatca
104341 catcctttca aaaatttcta aaatcaatct tagcctaata ataaaacttt tgtcaattgg
104401 atttttacac atattaaatc tttataaatt taatatgtgt aaaaacaaaa gatatttaaa
104461 agtctttaat ttaaaaaata taagttatga tatttagtaa tagattttgt ataaatttta
104521 ttttttatat ttttttatta tttccattag ttgttttctc tcatcttcaa tcgttttttg
104581 ggacgggatt tgaggtttac tcctctcacc taatgatagg gtttctgtat ttttctgttc
104641 agataaccat tctggaacaa tttctgttct gcatcttctt ttttttgttt tgggtataaa
104701 actattttct ttttttctac gaatttctaa ttcttcaatt ttattctcaa tagatgtaat
104761 tagataattt tcgtagtttg gtacagtacc tttattgtaa ttatttatac actttttcaa
104821 tacagaatca aatgatcttt tttgtatatt atttttgaat atatctctaa ccttattgtt
104881 aatttttgat atttcgctat caatcaagag tggtgtggga tgcatttttt gattaatggt
104941 ttctatttca ggtttttttg tattattcct aattgtgtat aaaacagtcg gtttatcatc
105001 ttcaagattt ttttgtgttt ttttgtttac tttatctttt gtatgtgtac caacagtaca
105061 gtactgagag tactgtactg tcggtacact actctcagta ttaaaagttt caaactgatg
105121 tacattgagt acatcagtta aatctctatc aatatcaagg gatccaccgt tcatgggact
105181 taaggatttt actgaatatc cagaatatat taattctgta atagtacctt ggataaattc
105241 cacaaattcc tcagatttaa atggaatatc agatacatta taaaaagatt gtttttttcc
105301 gtttacgtaa cagttaaatc caattatata gttcttattg gcaagttctt tccaagcggc
105361 atctatattt tttctgctaa atttcttata aagttgtgtt ttataaataa tccaatcact
105421 aggtaggctc ataaggtgag aaagaagacc aattgcacgt aagtcaacta aatcattttg
105481 taaaggattg ttatgaattt gagcatattg tatggtgtgt cttcttttta ttacattgtt
105541 cattatttaa tttctccttt ttagagacaa aagaaaaagg catttctcct aattttaaat
105601 attagaaact atgccacttg caagccttgt ttaaaaattg tataatagta gtaatagttt
105661 ttaaacttaa aaaggtacaa gatgcatttt gttctttgaa agacgttcta aactttggtc
105721 ggttgggagc gtttttcttt ttgtctataa ttttttattt tttctagcag attaatactg
105781 taatagattg ttaccagatt tcgacagtcg gactaaactt aatagaaaaa gaggttcttt
105841 acatataact aaaggaaaaa atacctaaaa cagcatttgt tttaggtatt tttaattaac
105901 atagattata tggctttaat tttttatact catttttaaa ttaattaaaa ttttaacagt
105961 ttaaatccca agattgttac cgtggggaaa cgtagggatt taaactgtta agtgatgcat
106021 gtttaataat tcattagact acatacagct atcgattgga aattgatagg ctgatgggac
106081 acaataaaat gggaatggta tttattgcct aattgaatta ttagtgaata gaatagatac
106141 tggacttaac agaggtaaac aaagtatcca tctaaataat acaatcaata tgatatagag
106201 cggagtttga aaaatacttt tataaagggt aaaaaataat acataataac ctttgcatgt
106261 cgctataatt aatttgatat atccctatcg ataaaaacaa acaacactta cattatttgt
106321 aagcgttgtt tgtttttatt taaaaatcta ttactactgt aatttttgat aatataatgc
106381 tctgttatat gaaataaagt atttattatt taagtaaaaa gaaaggagtt ttacagattg
106441 aacgtaaaat atggtcttat aatgtttata gcgcttttac taggactagt cctttttgga
106501 tattttaata tgcaatacac tgatgattac aatcaagaat ggacagcatt taatgggaaa
106561 atatatagaa tacccaaaaa tgaatgtggg ttaaatggtg gggggaattg atcaaagatt
106621 aaagttagat tgtttaatag gatatgccca cgattcgata aaaagaattg atatgttaga
106681 tggagaaagg tatatataaa tgttaaaata atgtatttaa tatataattt tgatgattgt
106741 tcgtgctact gaattaattg cgatatacga ataatataat taataagttg aactatctaa
106801 tttgttaaga aacgtaattt tacaaagtgt caaaggaata taaaatttaa attatatcat
106861 aaattataaa aaaatcttta tttaattatc tattattctt cccctaacaa aaatgctatt
106921 aatttataca ttgcttttat aatttgtata tgtgtcagtc atatgttttt tctaaaagag
106981 gagaaaaatt caggttatga acataagtca atgcacacag agaaaacgca catagggaaa
107041 tttaaacagt gcataaagga gatttttatg aaaaaaagaa agataaaagc tattacgtca
107101 ttcacgttaa taggaagtat tttatttgga ggaaatatta attccacaca agctgaaagt
107161 gattttaaaa aaatagttcc agatcaaatg gtcccagcat ttctggacgt tccatcaaat
107221 cattgggcaa atgtagctat aaataatctt ttaaaaaaag aaatcatagt aggttatggt
107281 aataataaat ttggattagg tgattcagtc acaagggaac aagtagctgc tgttatttat
107341 cgtattaagt ttcctgaaaa ggaagtagag gcagaagctc aaaatccata tcgtgatgta
107401 aataaaagtt ctactatgtt tttagatgaa attttgactt taacaaaaat ggggattttt
107461 agtggtgatg agaaagggaa ttttcgtccg aaatctccaa taagtcgtgc agagatgacc
107521 caggttatca aaaatgcttt taatatacct gtagtaggaa aacataattt tcgtgatgta
107581 gcgaaagatt actgggcaaa tgatgcaatt agtgctttac agtcgaatca acttgtctct
107641 ggtacaggga atggattatt tgaaccttat aaatctgtaa cacgtgaaga atatgctcaa
107701 tttatattta acgtgttgaa ttttgaagat ctagttaata aagaaaagca attagatgaa
107761 ttgaataaaa ggcgtgatgt aataaatcaa aaaatagatg aatttgacaa gttaaattca
107821 caacgtaagg atcttgaaag aatgctggaa gaattgaatc aaaagttgtc acagcttaag
107881 cagcaaagtc cacagcttca agatcttaaa aataagttaa aggaatctca aagtcgacta
107941 ttggaattaa ataaaaagga ttcaaatcgc ttagaactta atagtgagat taagaaactt
108001 aatgatcgga aagctgaatt attaagtcta attatggaat taattaaaca acaaagtgaa
108061 tttgataaga aaataaaaaa tgaaaaagat gatcttaata aaaagcgaga agatttaatt
108121 aatcgaatcg ctgaatcaaa ggaacttgct aaaaagaaag ccgaacttaa tactaaattg
108181 gtggaacttt ttaaagtgca agaagcattg aacaaaaagt ccggtcagta tttgtattat
108241 ataaacaaac tagataatga attaagggaa ttagctgata aatataaaaa ttctgataat
108301 aaaatatcga gattaaaaaa tcacataggc gaatataata aacagttaga aaaaattgag
108361 aacgagttag aggaatgtaa taaaaaaata gataatacaa aaaaacaatt agctgaattc
108421 gataaatcta acaaaaaaca acaagagtta gagagtgagt tagtgcaact taataaaaaa
108481 attgatgaac taggcaaacg acataaacat cgtcaagagc ttgaagcaag ccaaaaaaaa
108541 gctctcgatg aagctaaaga aataaataaa aaactagctg aaaaagatcc tgaacgccaa
108601 cacattaatg acaagctaaa aaaacttaat aatgattggc gattaactaa taatgaatta
108661 aatagattga acagtgaatt acaaaaggtt aacacgaagc tgttaggtta tagtcaagaa
108721 catcaatatt ataatgctct taataaagaa agaactgaac ttagtaaaaa ggtagatgaa
108781 atttatcaaa aacaaagtga gattgacaaa aattatattg aactgaatag acagctagat
108841 gaacttagta accctaaacc aaatgagcaa gtacaattac ttaaaaatca aattaacgaa
108901 ttaaatagta gtattaacca aattcttaat catagaaaaa atgaaattaa taatattact
108961 cagagaaaag atcatataat tgatcaacta aatcaatttc ctaaactaaa cttagaatac
109021 caaacagtta aaaatgaatt aaatgttata gatcaggaga ttggcaaatt ggttcaatcc
109081 aaagcttaaa agaatagaaa atcatcataa ttcctaaaac aaacaactgg tcgaactgtt
109141 aactttaaat caaatattaa tttattaaaa aatctaagtt ttttggtgaa aagacaaact
109201 tctataagaa agtttgtctt ttttaacata acgttagcaa taaatagtct attttgaagt
109261 taagtacaag tttatatatt gtttggaggt actattatat atgtttaatt ttgatgtatc
109321 attcctaaaa tggatgaata atatagaaaa tgttacactt tcatcatatt tgaaatttgt
109381 ttcaaatatg gcaagtgaaa cgttatattt aattatcatt tcaatgatat actggtgtgt
109441 atctaaaaga aaagcatttc atatgataaa tataatttgt atatctggat atattagtgt
109501 aatgacgaaa ggttttttaa aaataccaag gccatttact tacgatggga tacaggccct
109561 atatgaagag tctgcttcag gttattcttt cccgagcaca catgtacagt taacgacaac
109621 attttggagc tctttaatgg ttttatttaa aaagaaaata atttatttga ttggaactgt
109681 atttattgta cttatcgcta tatcaaggct atatttacgt gtacattggt ttagtgatgt
109741 gattggatct attataattg gtgttgtaat tatctgttta tatgtgaaat ttataatgaa
109801 aataagtgat ataaaaatac cgtttttgca gtgggggata gtaatattct ctcttattgc
109861 atattatttc acggatcaag tagaaaatta taaagtacta ggtatcgcca cagggactac
109921 gataggtatg atactagaaa gaaagtttgt taattttaat gaaaagaatg tatttatagt
109981 gcaactttgt aaaataacaa caggactttt ttttgtgatg gctatacaag tcatactaaa
110041 aaaatccatc cctgagctga tttttgtccg ttatgcaatg acaggatttg caattacttt
110101 tatatgtcca tatgtattcc gtatttttca tgttcataga tagaaagaag atattcacaa
110161 aacaattacg tcctcgtgaa aaaataagtt taatgttcaa aagacctcta agttgaactg
110221 tatcctataa aatggacagt ttaataaaaa agccctgaaa aatcaagcac ttaaaagatg
110281 gttccgatat tcaatcggag ccatcttttt taatgtccac tgataacgat tataattata
110341 ctcctccatg taatctttta tgttgagctc aagggattca aagatttaac aatctttgta
110401 atctaattca tcgccaacgc ttcaagcatt gttttggttt cttctcacca atcacagcta
110461 agtcaaactc attctctaaa aagatttggc taggaccttt tccttgttga ttttctttta
110521 ccgctcttat tttaaaatct ggacaatagc taattgaacg ttccgacgct tttaatacat
110581 ttttattttt ttctagctgt tttatttgaa tctctttaaa aataatttta ctcattctcc
110641 gtactcattt ctatcgttgg ctccattata atgaggtttt ttgataaaaa tacacaaaaa
110701 ccccgaatca tggggctttt ttaagtgtcc ataattcggg ggacagttca ggtaaagccc
110761 aagatgtctt ttctaattgt acaaaatctt accactataa aaggttcatt gttaaagtta
110821 gaagctaata attatctatg gaagtggagg aggggattta atggatttgt acattggttt
110881 ggttacagtg ttaatagatc taggtataat aattatttga ttgttataaa accttaaata
110941 tatacgtttt tactctttat atctacactt gttaaaggta ataaacttat taaaaagggg
111001 tgaatttagc tttattaaaa gaataaaata acagtatatt gtttgtatag taggatatat
111061 ttaattcagg cttggataat aggttacagg gtgttttata tagtatcaaa tccggtagtt
111121 ttaaaaaatc agatgttaaa aactgataat tcgaatcacg tgacgaatat atctgttaaa
111181 gttgaatgtt ttagggatat attttgatta attattttct tttgttagaa gttattccgc
111241 agtatgacag tgtaggatta tatttgttaa tttccatcta ttattcaaaa tgccttgaaa
111301 attaatattt aaaaaatata tttctttttg atttattaat acagaataaa atacataagg
111361 agaatccatt ttagatgaaa aattttttta taaatattaa accttatacg tcctatgaga
111421 aatttagatc gtatttaccc aaaggagaaa atagtttaaa gcaaaataaa ataaaatctt
111481 ctttaaaaat gcccttcata ttacttgttt tttctttatt gattgtagca atgtactata
111541 ttaactttac cattcgtgga agttttagtt tgtttttagg gatatatgga acgctgatgg
111601 tgatttactt acttggaaaa caatcattat cattttttta tcgaccaatt acaggtgata
111661 aggttccaaa tatgaaagtg gcagtagtgg tcccctcata taatgaaagt gcaagtgcta
111721 ttgttaatac aattaatagc gttttagctc aagattatcc aattcatgaa attttctttg
111781 ttgatgatgg tagtaaggat aaatcggctt atgaagtagc acttaaaatg agggaggaac
111841 ttcttagaac tcaacgagaa attgctgcta caactaagaa taattgttct gaaatattag
111901 gtattcctga cttaatcgta catcgtttac ctaagaattg cgggaaaaga catgctcaat
111961 tatgggcttt taaacggaca acagcagatg ctattgttac cattgattca gatggtgatt
112021 tgttcccaaa tgctgttaga gagttattga aaccctttaa tgatgaaaaa gtaatggcca
112081 caactggtca cgtgaacatt cgtaatagaa atgataattt attaacaaaa ctaattgata
112141 tgcgttatga caatgcgttc cgtgtggagc gtgcagcaca gtccgtaaca ggaaatgttc
112201 ttgtttgtag tgggccgtta agttgttatc gtagagaagt aataactgaa aatttagaac
112261 attatggaag tcagatgttc cttggtgagg aggtgcagtt tggagatgat agatgtctaa
112321 ctaattatgc tattttgaaa gggaaaacag tttatcaatc cactgctcga tgtattactg
112381 atgctccaac tacattaaaa caatttctta aacagcaact acgttggaac aagtcatttt
112441 ttagagaaag tttaatttca cttggcattg gtatgaaaaa accaaatgtt cttgtttgga
112501 caattttcga aatatcgtta tggattttat ttgggctttc cctacttcta agtattattc
112561 tcaaggcaag tcatgtaggg ttaattttgg ctgtttatta tttgggttat atttcgttag
112621 ctgcatatgc tagaaatgta ttttatctat taaaacatcc ccttactttc ttactggcgc
112681 cattatatgg aattctccat gtattagcac tattacctat acgcttttat gctttactaa
112741 ctattaaatc taatggttgg ggaacacgtt aattacagta attttatgta ttttttttag
112801 gaggatatta ttaagtgaag attagaaaag cgattatccc agcagcggga ttaggcacaa
112861 gatttttacc cgcaacaaaa gcacaaccta aagaaatgtt gccaattgta gataagccaa
112921 ctattcaata tattgttgaa gaagctgtta gctcaggaat agaggatatt attattgtaa
112981 gtgggagagg gaagcatgtt atagaagatc attttgataa atcttatgag ctagaacaaa
113041 ctttatttaa gaaaaacaaa ataaagactc ttgaagacat tgaatgcatt tctaatttag
113101 cgaatatcca ttatattcgg caaaaagaac ctaaaggatt aggacatgct atatattgtg
113161 ctagacgttt tataggtgaa gaaccttttg cagttttact tggtgatgat attgttagct
113221 ctacgtatcc atgtctcaag caattgatag atgtttatga ggaacatcac tgttcagtgg
113281 taggtgttca aagggtatta gaaacagaag tgtctaaata tggaatagtt aaatcggcaa
113341 atcaaaatgt taatcaatct attattccta tttctatgct agttgaaaaa ccacctctgg
113401 aaactgcacc ttcaaattta gctataatgg gcagatatat actaaaacca gatatttttg
113461 aggtgttaaa aaatttacct gtcggatcag gtggagaaat tcagttaacc gatgcaatca
113521 atgttttaaa taaacaacaa aaagtactcg cctttgaatt tgatgggaaa agatatgatg
113581 taggggataa atttggcttt attaaagcga ctatagattt tgcacttcag agagaaagtc
113641 taaaagaaga tgttttgagt tatttgagaa atatcactcg agataaactt atcaataaat
113701 aaaatatgta aaaagtgagg aagtcttaat gaatatatct atagtaggaa caggctatgt
113761 tggcttagta acaggtgtgt gtctatcaga agtaggtcat aacgtcactt gtattgatat
113821 agacgaagaa aaagtaaaaa aaatgaaatt gggttattca ccaatatttg agccatgttt
113881 agaggaatta atgaagaata atattataaa gggaagatta cattttacaa ctaactatgt
113941 tgatggagct gatggggcag aaatttttta tattgcagtt ggtacaccac aaaaagagga
114001 cggttcagcc gatttaagct ttattaagca agcagctatt aatattgctc gtacaattaa
114061 gaatgatgtt attattgtgg taaaaagtac cgtgcctgta ggcaccaata tatatattaa
114121 gaatcttatt ttgaaaaatt taaattatga tgtaaaagta gatattattt caaatccaga
114181 atttttacgt gaaggttcag ctgtaaatga tactttttat ggggatcgta ttgtaattgg
114241 atcggaaaat aaaacatcgg caaatgttat ggaagaagta tataaaccct ttggtacacc
114301 aatattcaaa acagatatcc aaagtgccga aatgataaag tatgcgtcta atgcattctt
114361 agccacaaaa attagtttta ttaatgggat agcgaattta tgtgaaatgg ttggagcaga
114421 tgtggaaaag gtagcacaag ggatgggaca agataaaaga attggttctc aatttttaaa
114481 tgcaggaata ggatacggtg gatcatgttt tcctaaagat acacatgcgt tggttaaagt
114541 ttctgaaagt ttacaacata aatttcatct tttagaatct gttattaagc tgaataaaaa
114601 tcaacaaaca gttttgatag aaaaaataaa aaaacgtttt ggaagtattg ttggcaaaaa
114661 aattgcttta ttaggacttt cttttaaacc gaatacggat gatttaagag aagctccctc
114721 tattcccata gcaagaaaat tagtagaaga aggtgcacag gtgattgcat atgacccagt
114781 tgcaattaag aacgcgcgag aagtgttgcc taaagaggta cattatgtat attctactat
114841 ggaggctctt actgaagcag acattgcctt agttctaaca gagtgggatg aagtggtcga
114901 ttctttacta ttaaaagcaa gtcaattaat gaaagaaccc gtaatttttg atggtcgaaa
114961 ttgtttcgaa cttaatgagg ctaaaaatta cgatgttgaa taccactcga ttggaagacc
115021 ctcagtttta agagaagtaa aaggagagat aacagcttga gatttaagtt ataaattcaa
115081 gctgttgaat tagaaataag aaatatgaaa ctacttatta cttatactat ataagtaata
115141 agtagtttga tttatttata tctatacacg gatgatttta aatgaaaaac aaataatata
115201 tacagaaaca gtaataggaa aagagcgtag tttatatata gggctttaga gcgatggctt
115261 attaaatata agtttaatat ataagttcgc ttgtagttgt taaagcatac aaacatgttt
115321 aaatgatgtt accacgataa agtatagctc ctatgattaa caaaggaata gaagcaagaa
115381 gggagcttta ctgattataa tataaaaaat catttcatta aaggtacaag ttttacgcta
115441 gaataaaatg atagattcac tatttttaaa agtaaattag ttactaaaag tctatactca
115501 taatgatata aaatgttttt gattaaaggg gatttataaa catatcgctt aacaatatat
115561 ttaatagcaa actgtttttg taacaatcgg tacctacaaa acagagttga gttttattaa
115621 aaatacttta tatgaaggag aattaatata aaaaaacttt atatcttata caattgatat
115681 tgctgtttag cctaattgtt ttaataaaca taccgataat tattattgta tatttgtttc
115741 tctttatgac tccaacaggg acaccagtta tcttattaga ttacgccgtt ctacttggat
115801 taataataat agttaatata ataatagtcc aactattttt ggcccttaaa acattgaact
115861 ttaaggcttt tttatatggt ttactcgtag gcttattgca gacaattggt ttatatatgt
115921 ttcttgatac ttctgtaaaa ttgggtttgc tttttattat aatttctatt atagctgcgg
115981 tggtattgtt aatattagaa ttgaaaaaat gctacagctt ataaatcagt aaaagataat
116041 aaatttaagt ttctattatt actttataga tacgaagtgc tacaaaaagt aattttgaaa
116101 tcaacttttc cctatccaac ttaatattat agaaagttgg aaaataaaag ataaggtatt
116161 aagtaattaa aaacctcatg gtctatctga agtgaatccg aatagtgagc atgaaaaaaa
116221 cacctccatt aaattcacat actttgtgaa ctgatccaat gaaataagac aaggaaaaaa
116281 cacctcttat accgtattta atttaaatac gaatatacgg aggtgtttct tttatgggaa
116341 cgagaaaatc ttattcagaa gaaattaaat ggaaaacaat cgaactgaaa aaacaaggat
116401 acacaaacaa agaaattatg gaacaattag gaattaaaaa taaagcacag attaaaactt
116461 ggatgaagtg gcatcgtgaa ggtgaaacgt atcgttttaa tcgccctgta ggaaaacaaa
116521 gtacgctaca aaagactagt gaagaaggca taactgaaat cgagaggagt tggttaaaga
116581 agtagttgta gaagtagtgg agttgatgaa agatgagtac tccattaaag agatatgtat
116641 attaattggt atacctcgtt ctacttatta tcgatggaaa aataaagaaa aagatgtaaa
116701 ggaagcaaaa ttagaacagg ctattttgac aatttgtatg acaaatcact ttcgatatgg
116761 ccatcgaaaa gttactgctt tattgaaacg aaaatataat tatcacccaa atcgaaaaac
116821 tgtacaaaaa ataatgcaaa agaaaagttt acaatgtagg gttaaaagaa agagaagaac
116881 ctggatcaat ggagaaagta gaattgttgt agagaatctc ttaaatagaa actttcaagc
116941 taacaagcca aatgaaaaat gggttacaga cattacatat ttgccatttg gtacagagat
117001 gttgtattta tcaagtatta tggatttata taacaatgaa atcattgcgt atgaaataag
117061 taacagacaa gacgtaacac tcgtcttaag aacagttgag aaggcgataa aactgcaaca
117121 aaagactcaa attatactac atagtgatca aggggccgtg tatacctcct acgctttcca
117181 aacgttatct aaaaaaatgg cattaccaca agtatgtccc gtaaaggaaa ttgtcatgat
117241 aatgccgtaa tagaatcttt tcattcctca ttgaaatctg aattgtttta ttcccaagaa
117301 aaacaaatac attcaacttc tactctcaaa caactcattc acgattacat tgagtattat
117361 aatacggaac gtattcaaga aaagttaaac tacctgtctc ctatagaata taagaaacag
117421 gtagcatagg tgtttttttc atgtaccaaa ttcgtgggtc agttcactta gtatgtggat
117481 ttaatggagg tgtttttcgt ttgaagacaa gggtgcatta tctagaagaa ataaagtgaa
117541 aagcgatgaa aatgaaacag gatggtcatt ataatttcct tattttagaa aaaacagaat
117601 taaaaatgtt ccccaaatta aaccatgaat gaaatggtgc tgaatagatt aaacgtaccg
117661 tcttcaacaa actgtaggaa aacaatactt ttatgggaaa agccaaaaga gctaagtgaa
117721 ttggaacagt tatgattaga aaataagcgc taaataacaa aattaaccat acaagaactg
117781 agtaaaatat tagaattacc acgtttcaca ttttatcgtt ggttacagac aacagaacgt
117841 cctaaagacg atacagaaga gaaggtctgt tttagatata aattaagata tggaacctgt
117901 tctagtttcg catcaattag aatgccaatt tgaagtggca atcccaaccg aaaagggagt
117961 tacagatgtc acgtatctat tatttggaga gcttacgttg tatttatcaa cgattataga
118021 tgcttctaat cgtgaaatca ttagttatat catcagtgaa ttacaaactt tgacattaga
118081 tttgaggaag ttaaaacgag caggaagagg ccgaaaagta gaaaatgtca tccgtcactc
118141 agattaagga agtattttat attgcgaagg aattcaagcg tatgccaaag aaaaagcaaa
118201 tctttttatt tacaaaagat aacaaaagta tctgacacaa ctgtgcgaat tcaaaaaaat
118261 caaaccacct atcccttaaa gaatatagga aacagatggt ttaggtattt tgatatgcgt
118321 cccgtttttg ggttttactt catagaccaa gagatttttt gttttaaagg gagttagaac
118381 ctttctatta ttcttaaaag tctataacat actgtgtact aagctgttca ccctaaactt
118441 ctatacaata atttcatgaa atttccgaaa aaaagttgtt agatttttat tattttgcat
118501 accctcgatt gtctcagggt ccaaatggat taattttatt aattctcctt ctttatctat
118561 tccgactact gcttcgccat cttcagaacc caaaaaacat cttttagatt tcagtcctaa
118621 tgaattataa tatttttgga tttctaaagc taatttctca cgatcttcaa tatattgctt
118681 aaccatttta tttggtatta aatatgcatc tattttagtg tctccttcaa ctaaaatgtt
118741 tttttattta aattccactt ttcgtcccaa taatgaataa aattccaaga aatatatatt
118801 ttctcatttc tagaaaacat atatttgctc aaaataaata taaattcttt ataattcact
118861 tcgtaatatt cagggatttg agaatagaga agaacatact ctgtgtagtt gtgattatct
118921 attgtatagc tcgttttggt aacgaatggg attttatcta taaatttttt tatacactct
118981 tcattattga agagtcctat tgtatgcttt tccttgcctt gtattaattc taataaaatc
119041 attataatta attctcctca actcttttat tattcagatt tagtttgttt atttttggtt
119101 ttatgtgtaa atggtagata tgacctattg gaattgtttt attggaaaat ctcttcgtat
119161 tctttatatt tttttgtttc tagagttttt aggtattctc caacatttag aaatttaaat
119221 ccagatatag aaaaaggcca atctttaaaa agatgtccgt gtgttagata attcaatgtt
119281 aaatttttat ttttttcatc aatagtacat tttatacagt aaccaaaata atttaaattt
119341 gttttatcac acatagggtc aagtattaaa tttttaatgt cgttattttt ttggaaaatt
119401 acaatttctt tgagctcata tctctcagct aattgatagg ctctattaag gatccaatca
119461 tcattttgag tttctctatt tttaaaatct ttttcaataa gtctatcttc atttcttgaa
119521 atccctatat gatcctcagt atttttatag taatctaata aattagttgt tgaaatacca
119581 tatgaaattt tcatgaaatc acctcgttta ttagtttagg tctaagtttt tatatagaat
119641 ttttatctga tagcttacaa aaaggaatca tttctaccac tataagaata tatttgctat
119701 aaaagagaca ggactgtcag tcctgtctct tttatactgt gcttttgaat gattaaggga
119761 aatcgttttg gaatttaggt attcaatttt tattctcaat cttattataa cttaagtaaa
119821 aagtataaaa tttttatttt taactatgaa aaagaaaaaa agaaacattt tacaggttag
119881 atatatgtta ttattatctg ttttaaatgt gtatttagaa taattaaggg gttatagctg
119941 ataataaacc attttctgga aattaaaacc ccaaataaag acacttatat aagtgtcttt
120001 atttgggttg tgtgcataag agggaaactg catagattct attttgatat tgatatctat
120061 aaattaatca tagcaccttt gggagtgtaa attttttttt ttgactatac caaagggaaa
120121 ataatattag atttactatg ataattttat atggatctat tactttgacg ttttttaata
120181 tagataataa ttaaggagta cgaacgtatt acaacacttg gaataaagat tgaatcaatg
120241 aataaagcca ttatgtgaat ggtaagctta gaaagaatcc atacaactat actgttcgta
120301 cagaagtgat agagttgttt aaaccttata attgtgaatc taaaactccc aaaaagtaca
120361 tatatctata taatttcagg actgtcattg gcagtcttat ttttatttaa catcttaaat
120421 tatatgaaat gaaggtaggt gagtgtattt ccacccgctt taaattttac gtagtcatct
120481 ttatatacat ttgtatctac gtttacctta atattactga tataagcatg aatataatag
120541 taattgatta cccccttact taaagggata cgtcctacgt ttgaatcctt tctcatatct
120601 attatatcct tcacatacgc ctcatgcgta ggccaaacaa ctccttttgt atagagttgg
120661 atattcagtc tttctttcgg taaagtattc ggtttcccga caaaggtcac cccatgtggt
120721 aactcaattt caatatagcg ttttggtttg tcaaatgttt tataattatc tacatagccc
120781 cctagattca aactcatctc aattactgct gtcttggttt gttgattgaa gtttgcagtg
120841 ttagctgtag cactactcgt atgtgttaga tgttggtgag atttattatc ccagttttgt
120901 gtaaaggttc tgaagatttt ttgttctcat aactgtaatt caaaacgttg tcctcgtaac
120961 tttaacttgt caatagaggc cttcacatct cgaactgttt ttttagaaaa cgtatgtttt
121021 attacgccgt caactagtac ggcccagttt ttatctttcg tactaatgct tttatcaggt
121081 ttttgtgcat acatgctaaa tacactacct actttaaaaa aggttagttg tccgtcttta
121141 ctcccgagcc tatgaatttc atgcgatttt tgaacgactt caaattgttt tccttgtttc
121201 tttaccttcg gtagtttgtt aaaggcatca acaacctgtt ctaccttcgt tgattcatgg
121261 aaggaataga tttctttccc atccacacgt acagaccaag catgtctttt gttacttaca
121321 gattttccgt tgtttttact ttctactctg agagaattcc catcttgcgt aaagatcaat
121381 tgcccggcag cttctccaat tgttttagtg gaaaaagctt gagtggcagt ttctattgcg
121441 ctaggtttcg cagaatatct gcagcagcaa aggttgtccc tacccctcct aaagcaatta
121501 agccgaatga aagtgcggtg gttgttacga tatgtttttt cttcatattt taaagtcctt
121561 tcttaattgt caatatttga acctttaagg aaatagatgt tccattgtaa ctgtatagtg
121621 tttacgaagt tggaacttct agtaatttac tctttgtatc catatttttt gagaagttat
121681 tggaagaacg atctataaag gtcacatata gtacagctag cgatgttttt tatttttttt
121741 atgaaaaaat atcaagttta attgttaagt ttgaaggggc tatgttacta atttaaacac
121801 actgaaaaac ataatatata aataatgaac gagttatgtt agtatatttg aattttgtaa
121861 tttattttaa ttcattttgt tatttgtgaa attatatttt tcctaaggaa ggctcaaatt
121921 ggattggaag tacgcttttt gattaaaatt tttagaattg taaattacga atagtcagac
121981 ggcatttaga gagcactagc aaatgaaaca atattgtcgt tttctcacat agcatggtgt
122041 tacacaaatt atgttcctgt aaaggaaact attacgataa tgcagcgatt gaaaattcca
122101 atggaatcat gaagtttaaa tttttaaacc gaaatgaatt taagaatata gaatatttta
122161 agtacgaact agtaaaatac acagcgtact acaatcatac aagaattaat agaaacaaaa
122221 agtcatgagt ccagtacaat atcggattca tgacgaagaa gatacctaat caaataatat
122281 atttctcttt atggactcac ttcagaggtg ggttactttt ttatatactg aattaaaaag
122341 tccaagcact tatatcgtaa tagatgcttt ctattgacct tatagtcctt gaagttacga
122401 ctgaccaatt atgagacgtt tgcgctaacc tgctgaattc aaaatcggac ttagaaatac
122461 acatatagaa ataaacaacc taatccatgt cactgtaccg tttttttact aaataaacga
122521 aatcagtgta aaaatgaaca gctgaacttt atcaacttag aatctctttt tttactttaa
122581 atgcctagct gttttttcta atgtttgtat ttctaaatat atttaaatat gaattgtagc
122641 tgtgtgccaa gagttataat taatttaaat aagattatat ttgtaaataa aattgtaatt
122701 taacatgtag aataaagaga tttttagttt tattaacagg atgaaaatcc ataaaaccgt
122761 aaatgtgatt tctaaattag tttaaaataa aaaacaagga tttgctcaga cttgagatga
122821 atatctaaat atcaagaacc aaaggaggtt taagaatgac tagaaataaa tttataccta
122881 ataagtttag tattatatcc ttttcagtat tactatttgc tatatcctcc tcacaggcta
122941 tagaagtaaa tgctatgaat gaacattaca ctgagagtga tattaaaaga aaccataaaa
123001 ctgaaaaaaa taaaactgaa aaagaaaaat ttaaagacag tattaataac ttagttaaaa
123061 cagaatttac caatgaaact ttagataaaa tacagcagac acaagactta ttaaaaaaga
123121 tacctaagga tgtacttgaa atttatagtg aattaggagg agaaatctat tttacagata
123181 tagatttagt agaacataag gagttacaag atttaagtga agaagagaaa aatagtatga
123241 atagtagagg tgaaaaagtt ccgtttgcat cccgttttgt atttgaaaag aaaagggaaa
123301 cacctaaatt aattataaat atcaaagatt atgcaattaa tagtgaacaa agtaaagaag
123361 tatattatga aattggaaag gggatttctc ttgatattat aagtaaggat aaatctctag
123421 atccagagtt tttaaattta attaagagtt taagtgatga tagtgatagt agcgaccttt
123481 tatttagtca aaaatttaaa gagaagctag aattgaataa taaaagtata gatataaatt
123541 ttataaaaga aaatttaact gaatttcagc atgcgttttc tttagcgttt tcttattatt
123601 ttgcacctga ccatagaacg gtattagagt tatatgcccc cgacatgttt gagtatatga
123661 ataagttaga aaaaggggga tttgaggaaa taagtgaaag tttgaagaaa gaaggtgtgg
123721 aaaaagatag gattgatgtg ctgaaaggag aaaaagcact taaagcttca ggtttagtac
123781 cagaacatgc agatgctttt aaaaaaactg ctagagaatt aaatacatat attcttttta
123841 ggcctgttaa taagttagct acaaacctta ttaaaagtgg tgtggctaca aagggattga
123901 atgttcatgg aaagagttcg gattggggcc ctgtagctgg atacatacca tttgatcaag
123961 atttatctaa gaagcatggt caacaattag ctgtcgagaa aggaaattta gaaaataaaa
124021 aatcaattac agagcatgaa ggtgaaatag gtaaaatacc attaaagtta gaccatttaa
124081 gaatagaaga gttaaaggaa aatgggataa ttttgaaggg taaaaaagaa attgataatg
124141 gtaaaaaata ttatttgtta gaatcgaata atcaggtata tgaatttaga attagcgatg
124201 aaaacaacga agtacaatac aagacaaaag aaggtaaaat tactgtttta ggggaaaaat
124261 tcaattggag aaatatagaa gtgatggcta aaaatgtaga aggggtcttg aagccgttaa
124321 cagctgacta tgatttattt gcacttgccc caagtttaac agaaataaaa aaacaaatac
124381 cacaaaaaga atgggataaa gtagttaaca ccccaaattc attagaaaag caaaaaggtg
124441 ttactaattt attgattaaa tatggaattg agaggaaacc ggattcaact aagggaactt
124501 tatcaaattg gcaaaaacaa atgcttgatc gtttgaatga agcagtcaaa tatacaggat
124561 atacaggggg ggatgtggtt aaccatggca cagagcaaga taatgaagag tttcctgaaa
124621 aagataacga aatttttata attaatccag aaggtgaatt tatattaact aaaaattggg
124681 agatgacagg tagatttata gaaaaaaaca ttacgggaaa agattattta tattatttta
124741 accgttctta taataaaata gctcctggta ataaagctta tattgagtgg actgatccga
124801 ttacaaaagc caaaataaat accatcccta cgtcagcaga gtttataaaa aacttatcca
124861 gtatcagaag atcttcaaat gtaggagttt ataaagatag tggcgacaaa gacgaatttg
124921 caaaaaaaga aagcgcgaaa aaaattgcag gatatttgtc agactattac aattcagcaa
124981 atcatatttt ttctcaggaa aaaaagcgta aaatatcaat atttcgtgga atccaagcct
125041 ataatgaaat tgaaaatgtt ctaaaatcta aacaaatagc accagaatac aaaaattatt
125101 ttcaatattt aaaggaaagg attaccaatc aagttcaatt gcttctaaca catcaaaaat
125161 ctaatattga atttaaatta ttgtataaac aattaaactt tacagaaaat gaaacggata
125221 aatttgaggt cttccaaaaa attattgatg aaaaataaat atatataatt gtttttctga
125281 aaattcatca ttttaaagaa gacactagga attaaataga tgtattgaat agttatagta
125341 atggtcttgt atggacatac cgcttatact ttgggaggta gtagatatta aacaacatat
125401 agcaaatgaa ctggagtgta gatcaaaaga aatttttcta aaaaatatct catctttaat
125461 aaaaaatggc actgtatata aagcagcaac agataaaatt attacctata tgcaaaagat
125521 ttaaatattg accttgtaat aggcatggaa tctcgagggt ttatttttgg ttgcccagtt
125581 tcatatgctt tgggaatagg ttttataccg gttcgtaaat tagggaccct ggttggattt
125641 gataatgaga acgtaaaaga tattctaaca ataaataatg atgcgattaa accagggcaa
125701 cgtgtgttaa ttactgatga tgtgttaact actggaagaa ctattgaagc aattatcaag
125761 ttagttgagg aggctggtgg aattatatcg ggaatcgtat ttctagtaga actaacagac
125821 ttagatggcc gtaaaatgtt agatggttac gatgtattgg ttttgggaat agattgatat
125881 ttcgaaaaat aaaagttatt atccaagaga aaacacagtt agtaaaataa aaacgacata
125941 taaatatgtc gtttttatca gagtgttggg aaacccttta gggttcccaa cactctgtaa
126001 tcttttttga ttttagcgaa taaaaacaac ataaaataat agaatttaga aaaatagccc
126061 tccaccagac cctttttggt caggtggagg gctatttttt tcatattttg acaagctgcg
126121 gtgagataag cttgcatttg gacagacttc agccctcgaa accgggcata gcggtagcca
126181 tgtagttctt tggcgtccgc aaagcttcgc tctatagtgg aacagcgtac tttatacaac
126241 cttttccctg tagctgttag cttgtttttt tagcaatatc cttatatttc tcccatatat
126301 gatgagtgat aactttttgt ttttgtttct ttgaaaagca cacctcacgt aacggacaaa
126361 cagcgcagtc ttctggattc gatttgtatt gacggtatcc ttcacgatcc gttgttacat
126421 attctaaaat acatcccatc ggacaagcga aaacattcat ttcttctaca tatttaaatt
126481 ggcttttcgg tacttcttta tttcgttttc caaatcggcg atacccatca ccatgaatat
126541 attccgttct gataatttct tacaaatata gcctgtaaaa taacccgcat caagagcgac
126601 agcttccact ttgaatccga atttatcaat ctgagcttgg aggcgtgcta aatacggctc
126661 ggaatctgcc atatttccag ccgttacata ggtatctgta ataatattgt actttgcatc
126721 agtcgtacga tgatctaaga aatgaaaacc atttggtttt ccatctctca ttaaaaatcc
126781 actatctgga tccgttgtac ttatacgagt ttttttggta ggggtatcac tttcctttct
126841 aggttttaat tcttttttct gtgtacctca cgatcttcga ttactgcagc ttctagttca
126901 tctatataaa actttgcctt ttctttttta tatttatgta caaatttatt tttattagca
126961 ttagccttaa tgtgagtaga atctgtcatc aacgcacgtc ctcctaccat ccgatgctcc
127021 gtcgcttgtc tcacaatctc atcaaaaatt tcttcaaaaa tatttgtatg aataaagtgg
127081 gtacgacgat tccaactgat tgtagaatga tctggaatcg tgtctgatag agaaaaacct
127141 aaaaaccaac ggtaagcaat attcgtttta atctcctttt ccaattgacg ctcagaacga
127201 ataccgtaaa aatatccaat aaacatcatc ttaaataaaa caataggatg aatggacgga
127261 cgtccattgt tttcacaata ataaggacgt agcttctcct caataaactc aaaactaatt
127321 gtcgcttcaa tcgcacgaag gaaatgatat tgtggaacca attcttctac agaaacagat
127381 acacgctcat cacgatgatt ttttaaagca cccatcataa gaaatctctc cttttcctct
127441 tttttatcag tgttgacaca taaaaagagg ttcagacaca aaaataggct gtggagaaga
127501 ctttctccac agcctgataa aaacgacata taaatatgtc gtttttattt tatataaatg
127561 aaataaatac ccttttccat atacgcgccc catatttctt gtaccaggct ttccgcttcc
127621 ttcagcccta atatcaacgt tatgtttcaa ttttgttact atatcagcgg tcaatatatt
127681 tccaagtaaa taagaaaccg ccaaataaaa aaactatata ctattaatca tgtaaccatt
127741 cacttgctac aaaggaatac atataaaaca ttaaattact acgtatattt tacgttttta
127801 acacaaaccc ttttatacac tttaaaacca tatttttaca aatgatgaaa aattcccatg
127861 agaatacttt tcaaaatatg gtcctatcca tcgctatgca ggtgcaattc accgttcttt
127921 cctgtaccat ctatagttaa tatgccatcc taacctttta aagcatctgc atatgcaatc
127981 attgtgtcat taaacaaata tttaaagggc atttatatta tctttttgat ttcatgaaaa
128041 tctctttctg taggaaattc cgaaatttgt acaataggta tattttttat aggtaagtta
128101 acattagaaa taataatatc tatctccatg tcttggagtg attcgttagt taaatttata
128161 atagtgtttc ttacaatttt aataagtcca ttataacgtt tttcaagcag tgcagatata
128221 tactctcgat gtatacatcc ttgtgaggtg tatacatata tttttttcgg gttattttta
128281 aatagcatac gttgagtttc aaaatgcatt gttaataatg aaatttcata gcagtcgaaa
128341 tgggagtata ctgtatagtt taaattacta atgcattctt gaattgtatt aaatgtattt
128401 ggatgacgct gttttatatg ccttataaat tttatattat aattataata ttgaataaag
128461 tttttatcta atgctttttt tatgattaga acaacatatg ttaaaaaaga ttcatcataa
128521 tttatcccaa gttgtaattt atgttcaatt cctttggtaa tttctttagc caaaggcata
128581 attgtttttt tgtaggaagt taatgtttta ttgctgtctg tggtaataga atttccaaga
128641 gataaaagta gtgcaagggc taaaaatgaa atctcagttt catgtaatgt aacgccgaaa
128701 gagttttgta gctctgaggt tatagacgct actgttttat aatgatcatc atttttattt
128761 actaaaataa gtccacttac attatctatt gtatttcctg atagtaatct ggagattgtt
128821 atagcgaaca acacacacaa tttgtgtttt gaataggtgt acatttgtac atttaaattt
128881 ttttccattt tattaattaa atcagtgata ttttgtttat taatataggg aaacggccaa
128941 taatcatttg gaatattgca atataacctt aacataaata cgcggacatc ttgttctctt
129001 cccgatattt ctagaggttt ttttttgata tttaaatgac tggattgtat atcataattt
129061 atttgattaa taattgggta taaagctcct acttgtaagt ggagtttttg agctaaggat
129121 tgcatactgt tttttttgaa tacaagttct tcgcaaattt gaagatttag tgattttctt
129181 aaaatttttg attcaacaaa ggaaagggat tcatttaatg gtttttttag ataaattcct
129241 tttccttttt gaacaagtaa attccaagat ggaggaattt cgtcttctaa taattttaaa
129301 tattttcgga ctgttttatc tgcgacctgt agataatcag ataattcttt aattgtaaac
129361 catctatttt gttcattgat aaagtgtagt aaattaatta atcttatatg ttccttttcg
129421 atggatatcg gtgttagcat gtctataatt gattctcctt tcctgttgtg taaatataca
129481 gaatattaga attaacggac atttaacggt attttaacca tgtcatcaga tgacctgaca
129541 aatgctatta tatttcaaaa cacatatttt gggaatgatt tttttaaggg aaaaattggt
129601 tttttgtttc ttctattgaa atagcatatt aacatagaaa aattataatt tttatttatt
129661 attccaaagt taaagtaaaa aaaagttata taatctattt tgcaacataa ttaatctagc
129721 ttaggattaa tgaatgctac tgttttttaa gttaaggtaa ttcatataaa gatttttaag
129781 gaattaagga gtggaattat ggaagcaaca aaacgatact tatgtttata cctaaaagaa
129841 agccaggaga aatttatatc aaattggaaa aaacgtattt tagttcatga acatgatcct
129901 tataaaaatg aaataattaa aaatggaacg catttacttc atgtattcac aatgtatatg
129961 cgagaagaaa ttaatttaca agacattgaa gatatttcaa aaaaaattgc ccaagaacgt
130021 atggatgcaa aagtaaatat tgcagatttt atatataata ccaatgaagg aaaaaaagaa
130081 atattaaata cattattcct tttgaatcca actggtcaag aatgcaaagt ggtaattgaa
130141 cagataaatt tgttctttga tcatttaatt tatagtacga tatattccta ttataaatta
130201 aaaaaagaat atattcattc atattatgaa ctaaaaaaga aatataacta ataaaacccc
130261 ttacgattta gaacaaaaaa ctagattgta agggggggtt attagttttt ttaattaaat
130321 caccttgaaa tttttggtga gtatagaatt ttcaataatt aatttttgat tatattaaaa
130381 agaattcaat tctattttat ttttgtctat tttaagattt tattattgat atatatatag
130441 tttccaccag ctttaaaagt gagatagttt tttatatata tgtttgtatc aatatttaat
130501 ttgatgttat gcatataaag atgaagataa taatagttta atgcggctct ccgtaataat
130561 atacgtccag tattagaacc cttaagtagg tctacagtaa tattatagaa gtatcctgca
130621 tttcgtatat aaccttttac ataataatat agcttcagtt tatttgaatt gattttacta
130681 ggttctcctg taaaggttac tccgtatggt aattcaattt caacgtacct ttcttctttt
130741 ttatatgttt tataattatc aataaatccg cctaaattaa aattaagatc tataattgaa
130801 ttattatatt tatctaaata catgttattt attgtagcgt agtaagtgtc agttaatttt
130861 tgcggggttt tgttattcca attatattga aattgctcca aagatttttc caaaatacaa
130921 aacttcctcc tttttgttgt atttattact taaggtacct tattaaaggt atatatagtt
130981 cttaaatagt gtatagcttt ttgaattata aaattaaata ataatttctt ttttaaagaa
131041 attattattt aattttatat aatttaggat taattatttt aatagtatgc tatattttca
131101 ttattttgcg gtaccaagtt attttttata atatgaataa ggtgatatac gttaaattaa
131161 actatgtaca ttttcttatg taaaaaatat ctcttaataa tagggtattc gaaaacagct
131221 aaggacaatt agttctaggt aactctaatt agtccacaag attttaatga ccaattaatt
131281 gattggatct gtttttagtt catctataaa tggatatttt ccgcaaaaat gagaagagta
131341 tattatgggt gaatatggtg aaccttataa gtagtagggg gaattgttat attgaagtaa
131401 ttacttattg tgatgaatta gccgtataaa gttgaagttt tgagtagata aaattcccat
131461 tatcgtttcc gtcccattac tatacaaaac tctaaatgta ctttaacagt taattgcgga
131521 tttagaaaat tgttgcatca caaattatta atttgtctac tcgtgaataa aaaaatactg
131581 ttaataaaag taaaaaaata tataaacccc tttataaatt gatgtatatt ttagctatgt
131641 tgttgaatgt tatagttcaa gagttactga aactagccat taaattaata tgaaaattag
131701 gtgaagaagc gatagccatc ttttctccat attaggatat gtatttgaat tataacgtga
131761 ttcaacttgg ttctggcgca aggaacccaa gggagttata actaactccc ttatttctaa
131821 tgaaaattag gattttgtaa aattaattta tgcaattagg catgagtata caagagtatc
131881 tgtaggtaag gaaaagaatg atattaaatc taaatgggtt aaaaaatgaa aaaacagata
131941 tttagaatat aaaatgtaga ttgttactac taaaattaaa tgtatgggta tggaataatt
132001 atggaattac ataaaattga gttattgcta ggcatggtgt ggctaacaag tctttttcta
132061 acgttttact ttgtaacact ttatttaatt tgactttatt ttggattttt ataagaaggg
132121 cagctgctat tttcgaaagt aactttgtag aaggggaatt atatgaaaaa tgaaaaagat
132181 ttgatacata attggaaaat agatttgcaa attattaaag aggaaaagac caaaagaaaa
132241 aacaaaaaga aaaaaaacaa aaagagaaag aactataaaa ttggaaatag agaagtagtt
132301 tttggggaca aacgtttata ttataaaaag aatggggtct ggagacaaat agagactagg
132361 aggaaataat ttgaataagt ctatggttgt aattttaggt gctgtcctaa taggtgtaac
132421 aacgtattta ttgttaaaaa aataataaca atttattatt ttatagaaat agagattaac
132481 gttgggagat ttataagaat atgaaaactt atacaacaat aattaatttc attattattg
132541 tatgttgtat tttaatttgc tcttttcaaa taatgacgca agagacaaaa ggtattttta
132601 tacaaaaaat tcatgagatt attagcgagc acaatggaat tacctatata agaatattag
132661 atcattacaa aacacatgct ttttacattc caaatctaat attagatttg aaacgactca
132721 ttttgaaata actgaatatt taagcatcta ttattcactg tttttagatg aatgtgatca
132781 tagtttttct cgctctttat atggaagcat gatgttgata ttataatgtg aatatatgaa
132841 atgataaaca gattaatgta tcttaactac aatacttata attacattgt ttttagtaga
132901 aaaactcgga tgttttggcc aaccatttat tagagttcac tttacagcca ttcactctgt
132961 taaatatcta aaaacttctc gtagaatcaa cattggttgg atggaggttt ttgtagttta
133021 attttcactg tatgtataag aattttaaca aataaatctg agacctaaag aatttaacct
133081 caatgagacg aaaaaactcc taaacaatag tgagggtagg ttgttcagat catttgaaag
133141 taaatatttt tctgtttttt agtcaaaaag caataattgt agaaattttc taggggaatc
133201 ttatatttta tattaattat agataattat ctttttaaat tctattattc gaaattttaa
133261 tgttatttat atgtattagg ggtcacacga ccgaaaaaag aaaattgtac gtcaaggaat
133321 atttttacat attattaaga aataaaaaca cagagaaaat aattttccct gtgtttttat
133381 ttctgtttta ttctattttt ccgtagtggt cgtaagtttt caaaattcaa ttcttgattt
133441 aaattccaaa tataatctcc tgtaagtgcg atatgttccc agcctaatgg agagatgtgc
133501 tgaatatatt cctctggaat atgaatacca ttattccgta acgtttcaat tgcacgagag
133561 atatagatag aattccaagt tacaatcgca gaaataatga gttgaagtcc acttgcacga
133621 tgcaattgat cttcatagga tcggtcacga atttctccta attgattaaa aaatacagct
133681 ctagccaaag aatttttact ttcgccttta tttaattcaa cctgaacttt tcttctgtgc
133741 tcaggatctt gtatccactt taacatatat aaacttcttt ctattcggcc gatttcacga
133801 agtgcgatac ataaactatt ctgtctaggg taagatgata atttttttaa aatcagggaa
133861 gctgtaactg ttccttgtcg tacagagcta actaaacgta atatttcatc ccaattttca
133921 cgtattttct ttacctgaat tgttccgcca accatgaagt taatatggtc atatattgtt
133981 ggaacagata atgtatatat tttatgatta tcaatcgttt taattcgtgg tgaaaagcga
134041 aaccctaaca tatggcacat tccaaatata tgatcaacaa aacccgcggc atctgtataa
134101 tgttcttcaa tttgcaaatc tgtttcatga tacagtagcc catcaataat atgtggtgcc
134161 tcttctgagg aactaataac ttggacataa aatggatgat attgatctga tatatgtgta
134221 taaaaactta atcctgggtc atgaccatac ttaccattta cttgtgctag gggactggaa
134281 gtcccaccgg cacgaaaaaa ttgtccatct gaagatgaag tagtgccctc tccccaatag
134341 gaagaaaagg gttgtttatg atgaaaattt gcaatatctc caagtgcttt cgtatagctt
134401 tcatctctta tataccaatc tgctatccaa gctagctgag aatatgagat atttggacaa
134461 gcatcagcca ttttacttaa tcctaaatta attccatctg ataagatagc cgcaaataaa
134521 attgattttt cttttggagc cttttgagtg tgaagatgaa caaagtgttt gctaaactgt
134581 gtccaagtat ctacttctac taataaatct gttaatttaa tacgcggcaa taagtcatac
134641 acaagtcgag taatttcttc tacatcttct ggaaccatct tttttagaga agcgacttgt
134701 attttatctc catatatcgt tacaccttgc aaatcttgat ttgcaattaa acaattgact
134761 tttgaaagct ctatatctaa ttgttcaaag cgtttgttta aatatttctc tacatcctct
134821 gtaaattcca ggggaatttg ttgtgtttgc ttcatgtgct gccaagtatg gggtggtaaa
134881 agatactctt caaaatcttt atattgcttg ctgcctttta ccccacatat caccagaacg
134941 aagggtattc aataactctg aaaacacact aaattcatag taatgtcgat ttattttatc
135001 gtcttggtac acatatttca tccatttaga ctttataaaa tcagtcggta cattatcagg
135061 tatttttcgt tttccagatt gattggcttc ttttaatagt tctaatgctt gtaatacagt
135121 ttggctggtt gaagaagctt taaacacata tctattgagt aaacgtggag ccattttacg
135181 aaaatgtcca taatgattat cgagcaaatc tagataatca aattctattg gtctagctaa
135241 gctttcagct tcatgtacag agtgaataaa tttctcccaa gatataatag attgtacagc
135301 ttcgaaagga tctgtttcta attcttttgc ttcaattaat gcttttccta tttcgacata
135361 aagtctaact ttttcattta ttgatttccc atctttttga aatagtttat tatgtttatt
135421 ttctccacgg ttaaacattc gtcccattag ttttgcaaac atatctaaac cttgatcagt
135481 taaaaaagca tagatatgga taaggaatgc catgatcgtt gcatatcgtt tcctctcatt
135541 aaacctagat aaatgttgta tagaataacg agagccctca cgggccattt gtattaacct
135601 attctgatga atttctttcc cattatctaa aggtaaatct aaactttgaa taaactctaa
135661 tcgatccaaa atttcatgaa attttttaag cgctataaca cccggtggtt gacgtaacca
135721 tgataaaagt gaactttttt tctcttcatg agtataaagt aatgtatcta gttgttcgta
135781 ttgataagaa gaaagtcctt tcgttaaata tttaaaaatt cttttcctag cgcgttctct
135841 tacagaccag gctaaatgtt ctatagcgta aactgctgga aggataattt tccgttttct
135901 catttcctga ataagagctt ctaccagtaa atacccgttt tcagttttca ttgctagagg
135961 gagaagccac cgtgctaatt cacggtattc tctcagagta aaagtacgta aattgtaaag
136021 attccgtatt ttatttacat gctctcgccg tgtggtatct cgagtacgtg cgtaattttg
136081 tacctcccaa gaggctacac ctatttgttt ggcaagaaaa ttcacaagaa attgtggaat
136141 tttttcttta gccaataaag gcctccctgg aaaacgagga taagaaattt gaatagcaaa
136201 tcctaatcgg ttatgatcac cacgctgttg attaactatt tgtaactctt catcagataa
136261 tgtgtaatag cgaattaatt cacgttcatc catctgacta ggaattttat aaaaaaatgt
136321 tcgttgtata tctgtaagaa gttctcttgt tttcaatatt ggattccttt cttctaaaaa
136381 atcaattatt atcaatagag tataccctat tgataatgtt ttgtctcctt gataataaag
136441 ggttcacaga ctatcaatag cacttatcaa aaataaagag aaaaaaggtg aaaaaaatga
136501 tatatggata tgctcgtgtc agtgcacaag atcaaaattt agatacacaa attgaacaac
136561 ttctaaaata tggagttgat aagattgtta aagagaaaat tagcggtgta agtcaagaaa
136621 aaatagaatt agatgattta ctttctcaat tactaaaagg agatacgctc gtggtaacaa
136681 gaatggaccg gctaggacgg aatacaattc aattactaca atttgttgaa catcttcgtg
136741 aaaaaggcgt acactttgca gtgttaaatt taggaattga cacaagaact ccaacaggaa
136801 agttcttttt aacggttatg tctgccttta gtgaattaga ccgagaaatg attaaggaaa
136861 aacaaattgc tggaatcaaa cttgcaaaac aaaaaggagt ttaccggggg agaataaaaa
136921 aatatacaga acaacatgca ggaatgaacc atgcgattga attacgccaa caaacgaaga
136981 aaacaattaa agaaatttgt gctatcacag atgtaagtca agctgcgtta tatcggaaat
137041 taagagaatt gaaaaaagat gaaaagacga ttctttaaat agaaaagagt cgccttttca
137101 tgtgaaaata tttcttaaag aaaaaactta acaaatcaag ggcattacat aagcaatttt
137161 caattgtttt ttcggtttca gtgcaaaaat gattccatag gattttcaac cagaacattc
137221 aatgattttg aaaatacatc cttcgcaatc taaatatgtt taatgttcgt aattaacctt
137281 atgttttaat atcattcgaa tcttgcacca gagccgaata ttgcaaatag agctacatgt
137341 tgaataaatg tgtaacgtac cgagtataat actaacattt atttatgaca aaatatggtg
137401 gtagatatgg cgaagcagat ggttaatttt tttcagattg ctcttgtcct tattggtagt
137461 actggaatta ttaatcacgt cattataatt ccgatgctat tagatcattc tggtcgagat
137521 tcctggatct caattataat tttgagttta gtgtatatca tttggattcc ttgtgtattt
137581 atcgttcata aatatacaag ggaagaacat ttattctcgt ggttaatgag aaattatggc
137641 ggatttatca catatccatt gctttctata attgttttat atttgattat tctaggcaca
137701 gtcacattaa aagaaacact aacattcttc tctttttatt taccagaaac acccagaata
137761 ttattgggag tacttttatc gattatctgt ttttataata tacaaagagg ggttcaatct
137821 attgcactca caacaggcat tttattaccg gttgtatttt tgcttggatt ttttgtaatg
137881 atcgcaaact ttccacataa agattattct ttacttaaac cgataatgga gcatggtatg
137941 gacccagtaa taaaagggat gatttatcca gccgcaggtt ttgttgaatt aatttttatt
138001 ctttttttac aacatcatat tgggtccaaa attaaattat ctcaattaat tatagtagga
138061 atcattttag ctggtattac actaggtcct accatagcag ctattgtgga gtttggtcca
138121 tttgtggccg caaatcagcg gtatccagcc ttcgaagaat ggcgacttgt atcaattggg
138181 aagtacattg aacatctaga ctttctttct gtgtaccagt ggcttgtagg ggttttcatt
138241 cgtatatcac tcgttatttt tctcattcca gatgtgctac aagttacaaa gcaaaaagcg
138301 aggaatcaaa ttatctccat cttgcttata tgtatggtaa ttatttgtat attacccatc
138361 agtgatgcca gtttttattg gtttttatct catgttttct tacccatttc agcaataggg
138421 ttattcttgt tttctatgct tttacttgta tttgtttggg tctctaaaaa taagaaaaga
138481 gcttagaata ttatatattc ggttaatgga tgcaaagggg atcatataga tgaaaagaac
138541 agtggaagta aatgaatcca tactccgtgt atggtttgaa ggctgcaaag atgtaaaaat
138601 aatgaaccgt aaatggtgtg cagatacaac tacaacaacg attttattgg tgtattgtca
138661 acatgtaatt gatcatacaa agttaaagca agcgatagct cctgaaatgt gtaacgacct
138721 tttacagagc tcatttaaag attcaaatct tctagcatct aactctcagt tctcagtaac
138781 aacgttagag ttagaaaact caaacgaaaa tgtttctcga atgttatttg aaggaaagct
138841 acttattatt tttcaagaat ataaacgagg gtacacaatt gatattgcga aattacctac
138901 aagatctatt gaacaatcca atacagaaat gacaattcgc ggaagccggg atgggtttgt
138961 tgaagaactt agtacaaata taggtttaat tagaaaaagg ctcaaaacaa gctcacttag
139021 ctacgatgaa tttattattg gagaaaggac gcaaacgaag gtgggacttt tgtatctaaa
139081 agatgtagca tcacaagaaa caattagtca agttcaattt aaactaaaag aaattaatat
139141 tgatggtgtg gtttcaagtg cccagattga agaattcatt acgggggatc aattcagttt
139201 atttccttta attgaatata caggtagacc agattatgca gtgaattgtt tattacatgg
139261 gcgttttatt ctattagttg atggttcacc gactgcaacg attgcaccag tttctttccc
139321 gttttttgta aatactgctg aagatcaaaa ttatttttac ttattcggta gttttgtaag
139381 gttattaagt ctatttggaa tagccatatc gatcttcctt cctggatttt gggtagcctt
139441 agttacatat caccctgatc aaattcctta cacattacta gctacattaa gcttatcaag
139501 agaagggatt ccttttccgg ctcctttaga ggggatgatt atgattacct tatttgaact
139561 gctaagacaa gcaggcctac gcattcctgc tgcatttgga caaactttat ctgtggtagg
139621 tgggttaatt atcgggcaag cagctataag ttctggattt gtttcaccat ctatggtcgt
139681 catgatagcg atttccgttg tttcaacttt tactttagtc aatcaatcct ttactgggac
139741 attaagtatt ttgcggtatg gtgttttttt aatgtcttcc tttttaggaa ttgtaggttt
139801 tatatgttcc atcctgttaa ttgtaataca cgtagcaaat ttacgttcat tcggtctccc
139861 atttctcgcg ccatattccc ctcccgtgtt tagtagtatg ttaccatcca catttcggat
139921 tcctttcaca aggatgaaga agcgaccaaa agaacttcat acgtatgata atacaaggca
139981 aaggacaaat aatgatgaaa ataaatagaa aaggtgggct attccttctc atgtttcttt
140041 ttttactcac aggttgttgg gatagacgag aattagagca tgtgctattt ataaatacat
140101 taggcattga ctttaaggat aatcattata ttatttatcc gcaatttatt aattttacta
140161 atatggcaaa acaagaaggg cctgcaaatc gaaattatag tcccgcttat attggaaaag
140221 gtgagggaaa acttttatat gatgcagcgt ttgattttta taaaagttct caacagaaag
140281 tttcatggga acatattaaa agcattgttg ttacagaaag atttctcaaa aatggtaatt
140341 taaatcaact taatgatttt ctatctcgtt tttttcagtt tcgaaatacg atgtgggtat
140401 ttggaaccaa ggagccccta gaaaacatac tagcaacgaa taatatattt aatatttctt
140461 ctttatacac tattatgaat ttgccacaag aaacgattag acaatctgca agtgtggatc
140521 ctttgcgact gtatacgttt cgatccaatt attatgagcc cggaatgaca acccggattc
140581 cttttttagc tacaactaca gaacattgga aacaggggca taaagcattc tggatgttag
140641 aatttaatgg atatggttgt atagccgcta agtcctatgt caatcattta aatgattctg
140701 atatagcagg agttcggtgg actaataaaa atacaaatcg agccccttta ctattaaaag
140761 tgaagaatcg agccattgga gaacttatat taaaaaaacc taaaatagat acaaaagttt
140821 ctatagaaaa aggaaaacca catattgtta tgaatatctc gctagaaggc gatatttatc
140881 aattaatgaa gccgatgccg gtacataaag tgaaaaaaac gctgaggatc tcgttgaaaa
140941 agaaataaaa atgacatatc aaaaaggact ggaaaaaggg attgatgttt atcaattatc
141001 ccatctacta tatcgtgatc agctaacttt atggaagaaa tatcaaaaaa aaggaatgat
141061 acctcttcaa aacaatacat tagatctgaa tgtttcaata aatatatcca ccaatgggaa
141121 atcgaaagtc acacctataa aaaatgttga ggctcaggga taatcagttt tgatagtaaa
141181 taaattacaa ttaaaaagat tcgctgccgg aaatatcgga tatggcttct cccatgtttt
141241 cgtgtaaata attttgttaa tcacaaatct attcttaaga aaatatatag aaaagagggg
141301 acagttcttt tatccatcta cgagagcatc cgtacgatcc attacttgtt actggttttg
141361 ttgcaagcat tgaataatgt taaaatatac aacaaaatat aaggttactt ataaacatga
141421 tacatatttt gattaataat acccgtaatt tttatttggt ttttcagagc agtattttca
141481 caatcattga atgttcaggt taaaaatttt atgcaatcat ttttgcgcca aaaactaata
141541 ttgaccaaag tcagtattta ggtgtaatag agcagaaatt gtggttctgg tgcaaaaaat
141601 acagcgcttg cgcgatgagt tttccataaa atgatgattt ccatttgcca acggggggag
141661 tagaaaccat gtatttgctc cattcgaaca atgccctcaa cagtagtaaa tttagaaaca
141721 atcattaaga gcatcaatga agatgatatt ttaaccaggc taaaacaaga gcatttactt
141781 gaagaaaaat acccaattaa gaggattcgt gcaattaaag gtgaaatcca accatcttag
141841 ctctggaagt aagagaattg aaaaaatata aaaaggtgat tctttaaata taaagaatca
141901 cctttttatg taaaaatatt ccttaacgta caattttctt ttttgggtct tgtgacccct
141961 attaaaattt aatattcagt ggcattttat tattaggtaa taaatgtatc gtaatataat
142021 ttattcgcta gtaaattatt acttttcata agataaaaaa aataatctat tatttgtgtt
142081 ttatgccata ataggtttat agtttttaag caattatgat tgaaaactat aagtttggaa
142141 aactcatcat gtctagaaca cacaaaaaag ataccgaaag gtatcttttt tgtgtgttct
142201 agactgttaa ataaaataag gttatagatt aagcttctgt cattcgtaaa tttcaaatag
142261 aacgtaaatt tagacttctc atcattaaaa atgaaaaatc ttatcttttt gattctattg
142321 tatattttta ttaaggtgtt taatagttag aaaagacagt tgatgctatt actccagata
142381 aaatatagct aaccataaat ttattaaaga aaccttgttg ttctaaataa tgattttgtg
142441 gattccggaa tagatactgg tgagttagct ctaattttat agtgatttaa ctaacaattt
142501 ataaagcagc ataattcaaa ttttttaatt gatttttcct gaagcatagt ataaaagagt
142561 caaggtcttc tagacttgac tcttggaatc attaggaatt aacaatatat ataatgcgct
142621 agacagaatc aaattaaatg caaaaatgaa tattttagta agagatccat atcattatga
142681 taataacggt aatattgtag gggttgatga ttcatattta aaaaacgcat ataagcaaat
142741 acttaattgg tcaagcgatg gagtttcttt aaatctagat gaagatgtaa atcaagcact
142801 atctggatat atgcttcaaa taaaaaaacc ttcaaaccac ctaacaaaca gcccagttac
142861 aattacatta gcaggcaagg acagtggtgt tggagaattg tatagagtat tatcagatgg
142921 aacaggattc ctggatttca ataagtttga tgaaaattgg cgatcattag tagatcctgg
142981 tgatgatgtt tatgtgtatg ctgttactaa agaagatttt aatgcagtta ctcgagatga
143041 aaatggtaat atagcgaata aattaaaaaa caccttagtt ttatcgggta aaataaaaga
143101 aataaacata aaaactacaa atattaatat atttgtagtt tttatgttta ttatatacct
143161 cctattttat attattagta gcacagtttt tgcaaaatca tgtaattgta tacttatcta
143221 tgtagaggta tcacaactta tgaatagtgt attttattga acgttggtta gcttggacag
143281 ttgtatggat atgcatactt tataacgtat aaaatttcac gcaccacaat aaaactaatt
143341 taacaaaaac aaaaacacac ctaagatcat tcagttcttt taataaggag ctgcccacca
143401 agctaaacct aaataatctt tgtttcacat aagttttttt ctaaatatac agtgtaagtt
143461 attgtgaatt taaccagtat atattaaaaa tgttttatgt taacaaatta aattgtaaaa
143521 cccctcttaa gcatagttaa gaggggtttt acaatttaat ttgttgaaat tagaaaaaat
143581 aataaaaaaa caaacctatt ttctttcagg ttgtttttgg gttacaaaac aaaaagaaaa
143641 catgtttcaa ggtacaataa ttatggttct ttagctttct gtaaaacagc cttaatagtt
143701 ggatttatga ctattaaagt tagtatacag catacacaat ctattgaagg atatttataa
143761 tgcaattccc taaaaatagt tttgtataac cagttctttt atccgaactg atacacgtat
143821 tttagcataa tttttaatgt atcttcaaaa acagcttctg tgtccttttc tattaaacat
143881 ataaattctt tttttatgtt atatatttat aaaagttctg tttaaaaagc caaaaataaa
143941 taattatctc tttttattta tattatattg aaattaaagt ttattaattt caatataata
144001 taaatttaat tttatacaaa aaggagaacg tatatgaaaa aacgaaaagt gttaatacca
144061 ttaatggcat tgtctacgat attagtttca agcacaggta atttagaggt gattcaggca
144121 gaagttaaac aggagaaccg gttattaaat gaatcagaat caagttccca ggggttacta
144181 ggatactatt ttagtgattt gaattttcaa gcacccatgg tggttactcc ttctactaca
144241 ggggatttat ctattcctag ttctgagtta gaaaatattc catcggaaaa ccaatatttt
144301 caatctgcta tttggtcagg atttatcaaa gttaagaaga gtgatgaata tacatttgct
144361 acttccgctg ataatcatgt aacaatgtgg gtagatgacc aagaagtgat taataaagct
144421 tctaattcta acaaaatcag attagaaaaa ggaagattat atcaaataaa aattcaatat
144481 caacgagaaa atcctactga aaaaggattg gatttcaagt tgtactggac cgattctcaa
144541 aataaaaaag aagtgatttc tagtgataac ttacaattgc cagaattaaa acaaaaatct
144601 tcgaactcaa gaaaaaagcg aagtacaagt gctggaccta cggttccaga ccgtgacaat
144661 gatggaatcc ctgattcatt agaggtagaa ggatatacgg ttgatgtcaa aaataaaaga
144721 acttttcttt caccatggat ttctaatatt catgaaaaga aaggattaac caaatataaa
144781 tcatctcctg aaaaatggag cacggcttct gatccgtaca gtgatttcga aaaggttaca
144841 ggacggattg ataagaatgt atcaccagag gcaagacacc cccttgtggc agcttatccg
144901 agtgtacatg tagatatgga gaatattatt ctctcaaaaa atgaggatca atccacacag
144961 aatactgata gtcaaacgag aacaataagt aaaaatactt ctacaagtag gacacatact
145021 agtgaagtac atggaaatgc agaagtgcat gcgtcgttct ttgatattgg tgggagtgta
145081 tctgcaggat ttagtaattc gaattcaagt acggtcgcaa ttgatcattc actatctcta
145141 gcaggggaaa gaacttgggc tgaaacaatg ggtttaaata ccgctgatac agcaagatta
145201 aatgccaata ttagatatgt aaatactggg acggctccaa tctacaacgt gttaccaacg
145261 acttcgttag tgttaggaaa aaatcaaaca ctcgcgacaa ttaaagctaa ggaaaaccaa
145321 ttaagtcaaa tacttgcacc taataattat tatccttcta aaaacttggc gccaatcgca
145381 ttaaatgcac aagacgattt cagttctact ccaattacaa tgaattacaa tcaatttctt
145441 gagttagaaa aaacgaaaca attaagatta gatacggatc aagtatatgg gaatatagca
145501 acatacaatt ttgaaaatgg aagagtgagg gtggatacag gctcgaactg gagtgaagtg
145561 ttaccgcaaa ttcaagaaac aactgcacgt atcattttta atggaaaaga tttaaatctg
145621 gtagaaaggc ggatagcggc ggttaatcct agtgatccat tagaaacgac taaaccggat
145681 atgacattaa aagaagccct taaaatagca tttggattta acgaaccgaa tggaaactta
145741 caatatcaag ggaaagacat aaccgaattt gattttaatt tcgatcaaca aacatctcaa
145801 aatatcaaga atcagttagc ggaattaaac gtaactaaca tatatactgt attagataaa
145861 atcaaattaa atgcaaaaat gaatatttta ataagagata aacgttttca ttatgataga
145921 aataacatag cagttggggc ggatgagtca gtagttaagg aggctcatag agaagtaatt
145981 aattcgtcaa cagagggatt attgttaaat attgataagg atataagaaa aatattatca
146041 ggttatattg tagaaattga agatactgaa gggcttaaag aagttataaa tgacagatat
146101 gatatgttga atatttctag tttacggcaa gatggaaaaa catttataga ttttaaaaaa
146161 tataatgata aattaccgtt atatataagt aatcccaatt ataaggtaaa tgtatatgct
146221 gttactaaag aaaacactat tattaatcct agtgagaatg gggatactag taccaacggg
146281 atcaagaaaa ttttaatctt ttctaaaaaa ggctatgaga taggataagg taattctagg
146341 tgatttttaa attatctaaa aaacagtaaa attaaaacat actctttttg taagaaatac
146401 aaggagagta tgttttaaac agtaatctaa atcatcataa tcctttgaga ttgtttgtag
146461 gatccataaa aacttagaga aaatgaaaca tccaatgatt ctatatacaa ttgtgcgaag
146521 tatctggagt ttagaaagca cagaaaaatt taattagagg acaattgcac attcaataag
146581 atatctataa tatattgatg ctcaaaataa aggttcatgc cttaaggaat gtagtaaagg
146641 tgtgctgttc aggtgcagaa acggttctat gtattaaggt aagggtgtct tactaacagc
146701 atagcagaaa tctatattgc gaaaagactt taattattat aggtagttag tagattagac
146761 gaaacgagcg ccaatgaact aattacacta cattaatgag caaaagttaa tacggtaaat
146821 agatagtatg attgaaattg ataaggacca caagagcgtg gcaaatatat tgaaagagaa
146881 agcaactgcc aaaaatattc ttctgttgga aaagataaaa gtggtaattt aggaatatag
146941 tttatataat ttatcacgat atagggacta tactctaaat caattaatag aaaatatgag
147001 gttaaagaat ctatacattt cttgttttat ttctttataa tttaatttaa aaatactata
147061 aaaatcctaa attagatatt aaaaatagtg tgtgaaagtt cttaaaaact taatattaaa
147121 atcatattaa tattatacat tagaattata taatcagttt attatacaaa acatcacaat
147181 gtacgaacat aatgatgtca tattattaaa aggttaaact acattaaaac ataaagagag
147241 aggaattgct atgacagtat ttgtagatca taaaattgaa tacatgagtt tagaagatga
147301 tgctgaactt ttaaaaacaa tggcacatcc tatgcgttta aaaatagtca atgaacttta
147361 caaacataaa gcattaaatg taacgcaaat cattcaaatc ttaaaactac cacaatcaac
147421 tgtatcccag catttatgta aaatgagagg aaaagtttta aaaggaaatc gacaaggttt
147481 agagatatac tatagcatta ataatccaaa agttgaaggg attattaagt tgttaaaccc
147541 tatccaatag attttatata attacctcct attttaaggt tttaatagaa ataaaaatct
147601 tatttattac aataagaaag cttatatttt catttattaa acaaagggaa aaagtaataa
147661 aaatcttata aaaaagacgc tttttatagc gtctttttta tcgtttaaag atactttact
147721 taaatttatt aggtaggtag atatagatat tgaaaatata atttaaaaga aaattgttgt
147781 acaattcaat attattatac acaaatattt tcatgagaat tatgtaattt tatataaata
147841 catttaaaga tttaaatgga atttttgttt ctatttttat actaaagaaa acatacaaat
147901 agagagttag aattaatctt ttctttaaga gtggtatttt aataaaaaat tgcgaaaatt
147961 ataagcgttt cttgtataat aacggcccat ctttgtatcc cttgtgcatg gagccggtgt
148021 tcatgatgat aaaggaatgc atatagaatg gaatagaaaa ataaaataaa agatgagaaa
148081 cgaaaaaaac acgagaagag tatttaaaga aaatcattga gcatgttgta agggtggaag
148141 taaaaaaaga tgagatagaa aagctcctta agaaagtacc atctgatgtt ttagaattgt
148201 ataaagcaat tgaagaacag gttttataga tggtaatatt acaaagcata aagagttaat
148261 aggacaggta gaatctgata agcagtatta atggaaatac agtttcacta aatcaacatt
148321 atgtgtatgg aaaaaaggga tttgaacagg cacttaaaat tcaagcttcg atagattatg
148381 aacaccacat gaaaaaacat taaccgtata ttatgaaata caaaacgctt tagcaaaaga
148441 taatttaact ccacgtaccg taatttccct ataaataaca aaaaactaaa ccataaggag
148501 ttctatttta aacccattga aacagcgaaa cgtgagattc cagaagaaat aagattagtt
148561 gggaagaatt actgaatcct aatagggaat gtgcttttta ttactctgat aaaatatttg
148621 ctatgagttt cttagcaaat gagggaacgt ataatgtagt gaacataaac ggtgaacgga
148681 aaaaatatag tgaaatggtc agcaccgcca gaagatgaag atcgacaaaa tggctcaatt
148741 ttgtcgtatc acccgcatga agagacagag tggtttgaat catatttaac gaaagatgga
148801 atcaaattag aaataagtaa ctttttatca gtaacagttg aacgtttatt tcagatgtgg
148861 tgggcaagtg cgaaactaac tacgagaaac agtggattat agcttcaatt caagatgagg
148921 tgagtttgta tggaaaagaa ataattcaaa agttaaaaga tagaatcgaa aagtatcctt
148981 tagaactttc caaaaggatg attgaagaga accttctact aagtaattgc tggaataacc
149041 gcgaagtatt gttaaaacga aaagattggc tcatactata tgatgtaatt ggtgaagtag
149101 agaagaatat tttttgcgtc ttatttggct ttaacgaaat gtatgtgcat catcttgcat
149161 ttaaatggac ccttttaata ttgaacaaat gaaattaaaa cctgcaaatc tgtataagca
149221 tacgtcaaaa aaccgaaatc tgagctcaga tttcggtttt ttgacgtatg cttaattaca
149281 aaatttattg aaaattacac aaaatataca gccacttgat agaataatat gttctttaaa
149341 agctttgcaa caggatcttt tcggcacttt tactaatatt cctataaaag gcattaaatt
149401 attaataaca ttatcattaa gttctaggtc aggatcattg tttttgcctt catatctaac
149461 gaacacataa aatatcattc tggcaatgcc accttttaca ctatctggtg cttcccaaga
149521 attactatca agtctagaat tagttgcttc ataatggctg gtcccgttat tattattatt
149581 aaatccattt gaaaattttt aatacattac ttatgagtta ataatgaact taatctgatc
149641 gttaataaat tggaaagttt tcggagcatt tttttgaact tttaaacgtt cagcatggtc
149701 cgtagaatgc attaacctaa aggcttctgc aaaaaattcc gcttcatttg ttctcccata
149761 cgaagttaaa ttactccctt cttccttaaa aatatcaatg aattttttag aatttgtaac
149821 taaatcagat tggttcttat ctaatagata tccagcataa tcatccacag catgtccaaa
149881 ttcgtgtata aaaccctcac tatcattcct taattctaca ccttttgaag gtccatggag
149941 taatatagaa cgggattctg gaacatataa cccttttgaa tgaacttgct catatatctt
150001 atcttgatgt gtatattgtt cagctatatt agggagagta atatcggtaa aaacaaatct
150061 tccattacca tcaactaagt aatttgttac cttttttata agatcacttt gaatattatt
150121 tttccattca ttcaatatta aataagcact ttctacaata ttggatgcat atctattatg
150181 cacgttgaat gtaataagct ttgtatattt tggtaaccct aatgctttat tccattcctg
150241 atttatattt aattgtgctt cttgaatttt tgtatctatt ttactctttg gcactacttt
150301 cgcatcaatc cttatatatt ctttttcgga ttgcttaatt atttgtacat cctttatttc
150361 cagaccgatg tttctttgta atataagctt tccattttct aaatatcctg cttgagtatc
150421 tggtgataat tggattctcc atttcaaacg ctcattatct aatgcaggcc tttcatttat
150481 atcaacaatc atatagttac tagaaatact atatttgaaa ttttttttga attcattgaa
150541 aatacctcta ttaattttag tattatcagt ggaatcaact aaatccgcac ctagggttgc
150601 tgtaaggtta ttgatattca tattttcata caaataaatt ttattgtaca aggtacttcc
150661 aatggattga tgtaataaag catcaatatt ttgaatatcc cttttatact gctttcttac
150721 atcaagatta attgacggac tatcaattaa ccctcctgta tcttgcaacc tttgattaat
150781 atcatatggt tgaatatcaa gtttcagctt ttttaaaaac tcctcttctt tttcagataa
150841 aggattacta ctatccacct gtattttatt taaaagctct ttttcttctt cagataaaga
150901 atcacgaata tcaatttgta gcttttttaa aaactctttt tcctcagtag ataaaaaatc
150961 actactatca atttgtattc tttttagaag ctctgtttct tcttgagata aagaatgaat
151021 tatgtcatct ttctttggct caataggaat ctgcagcttt tttaaaagtc ctcttccttc
151081 ttcagataaa gaatcgctcc agtgttgata gtgctgtttt atcttttccc atttttcata
151141 tcttgccatc atccgttgat ctttaagttc ttccaaggat agatttattt cttgttcgtt
151201 aaatttatcc atgtaattaa aagcttccgg tgcataaagc tgtaaaacat cacgatgctg
151261 tggctcgata taatatgcaa aagctttcgc aaatacttct tgtatctcat tgctattttg
151321 ttccaagaat tctacagaaa agtctgtggg atgttcctta agctgattag taaataaaag
151381 atcttgtcca tctgaatcag atgcattttt aatggtattt aatacatcta aaaatttctg
151441 atatggttga ttaattttac ttaaaatatc ccttgataat atcttaccta tttcataata
151501 aacgttcagt gccttttcag tattttctac ataatcttcc gaagattgga ttacaagtac
151561 gggttcatat ccttcttttg catatacata atgttcatgt aataaagcat ctttcccata
151621 aatgtctttt atttttttct tatcttcaga taatgcttct aaagatatat gttttgtaat
151681 atcaccatcc acaatatata tctttcctcc aattgcttta tacatctcta aaacatcaga
151741 tggtactttc tcaagtagct tttctgctgc ctctttttta acagcttcct ccccttttac
151801 ttctattttt acaatgtgtt tcatgatttc ctttaaatgc tctttctgtg ttttatttcg
151861 ttcttcatct tttctcttat tctcatcttt atttttctct ttctctttta cgtgcatacc
151921 tacatcacca tgaccgcccg ccccctgtac aagggggata aagacgggac cactcaaagt
151981 aattgctgtt actaaacatg acatactaat tacttttata aattcttttt ttatattcat
152041 atttaatctc tcctttttta taagtgaaca tttcaacaat aaaataaagt atgtagaaaa
152101 ttttacttat ttcctcataa attaaaggca atatttcttg tcataaaaaa tttttcattt
152161 taatctgtat aaaagtaaag taatttttta tattaagata aactttgttt atacaccaaa
152221 atttacttgc taaataattt actaaaatag tatggaacag aatatttagt ttgttttttg
152281 catggtatta tagaaataaa taagtttcta cctataacta ccaatttggt tatgttaatt
152341 agtgtaggga ttctatcatt tttcttgaca gtgtgatttt tttggtatgg tttaatctaa
152401 aactggagaa attccatttg tagattattt cattagtttt gtttaaagcc catttatcat
152461 ttgcattcca ctatttaata ctattatttt aaaaaaatac taacataacc gtaatctatt
152521 tattgactat ccagaatgaa taactgaaat ttgacaatgt taagggaata aagatgtata
152581 acaaaaggat taatttctat ggaaaagttg attataatat ttaggttgct gtatagaata
152641 aaaggtatat tatttttcta ttttcgagtt tttatctttt ataacggtaa aaaacgcgct
152701 atgaatataa ttgacatagc atataatttt ttaatcataa gagcctcact gcatattcaa
152761 tttgttttta tgtacaataa gaataaagag atcttatcag acagtgagag caagccactg
152821 tccaatcaaa aattggtcaa tttacgcatt gatttcgcct ttaaacaatt atttgggaca
152881 tccagaagag aagatatttt gttaacactt ctcaatgcaa tgttagctga ttcattaaag
152941 tcttcaattc gaagatcagc atttgcatcg agaatatgaa gtggataaat tatcgattct
153001 agatgtatct gctacattag acacaggaac caaaattaat attgaaactc agctaaataa
153061 taatcaggat cttttaaaat gtaccctgta tcattggagt aaactctatg catctccatt
153121 ttaaaaaagg aatgccctac agctcacttc ataaaaccat tacaatcaat ttattgaact
153181 tcgtcatctt taaagactac gaaacatttc atacaacggg gcaactgtgg aacgtgcaac
153241 aacagcaatt cttaagtgac gatatcgaaa ttcatgtcat agaaattcct cagctcatgc
153301 aacaatggcg aggggacaag gtaaatccat gagaagattc ctcgttatat ctaatagcat
153361 tataaagaag tttctatcaa tttaattaaa cataaaattc atatatataa ggtttcggtg
153421 tatatacata agactataac tataaaatac atgtgctgtt actatctgaa ttttatcttc
153481 atcccttcta caactttcat ggtaatgaat attgtcctat agttaaaact aattttaata
153541 cgctatgaca aaatagtagc atgaaaagat atcttatgaa aaacaagcat ttgacatgag
153601 ggccattgtt acctatttaa aaggagagta tatatgttag aaactcttga aacgagaaaa
153661 aagcaacacg aaatgaaaat aaaaaaatac aaaagtacta caacccattt ttgtgggtga
153721 ttttaattat ttattttatc tatttcataa tccttgatac ttcgtttcca ggatgtctat
153781 tactttctat tattactggt gtgattcttt ggagcatagg tcttatacat ttaaaactct
153841 tttatgagct aagagaaaaa caaaaaatca tgaatatagc aacaataaac gaaatgaaaa
153901 aaataaatat atgagccccg gaagaaaaga acgttatatc aaagactata gttcaacgaa
153961 agatgaacta gaaaagatta tgacttacgc taaatttatg ttagaagcta aagaaagaga
154021 atatgaaata aaagatgata ataggaattt agatatataa ttgttgtagg aaaagaataa
154081 aagcatattg gtagaacgat atataaatca tcgtgacaca ggaaaacaaa ttggtgagat
154141 tcgaaaacaa tatctactaa gtgattctac ggttttaaca ttggataaag ctattaatct
154201 tgtagataca attgtagtat tacatacata taatgcaatt gttcttctaa aagggttaag
154261 aagaacatga ggaattgtag aaaaaatcct atagaaatat ttgtagaaga tgaaaagata
154321 attttacaaa agtctaaatc atacgatgct tgtacaataa ctgctgatat ttcagaaaaa
154381 atcataccgt tagctaatcg gcaaatcgtt ctaagttctg atgggattga acttttaatt
154441 aaagaaatcc agcaacactt agtgaagtaa gattgcggaa cgatgtttac atctctttac
154501 tacatcactc ttcacaaaaa acaagtagag tagaaaagta aaatctttat taactatgta
154561 taaaattatt acattcacag cattttttag tgatatagct aattacatta atggttttat
154621 ttaacctaaa ccaccataat tctactaaca ctactttcac aagagaaaat atatcacatt
154681 cgttctaacc ctttaaaata tatcatcatg aaaaacaaag gtattttagt aaaataggaa
154741 cactaaaaat cagggtacta atattaagct atcaactgat tttcaatttt taatttggtt
154801 tgcattaaat tcaattgtgt tcttacgtaa ggtagctgga ctttcttagt tttttaatac
154861 ttcccaaaaa tttatcataa ctttagcata aaatttaaga atttcaacta ctacaaatgg
154921 tcgttttact gccctatagc agaaaaggta ttatttacat tctttaaatt ttatttgata
154981 aaatgttttt taatgaaata tgtataatca ataagaacaa ctaacacttc ttgttgtttt
155041 tcatcagata aatctgcaag tgctacctta atgcattcca attttctttc cagtgtacta
155101 tctcttccaa acaattcatc aatagagata ttgtgtagat ctgaaataca cattatcgaa
155161 tctccatcag aatcagtttt cccttattcc caaattgcat aattagtgcg ggcaatattt
155221 agacgatgtg atatatcgga ttgggtgtac ccttgttttt ttcgcaattc agcaagccgt
155281 ttgcttagat gggacatatc attccctttt cctttctgat ttataacgtt cctgtaaaat
155341 agaaaagata aattttactc gcaggactta taataagtca tatttatttt ttattcgcaa
155401 taaatagtca aaatattatg gtgaaagaga aggatttaaa gttctatgag caaaaaaata
155461 ggaagaaacc gatgcatcaa atcgagaatc ttcctattat atatgtttac taaaacaatg
155521 aatttcctat atctattgtg gccaagtttt gacgtcttgt acgttctctt aaataacgtt
155581 ccgtcgtcat aatagactca tgtcctaaat agtcacgtat tttcttaagt tcgactcctt
155641 ttcccatcaa atgattggcg aagaagtgtc tacaggtgtg gggagttatt ctatgttttc
155701 ggtaacgcag aaatggtaaa ttagtttctt caattttttc tgctacatat tttgataagt
155761 agtcggctct ataatgagaa ccgtccgctt taggtagaaa ggcagatgaa ctagaggcat
155821 ctaattcact tttctgtttt cgtaattgac gaagatgaca gagatcgttg agtacatctt
155881 caaagatacg aacttctctc gttttatttc cttttccaac tacacgtaga agataaacat
155941 ttaaagaagg gtgaaataca aggtcagccc actttgcatt tgcgacttcc tcaatacgga
156001 gtccagtagt tgtaagtagg aaaaacaagg aatacataaa gaaatttgtt ttcttcaatg
156061 tatctagaat ttcattcact tcttctggaa agagatcccg attgactaac tcttcttttt
156121 ttacagatac ttttttgaga cgactactaa agttgtctga gagaccattg ttatcataca
156181 catattttaa aaactgctga accactgttt tctttcgacg taatgtggtg gccgcatact
156241 ttttacttag ttgatagaag tagatttcca tctcattatg ggataactcc ttaatgattc
156301 cgattgtttc ttttatgtaa cgaagaaaat gagaaagatc atgcagataa agtttttttg
156361 ttcgctcact tctttttttc gttaaagaag gctcatcgtg taaaaataaa taaactaatg
156421 atccttcact taattgggaa tagtcaatat ttcgaatgcc catgcccata attttttcga
156481 aatgactgct atcaaaaaaa tccgatttgg attttacaag ttgattatta tgttcgtaat
156541 ttataatatt caaatttaca caccctttaa tagaatgaaa agatacacat atatttttat
156601 aaaattttat gattcttatt ataccacaat aaacgcatta tttattgtgg tataaaatga
156661 aatatttaaa tgtatatttt cgccttatta tttaacgttt ctgtttagat gatatataat
156721 ggaaatgttt aatttatttt tttgtacatt tcaatccaaa tgcggtagga ggagattttt
156781 tttgactagt cttcgtctga aaattttaca agaaatccat aatttagaag atacccattg
156841 ttcaatttgc cctctgaaca acctatcagt gaattgtaca gatgagcaag aacaggcaaa
156901 acagagaaac tacaaacatt gtaaaggttg tcccattttc gattccatcc gtgagaaagg
156961 agagcaattg aattctttat caaaaaagag tacatttaat aaggtacgag aacgttatat
157021 ggaaaatcca tttaagtatc ttcagtataa ggagtactca atcacagatg tagtaaaaga
157081 aacaggttta acaaagtatc aactaagaaa atttaaacaa cagctagaat gaaagtttcg
157141 gatgaggtga gaaatggact atttatcttt agaagaggta tgcgataggg taggtttaac
157201 aaaaaatcaa ttaggctatt taattaagta taaacacatc aaacctatca atctggctac
157261 ctggaaagca gatggcggat atcgttttga gcaagaagat gtagaaaagt tagaagaatt
157321 atacaaagac tctttaacat taaaagaagc agctgaattt ctaaataaat ctaagactta
157381 tgttcataat gcagctaaag atgggatatt gccctttaaa gagattacta aagggaaatc
157441 cactgaacga ttatacttaa aaaaagatct agaaatattt aaagaaagaa ttgaaaatag
157501 atcaaaagaa gagtcgaaag ataaaaagca gcatttaagt ctataccttg atgaaaaggt
157561 attagaagca ataaagaaaa aggctgaaaa gaaagggtat aatggctaca agaagtttgc
157621 tgaagacatt ttatctgcag aagtaaaaga agacatagaa gaatagaatt ctagagataa
157681 tagatcccta aaaaacgaaa aacgttataa ggggtctatt tttgttttta agaaactttt
157741 taactctcga atcttattgc attactgata taaccaacgt tctttataaa tgaatttgag
157801 agctcttttt tcgagtgtgt tccaaaaaaa ttctcttaaa atacaaaaaa agtaacatat
157861 atactatata tggaaaatga tggaggaggc ggtgagatat ttaagacgat tttattcaag
157921 gtaaaaaatt ttaactgtcc ccttagcgcc attataatca aattcatatg cattagggta
157981 tttgtctcta acccatatta accctgaacc agcacttgcc ggcattgcag aaataagtaa
158041 tgcagatgtt aaacttagcg ccccaactat ctttttaatt tttgattttg acataaataa
158101 tctcccttat cattttatta acttattaga atgatgtatc taataggtta ataaaatggt
158161 aacatatacc acaggtgttt tagatcgata aaacttgata aataaatatt ataaaattta
158221 aaaaacaatt actgtttcta ataaaattta agggtaaggg taagtgtaaa aaccatcaag
158281 taaacatatt ttaattatag taaactagat tattcgaaaa tgaatgtatc attgtggatt
158341 ctctatttaa atgaatagga atatgataaa atagaagtat aactgtatat cgtgtgaagg
158401 tgggcttgtt attatccctt ctttccattt ggaaggaaag ggggtgatat aacatggaat
158461 ttttgtttga acttttaaaa gaaattgctt tctcagtgcg tgagctttca gcatacgcac
158521 tgagaaagca attcaaaaaa aaagacaaca aaaaacccgc gcttcaccga ccaaagtaca
158581 agcgtgggtc taaaagaaaa agataatgca taataacagc caccttgaca gtagcagtta
158641 tgggacggga tgttgacgca tctcgtcttt tttagtttat gcaattcagt taagtactat
158701 acttaagata tattggatat gcattcaata tatatctaat ctacagtaaa cataccatat
158761 ttttattttt tggtcaataa atgaagaaaa tagaactgtt agaggaatga gaggtttcta
158821 tattctttca ttaagtgcat gttattttta aaaatttatt gggagactac atgatgagcg
158881 aattagtaca gttcgtaatg attaatctaa agaattcagg atcagagttt gacttcgaaa
158941 gttatacgaa aaaactttta gaaaacatca aaaaagattt gaggccaaat gatttaaatt
159001 ttctttcgag caatactaaa actacaaaat gcgcaattat gatagatgat ataaattaat
159061 ttattatcac tttcacctat attagatcaa ttacaatttc acaattaaaa gtggagatat
159121 ctggagatga tttgaatcgc ttagatacga atctacataa tttaaaaacc cggttaaaag
159181 atttaatgct agtggaatga gaagaatgtc tgtggctaca agatttacaa gctgaaaagt
159241 tttcagatat attatacagc gaggttcata aagttgagaa tgcattaaga agattaatta
159301 atacaattct attctataat ttaggtggga attggtggga aacatatatg cctaccaagc
159361 tcgtacaagg atataaagat agagatgagc aatttaaaaa gcgctcacat aatttcaaaa
159421 atatacatac aagtttaatg tctatagata ccaaagatct aataagtatt ttgaccttta
159481 aaacacataa agtaaaagaa gttaatttat tcgcgtctcc aaatacagac aatccggaca
159541 ttcaaaaatt ccaatatatt atgagcgatt tattaaatgg gcaaaattag atatgcataa
159601 aaaaattaac aggtatttta gaggatacac tggaagtaga taaggacttt ggtaaagaat
159661 tctttgagcc atggttttct tgtgatttag atagatttat agaaaagtgg aaagggtttt
159721 gtgaggatag aaatcacgta gctcataaca aattaataga tataaagctg tttaaaaaat
159781 acaaaaaaat catggcagag ttattagaag ttattgtaga agccgaaaaa aattcaataa
159841 ccatttagat tcggaaatgg aacaatatct tgaaaaacta gaagaacaag aagttatgca
159901 aatgatgggg gattatgaag ctgaacttca ttatcgtaga agaatgcgtg aagaagcagc
159961 aattgatagt tctgaatgtg gtgtaagtac agtgaactta atattatttt ataacaatac
160021 tccgcaaatc acatctaaaa tcacgtttac aaacggtagt tcatactttg atgatgatca
160081 aggaacatat atgccagaca atgagtcaga gcttgatatt gacggcctcg aagaaattga
160141 aactgagatt tgctatttga tcgcaaattt tatgcccgaa atagaagaag atgacatagc
160201 atcttttcct tgtgaacaat gtaataaata taacatcaat ctatcagaag ataacggatt
160261 tgaaataggt acttgcctat attgcgagca tcctaatcat gtagggaaat gtatgaaatg
160321 tggaaaaata ttgaattccc ctacggataa agtatgtgat gagtgttggg aagaaatcaa
160381 ggaagattaa tatttcagat aaaagttgca actattgttg taacttttat cttttttagg
160441 aacggatatt ttcaaatgat aaccattaat gaaataatga tatggtataa ttttcataat
160501 atatatgcaa agaagggatg gaatgagcac acaaattaag gtaacaccgg aacaattaga
160561 acaagctgct aaaaccgtaa aaaatacgag atcatcatta gaatatatac atcaagattt
160621 atactctcaa actgaatata tagcttctca gtggagcggc gcaagtagtg atcgtttcta
160681 tcagatgttt aatgaagcga agccaatgat gtttaacatt ttgcaagaat tagataaaat
160741 cgcagtagaa ttagagcgtg cagctgttaa attccgagaa gcagatgaat tgtatggcgg
160801 aaatttagtt gactctgata ttcaagaagg ggctatgtgt ggaaaaatcc ctccaaaatc
160861 ggaagagtca ttttttaata ataaggattt aaatgctgcg tggactggta tttctactgg
160921 gtttgtagat ggtgcagtgg atgcgtggga agtaggtgat aaagaaacct ggttgaatat
160981 gcgagatgcg attgtaaatt atgaggaaac tattcctgct gcattgaatg ctctatcaga
161041 ttcatttgta aacaatcttt ggcatggaga tatggaaagt agagaacatt atgcagctta
161101 tggtatagca acgttagggc tcgggcttct aggtgataag ggtcttagta aagcaggaca
161161 agtagggaag ggagctgcca ttacagggtt tactaaaggg aaatcacttg tgactaattc
161221 tccggcatac agaaatgcat tacacatatt aaataactat gaatttaaag ctggaaatca
161281 cctttcatat gcgggagtcg gaagtattca aaagtacttg cagaaagcag ctccatatac
161341 ttatgagggg ccaaatggtc cgaaaacaat aagattaagg ttgggtgagt tagcagggga
161401 caaacatcct gttacaggca ttcggtatga tttagatggt ttccctattt ttaaagctct
161461 ttctgaagtt aaattaaaag aagctgattt taaaaaatct agaccaacac atgatagaat
161521 atgtagtaaa gcattatacg aacaaataat gaaagaccct aagttagctg caaaattcac
161581 agaagaagaa atagagttat ttaagctagg cgaggtacca gaaaattata catggcatca
161641 tcatcaagaa gcaggacgaa tgcaacttgt tgattatgaa acacatagga aaacaggtca
161701 cactggtgga tataaaattt gggggaaaga cagcgataag taaggaggag tatatatgag
161761 caacgttact tggattggag taaataaaaa agaaattacc gatgaaaaca ttcagaaagt
161821 agaacattat ttcaacatta aattccctat ggattttgta gaatgtgtaa aaaaatatga
161881 tagtggttat ccaagaccca aaatatttga tgtacccgga caggatgaaa atgtatttag
161941 taagctttta acttttgatt tagaaaatag aaattcaatc attcaagttt atgatgatat
162001 aaaagataga ttagcaaata aagtatatcc ctttggtaag gattcatttg ggaatcatct
162061 gtgctttgac taccgtagca atcctgaatc accgacagta gtattttggg atcatgagga
162121 agaaaacata gaggaagcaa tacatcctgt atgctcaaca tttacagaat tacttgctag
162181 tctacgtgat tttgaagaag attgaggtaa caaaaaaacg gcctaggatt ctgaagtgaa
162241 cccgaatagt ggtacatgaa aaaaacacct cctgaattcg catactaagt gaactgaccc
162301 acgaatttgg tacatgaaaa aaacacctat gctacctgtt tcttgtattc tataggagac
162361 aggtagttta acttttcttg aatacgttcc gtattataat actcaatgta atcgtgaatg
162421 agttgtttga gagtagaagt tgaatgtatt tgtttttctt gggaataaaa caattcagat
162481 ttcaatgagg aatgaaaaga ttctattacg gcattatcat gacaatttcc tttacgggac
162541 atacttgtgg taatgccatt ttttttagat aacgtttgga aagcgtagga ggtatacacg
162601 gccccttgat cactatgtag tataatttga gtcttttgtt gcagttttat cgccttctca
162661 actgttctta agacgagtgt tacgtcttgt ctgttactta tttcatatgc aatgatttca
162721 ttgttatata aatccataat acttaataaa tacaacatct ctgtaccaaa tggcaaatat
162781 gtaatgtctg taacccattt ttcatttggc ttgttagctt gaaagtttct atttaagaga
162841 ttctctacaa caattctact ttctccattg atccaggttc ttctctttct tttaacccta
162901 cattgtaaat ttttcttttg cattattttt tgtacagttt ttcgatttag gtgataatta
162961 tattttcgtt tcaataaagc agtaactttt cgatgtccat atcgaaagtg atttgtcata
163021 caaattgtca aaatagcctg ttctaatttt gcttccttta catctttcac tttatttttc
163081 catcgataat aagtagaacg aggtatacca attaatatac atatctcttt aatggagtac
163141 tcatctttca ttaactccac tacttctaca actacttctt taaccaactc ctctcgattt
163201 cttggtactt ttttaaaata tctagttgca tttttaattt ccgattctct atctgaagct
163261 tctcgatttc agttatacct tcttcactag ccttttgtag cgtactttgt tttcctacag
163321 ggcgactaaa acgatacgtt tcaccttcac gatgccactt catccaagtt ttaatctgtg
163381 ctttattttt aattcctaat tgttccataa tttctttatt tgtgtatcct tgttttttca
163441 gctcgattgc tttccattta atttcttctg aataagattt tctcgttccc ataaaagaaa
163501 cacctccgta tattcgtatt taaattaaat acggtataag aggtgttttt ccttgtctta
163561 tttcattggg tcacttcatt caatggaggt gtttttcgtt tgaagacaag agttcattac
163621 ccagaagaaa caaagtggaa agtcattgaa atgaagaaag aaagttattc aaaccgtaca
163681 attatggaga aactcggaat taaaaatgtt tcccaaatta agacatggat gaaatggtat
163741 cgtacagatc aaacgtatcg atttcaacaa cctgtaggaa aacaatattc ttatggaaaa
163801 ggaccaaaag agctcagtga attagaacag ttacgcttag aaaataaaca tttaaaaaca
163861 aaattacttg tatggggaaa gtatctagaa atcgaaaggg gctgaaacca gaaactgtag
163921 ttactttatg gaacgattta agaacaaaac taacggtaaa agaattgtgt aacgtattag
163981 aattaccccg gtccacattt tatcgttggt tacaacgaac ggaagatcta aaagatgata
164041 tagaagagaa agtaaaggat gtttgtctta ggcataaatt ccggtatgga tatcgaagag
164101 tgaccgctac tcttcgaaaa atgggactgt gtgtcaatca taaaaaagta ttacgaatca
164161 tgagacaaaa tcacattctt tcaaaagtac gtcgaaagaa aaagaaatat atcaatggtg
164221 cggaatccat ggtagcccct catcgattgg agcgccaatt cgatgcatcc agaccaaatg
164281 aaaagtggtt tacagatgta acttatttat tatttggaga gcgtaccttg tatttatcaa
164341 cgattatgga tgcctttaat cgtgaaatta ttagttgtgt catcagcgaa tcacaaacac
164401 tgacattggc gatgaagaca ttaaaacaag caatgagagg gcggaaagta aaagatgttc
164461 ttcttcactc ggatcaagga agtatttata cagcaaaaga atttcaagcg taagccaaag
164521 aaaacggcat tatcaccagc atgtcccgga gaggaaatta ccatgataat gccgtcatgg
164581 aaagcttctt tggtcattta aaaagtgaag ctttctattc acaaaagata acaaaagtat
164641 ccaacacaac tgtgcgaaag attgtgctag aatacattca ttactacaat tgtgtgcgaa
164701 ttcaagaaaa atcaaaccac ctatccccta aagaatttag ggaacaagtg gtttaggtgt
164761 tttgattggt gtcccgtttt cggggttcac ttcaatacag aaaggatggc ttttttatat
164821 gaatctactg attcaggatg agctttattt gtgctttaaa gaactacagc gatatctatc
164881 ttcacatatt ctccaacaac ttgcacaaga gacaggtttt gtaaaacgta aaagttagta
164941 tggcgcacga gatttgacgg ttttatgtat ctggattagt caacaagtag caagcgattc
165001 tattactcgt ttatgtagtc atctttgtgc aaatacagct atacttatga tttcagaagg
165061 acttaatcaa cgttttaacc gatgtgctgt tttatttcta cagcgtgtat tccgtagata
165121 tacaactaaa gcaattcatt tatcaaaaag gacccacttt catgtctgaa aagtatccat
165181 tttcatgtct ttctacaact gtacaaggac atgaatctct aaactataat ctcatgaaca
165241 aacgttggaa aatagccatt atcataagtt tagtaggtac tttcttgtct taataacggg
165301 acaagaaact ctaaattact tagccagtaa taatgcaata agatgatagt taactttcat
165361 cttattaagt ttcctgagta tatcagtaga aattaaaatg aaaagctaag tggttatata
165421 gactcattgc aattatccag aagcttttgc accatactta taatagtctc caaagattta
165481 cagataggat aatccattta ttaatattgg attatttttc agttgatgtt tacacaagac
165541 atatgtataa tttaaatcgt aatcattacg atttaaatgg aggttttata atgaaaattg
165601 catttacaaa gatggtaggt atattaacta ttagttcaat gttagtgtta gtaggctgtc
165661 agacttcagg ttcatctaaa aagcaagagc aaacatctga aagtcataca cacgaaaatg
165721 aacacgatca cagtcatgat catagtcatg ctcatgatga atcaacagaa aaaatttatg
165781 aagggtattt cgaagacaac caagtgaagg atcgatcact ctccgattgg aaaggagact
165841 ggcaatcggt atatccatat ttacaagatg gaacgcttga tgaggtattt gcttacaaag
165901 cgaaacataa aggtaaaatg tcagccaaag aatataagga gtattataat gaaggatatc
165961 aaacagatgt caaccgtatc gtgattcaag gagatactgt aacattctac aaaaacaaag
166021 aagaatattc tggtaaatat atctatgatg ggtacaaaat tttgacatat gatgcaggga
166081 atagaggtgt aagatacata tttaaactag cagaaaaaac agaaggagtt cctcagtata
166141 ttcaatttag tgatcatggt atttatccga ataaagctaa tcactaccac ttgtattggg
166201 gtgacaatcg tgaagcttta ttcgatgaag tcatacactg gcctacctac tacccatcgg
166261 atatgaatgg acatgatatt gcgcacgaga tgatggcgca ttaaattagg agtcaccatg
166321 attatttctt tgaacaatat ataaaattca aaggttatca gtctagaatt gcattgttta
166381 atactcaaaa gttaactata aaaaaatact cttttataat aacaagtgat ctatacatgt
166441 ttttggtaga tattttagta attgtactaa atcaaataaa ttgagaaaag taatcctaca
166501 cttcggtaaa cgggcttgta aagatacggt tgcaatagaa ttgttggtgg aagtaggata
166561 gtcacctaac gtgaaatcaa ctgaactaaa agcggaagaa attcgtttaa ttactaatat
166621 caacaaaaaa ataaaacaag tggtaaacca tttatacgta taatgcaatt aatccctaaa
166681 aattcatatt tttggggatt tttctttaaa taaattatat tctttcgaat ttatttattt
166741 ggtttaacat taggttaaat ggatattata taaaatctaa aaaattttag tttagatttt
166801 cttgtctttg tacaacaaat gggggaaggg gttaactccc atcattgaag tgttcgttaa
166861 attctgattt aacgaacact tggattgtgg tataatattc ctatactatg aataaggagt
166921 tgaagctaat gcaattaaat cagcaagagt tttttgaaac atataacata gatacacaag
166981 agtttgagac tgcagaaatt agttggaata gtttattaga gatacatagt gattacttat
167041 cctataaaga aacattaatt cctacagcag aacatttatc aatgatgttg cgtactcacc
167101 cagcatctca tactgttagg tctagggtta aagatgctgg gcacttaatt gataaaatta
167161 ttagaaaaac tattagagaa aaggagaaaa atcctgatta ttacatcgac gttaataatt
167221 ataaatcaga gattacagat ttaattggaa ttagagttct gcacctttac aaagaccaag
167281 cagctcctat tgataaattt atccgtgata cttgggattt aagggaaaaa tgtaccatct
167341 actaccgtca aggtgattac tcaaaacaag aagaacctaa aaataatgat ttatttaatt
167401 tcaaggtaca tccatttggc tatcgttcat ggcactattt aatcagttcg caagcaacaa
167461 aaaacgttca cattgcagaa attcaggtaa gaacaatttt tgaagaaggt tggagtgaaa
167521 ttgaccatca gctaagatat cctaataata tgaacgacgt ccagctaact aagcagctat
167581 tagttttaaa tagagttgct ggaagtgctg acgaaatggc gactgtaatc agagaattag
167641 ttgctgaaaa taatataaaa caaaaatcta ttgatgaatt aaaaacacag cttgacacat
167701 tgatgaagga aaataatatt gaaaaagctg ttaaagaaaa attccagaag aaagttgaag
167761 agcttcaaga tcaactggca cttaaattac caaataatag atggtttaat acgcctatat
167821 atttgggaga aggaccaacg cccgcttcat cccccctact taaagccggc gaacaatttg
167881 ttattgattt taaagcagat gagccatatg acattaagcg atatttaagt ggttatacac
167941 atcctgcact cattaaaaaa gcagatccac agaaataact gttcgttaaa agtgtattta
168001 acgaacagtt tgatggattt catagaattg agtatagtag aggtatcaat catatattga
168061 tacctctctt ctttttcaaa aactagtatg gtatccatat atgtaatcaa gctatttatt
168121 aaaataatat tctagctcaa aaattcgaat gtttagttta aatatcggtt taagtattag
168181 tttaaaaatt aatttacatt atttgatttg aggtgtacaa catgagtaac caagaaaaag
168241 aaaagtttaa aatactaatt gataagcata aaagtaaaat gccctggtat atcatagagt
168301 atgcagaaat gaaaacagcc ctctcccccg ctacattgta tgcttatatt actgaatttg
168361 aaaagtttct aaaatggctt ataagtaatc gattagccgt tgaaaacggt aaggtggtca
168421 ctaatatatg tgatgtacca atttcaacac tagaaaatct accattaaat gaagctagaa
168481 cttttcaaag atatctacag ggagaaggta ttgagacaag agctattaac agaactttct
168541 ccgctttaaa atccctattc aagtacttag ctcaaaatac agagaacgaa caaggggaaa
168601 attacatctc acgtaatgta atggataaaa ttgaactgca taaggagaaa gtagatgcag
168661 cagcaagagc agatgacgtt gcaaacatga tatttaatga aaaagatgat gtagcttttc
168721 ttcaatttct agcaaatgat tatggtgaaa tgttgaagga tatatcaccc aaaaaatata
168781 gtttttttca gcgtgataaa gaaagagaca tagccatcat aagccttatt ttaggcactg
168841 gccttcgagt ttctgaggta gctagtctta ctatatctag tataaacttc cgtcagggga
168901 aagtaaaagt gacgcgtaaa ggtaataaga gatcttccgt attagctact cgctcttgct
168961 tagatgatgt tcaggagtac attaaggttc gtcctagtaa atataactgc cctcaagatg
169021 aagacttact cttcgtaaca aattataaag ggaaatatac acagttaact gttagagcta
169081 tacagaagtt atgtgacaaa tattcaagtg catttgatga aaagcgtagc cctcataaac
169141 tacgacacac atatgcaaca aaccattata aagaaaacaa agatcttgta ttgctgcgag
169201 atcaacttgg ccacacttct gttgaggtta caagtattta tactaatatt aataacgaga
169261 aaaaacgtga ggctgttgat cgcttggaaa gaagacaatt tgaataaaac atataaatga
169321 ttaacatttt gtgcaattat ttataggggt ggagatatat taatatatct ccaccctatt
169381 tgttaaaaca ttcaatatta tagcaaacgc caggtaattg aaaataatct tcccacaaac
169441 tcgaaaatgc tcttcaacta tttgtatagt ctatgtcact cttttttgga ctttccatat
169501 tgggagggat gattattaaa agacgactgc tatttattat ttaatgagtt aataatctta
169561 gtcataaatt ctacgttatt tacaacaagc aacataattt gttttctagc gcgagtaacg
169621 gattgataaa acattctctc cggatcataa taatttgctt ttcttacagc aatactattt
169681 tgattatcat aataaaaagt agaacctact aaaacaagta ctttatcaaa ttcttgccct
169741 agaactccat gtgcatttaa tcctctattc agttgcattc tccttattgc ttcaccatta
169801 aagttttggc ctgtatagtc aattatctgc cacccttcgt tttccattcc ttctgcaaat
169861 cctctcgctt ggctaatttc atcaaaataa tggatagata tatttttagt atttctacag
169921 tatttcatat gttctaagtt aaacaaacct ttgataaaag ctccaagttc tttatttgtt
169981 ctaatctttt tacttagttt gaaatgctgg taattgttta aagagcagag tgtatttaaa
170041 ttattgtaat tacgttcacg aattgaaagt atttgctttg gatcgataga aaagatcccg
170101 attatattat tttcttttat gtatttaata ataaacgcca gctgattagg atacattctt
170161 tgtgtttcat caacaaaaat aaactgagga ttaagttgtt gaatctgttt aacattctta
170221 acaggaatta tattccattt atattgttgg tttaatttta aatgccctgt gtttaaatct
170281 cctgtatgaa ctataacaat atcatttgtt ttattgaatc cttttgctaa atcataaagc
170341 aataatgttt ttccggttcc gggtaaacct tctatgattg taaactgcga caaatttttt
170401 agtattttat ccttaaattc ttgctgttgt tttgtcaaaa aatatacacc tttattgaat
170461 ttctccatat cattaaatgg tgaaaccagg taataggatg gattaaacaa agtatctaaa
170521 tttgagtggt gctctatttt ttgactaact aaaagttttt cgaaaacacc aaaatctacc
170581 ggctgaagag tctcatcatc tgccaattga tataaactat catcttctga aatataagta
170641 aataatttta attttttacc taacaaagat aaataatatt tatttttaac tagctgctcc
170701 cgagcagcat ctccttgcat aatagatttt atttctacat tcaagatgta attttcccca
170761 aatctaagta agtcaaattc cttatctatt tgaggtatct tgtaacctac ataaaaatat
170821 ccaaagaatc tatcctccac aattaaatta tcaataaaag cagaaatctg ttcaatctct
170881 gcattgctaa tagtaaaatt aaaaaatttt ttaattcctt caaaagcttc ctctggtaaa
170941 tttttataac tgctcactaa agaatttaaa tcaattggtt ttttcacaac attcacctac
171001 acctataaat tttctataca gtgccaattg ctatattaaa aacgatttat aatatagcaa
171061 aacccactct tcaactattt acttagatat cttgcaccct aacattaata gatagggttt
171121 tatagatatt aatataataa atcatctttc aattcttcta tatatacatc cctaactaat
171181 ttacagaaac ctatatatcc cccgaaataa tctctaaatt gctttataaa cccttctctt
171241 tcttctgtat gatgagacca tatagacata ctccccatca attcacctat ctccctttta
171301 atttctttta attcacctgg cgatatacct tgtgggtaat cattaaacca ttccaaccaa
171361 tccgcaagta gctcctccac aaaggataat ccggattctg agcagaaatt aaattccctt
171421 tttccagctg taataaatgt gtctaaatca tttaaaatta gacgaattat atatgaagta
171481 ctaacatttc cgatactatg tttcatatgt tctcctccct atcatttttt tcttctaaag
171541 aaatgcgttt gttataccat ttatttattt ttcctttgta atacttttcg agttcgtaat
171601 ccggaatcca aatttcacga tcatagattt tactcataac actttctaaa acatcctcat
171661 gttctctcgg tttcaatcta cggttatgaa ccttaatctt ctctatataa gcctctctca
171721 gccaatttga tatggtttca cgctgttttt gctttaggtg agaccatttc ttattagttt
171781 gtagtaattg tcccttagaa ttccttgtgt gattcttcat cgaacgctac ctcccctact
171841 ttatttttac ttatttccta ttcgaaccga aaacacagcg cattccaaat cgagtcacag
171901 catatgtcgt gccaatttta cgaattgagc ctttcgggaa atcctttatc cttttacgta
171961 atgtcgatga ttcaattccc cactcttcta tagcatccgt actactcata atttcgttat
172021 ccaataggtt aaggtctccc caatcaacat cttcaaaatt aaatccatcc atctctaact
172081 gctgcagcat gtctctttcg tctcctttta ctgcaaacaa attatgatcc tctccctgat
172141 ggacttcttc taacacttct acgtttagat actcattgtc agttatttca atcgtactat
172201 tctcagatat ataatagtag ctaccttctt ttactttgaa tatagcctta ttccatatac
172261 catctgcact agtaccttca aaaatccgtt ccgctttcat aataattctt tctcctttca
172321 cgcagacgtg acataatccg actcacttca actatatcac gtctgcgtga attgttaaag
172381 cgagagttat gattcaaata taaataggtc gctttaatta actgtttttt ctgaattttg
172441 ttgaaaaata aatatataat agttaaatac aaaggggatt ttgctataat ggaaatatat
172501 aacattagca cacttctata ggatggggga atatataaat gattgtttca gtaaagggga
172561 acgagcaaat tactaaaatg ttaaatgact ggtatataga gatacgtgcc agacatgtag
172621 gaaaggcaca taatttaaaa cttgagattg atcaaaagat acataacatt gaagaagacc
172681 aaaacctact tttatactat gcccttttag attttcgtca tcaatatatg cttgatagtt
172741 taagtattgg aaaagatagt tttgataaag tagattcact gggtgtacct gcggatcagt
172801 ttttacaata ctactaccac ttctttaaag ctattcattc aaatattaca ggtgatttta
172861 catctgcaaa agaacattat aatcaagctg aattactctt aaaacatatt cccgatgaaa
172921 ttgaacatgc tgaattccgt tttaaattat caacttttca ttatcatatt tataaaccgc
172981 ttgcagcaat caaagaagct accaaagcaa aggatatctt taaaaaacat gcaggatatg
173041 aaactaatat tggattatgt gataatttaa ttggattagc ttgtactcat ttaaaacaat
173101 ttgaggaagc tgaagaacat ttcattacag ctattaatac attcaaaaaa tctggtaaag
173161 aaaagaatat cacgtttgta cgccataact taggtttaat gtattcaggt caaaatttat
173221 ctgaactagc aatacgatac ctctctgaag taacacaaga actccctaaa gattataaag
173281 caatttttat taaagctagg gagcatatga aaatcgggga gtccaaagaa acttataatc
173341 ttatagtgaa aggcttagaa atttgtaaag agctaaagaa tgaagaatac gaacatcact
173401 ttttaatttt agaaaaatta aatcaaaagg tctctgctga cgaattagag aagacaatta
173461 aaacaggaat ctcttatttt aagagagaaa acctacatga gtacgtacag gaatacgcta
173521 aaaaattagc agttttattc caccaagaaa ataaccgttc aaaagcaagc gattattttt
173581 atcttagcca tcaagcagaa gaacaaaact ttgaaaagga ggctttaaaa tgaaaaaagt
173641 catgtttagc ttaattggat taacagccgt attcacgttt atgtttaacg ctagcaatgt
173701 aactgataca caaaaagctc ttagcgagga taaagttgta caatatgctc acggccatac
173761 tggcggatga taaataaaca aaggtcttca ctttatggtg agggcttttg tttttatatg
173821 aaggtaccct ttgtaaaaat tataaaaata ttattttaaa atcttaatat actacaaaaa
173881 tgtgaaattt aaattattcc ttttgccacc ataagaagga tcaaaaaaga ttagaacgtt
173941 taaagagagg aagaaactat tcatgcatac acaagaagat ttttacaaca aattaataga
174001 ggaacaaaga ttagtaacga tatttttaat aaacggcgta agagtacctg gaatcattat
174061 cgctgttgat aaattctcag tgctagtttc cagtcatgga aagcaacaat tcatttataa
174121 gcatgctatt tcaacagtat ctttataaat atataccatc taaaagtcta atttgaataa
174181 tattaattga ttagaaaaat aaaaaaggaa tccttataat aaggattcac cccaggaaat
174241 atacataaat aaaaagaatt aactacatta taatataaaa gtaaacaaaa catattgaga
174301 aaaaataaga ttgaagtttg atagaaaaga ataacatttg ctatactaaa tgtgcaaaaa
174361 tatatgcaaa atcacaaata aaataaggac agcctgatat ggctgccctt attttatttt
174421 taatctcata atctgctatt tcgtttgagc taattataaa cctagtacac taacaatctg
174481 gcatgctttg gaatttgcaa tatgatagta catctctaac ccttttcttt ccgagcgtag
174541 aatcttgcca cgcatcttag ataaatgctg agatacggta gattgaggaa tatctaatag
174601 ctccgttaat tgtgttacat tacaaatctt acggtgttct agttccttca cgatttgtaa
174661 cctaactgga tgggccataa tctttaataa ttctacatcc gcctctggga ttttgtgcat
174721 ttcattacct gcttgaatag ttgtcatttt aaattctcct ttttagtttc tttttttatt
174781 tttaagttat aagtattttg tgtttgtatg agtatatcga ttataatcgc tgtgttattt
174841 gttcttttgt ctctttatct ggtttatata taaaagtatt atgatggcta aaaatccaac
174901 aaaagatagc ataggaatcg agatgaaacc aaacaaattc aaataatttt ctgtacaaga
174961 aacgcctact gaacatatct tcatttcact tgttggaaaa gcctgaatcg taatttgata
175021 gacagatatt attaatccaa tacatgcaaa tggaaatgca tatatgctta cattagaatc
175081 ttttctatac attcctatac ccaatattaa tactaatgga tacatggcca tcctttgata
175141 ccagcacaaa tcacatggag gtagcttcat ccattcacta aaaattaaac ttataagcat
175201 tgcactagta gctatcgtcc aagcaattgc aatgtgatac tttcgaatta tcgtcatctt
175261 atattcgcct caactgtcaa atttgggtgc aacatgttta ttaatatatg actagtttgt
175321 ttccgtgttt tgaatacccc gtctcaatag acagaatcca atcgttaatg tcttcccagt
175381 cataacccct ctctttcaat tctaaaggga aaagattctc aaaatcatca cgcatttcat
175441 acatggcttc taatgctttt tctagcggac caaatctata tacaatatgt gtaagtattc
175501 ttttattttt cttttctgct acagctaaat atacataccg tctttctttc gctaaaacaa
175561 acttcaaaaa tccaggtact tgactcaaca tttacactcc tttacggttt tccttaccga
175621 ggttaaaagg atacgagtaa ggaaaactat taagtcttac tttactaatt taataaatgt
175681 cccgtttttt tgctttgaaa atacaagaaa acgctcatca tcacaatatt tattacacca
175741 gctgctgcac cgatttttga gataacatac acatattcat tattactaaa tggtaatagg
175801 ctcgtgaaaa taaataaaat tgaaatgata aaggataaga gcatatttct tttgttttca
175861 tccattcaaa aaacctccat tttgcacaaa tatttgtatt gcaatggatt agggtgctaa
175921 gctgcatcat tacggttata atgacggttc ttttcatcta caaatccctt tatgctccac
175981 acgccagcct ttgcttcttt tgcttctttt tctgcctcta acatttcggg tagtaatgta
176041 gtattaggtt taaaaatata ggctataatc ccataacccg acttggccat taattcattg
176101 atgtgtatac cattacaaaa tacataagcc aatttcctac cgtacttgtc ttcttttggt
176161 ccttgatcat aaaccaaggt tacacttttc ccatctagct gtttctttaa aaagaaagaa
176221 gcttcttttc ccatcttttg tggtgggatt ttttgagata cagactcagg ggtatccaat
176281 aacagtaacc ttaccgtctg tttctgcccc tttacgttca cgtctatcgt atctccgtct
176341 tttatatgta ataccttccc tttaacggtc tctaagcctt ttaatttcct cttataagct
176401 tctggaatat caacaatatc tttcccttct acgtgctgtt gtattccgtt ttgtactgct
176461 tgggcaggtc tcgaatcatt ttttgtttgc gcggaactgc tgcatgctga catttgaatt
176521 acgaatgatg ttatacaaat agctttaatc catattttca tatcgaaatt tcttcctcct
176581 acttaaaata cgtaaatagc tgcgtctaat aaacaaacgg actttccaat gtatttactt
176641 ctcgataatt gcaacatagg caaaactgta tccattttgg ataatcatta tatagttctt
176701 tgaatgaatg tttcttacaa ttcgggcata ttgacgccat gcttttttca ttctcttcct
176761 gacttttcaa tttttcaaaa gatacattag cagatgctat attactggta cacaatatat
176821 atcccccttt tgagtcttga aatcttaaaa atacataaaa aaggacacac ctatggcata
176881 tgtatgcgta ggtgtgtcct tttgcaagat agttttagaa gtattttgtt actttcatca
176941 tatcatagtt cttattaatt ttatatatga aatttaagat tttgcgatat tatttcttct
177001 tctcatatat aaacgtgact ctcttctgtg tagagtcata tgttaattta gcatcgaatg
177061 atttccctgt ttttttcgat acaaatcctt ttactgtatc cgtcatattc ttttctaata
177121 atttcttgat ttgactggct gtaattcttt tttcaagtat cattcctgaa acaataaaat
177181 cacaacccct cttgtattgt tcgcatagat agtttgtttt cccgattatg actctactct
177241 ggcataatgg acatttacct accgtacgat catctgtagt tggaaattca aaacaaatac
177301 taagatccgt ttttaatcga atcgcagctg tgaattctcc tttttctcca ctaaaaccat
177361 tgatgaagtc tgtcacatga ttattcacta gttttttaat ctggctatcg gataatttct
177421 tacctttaat tttagccggc aacataaaat cgcatccgtt ttgatattct gagcacccaa
177481 aaaacgtttt acggtttaga atttttcctt tttgacactt tggacactgc cctagcgata
177541 attcttcaac tgaaggcaaa ttaaagctga cttcaccgtt aacaaatgct agatacgcag
177601 aaaattcttt accattagat ttaaaacctt ttataatgtc cgttttattc tcttcaaaca
177661 gttttttaac ttgtgctgtg ggaatcgctt tttcctttac tcttttgggt aatcccttgt
177721 tacagttcgg gtgattgcta cacccgaaaa actttcctct atctaagatt attccatttc
177781 cacaagggca ttggcatact tctatttgtt tcttccaggt ctctattaga ttatacgaaa
177841 ctgtgtcagg gattcttata atctcttgtg ttattttttg tacaaacgca tttgtttgtg
177901 caataaagtt ctcataactc atttcattct tttcaatgcg atgtatcatt ccttccattt
177961 ctgctgtgta caacggatct ttaatttgct gaacgggaaa ttgttcaata aaggcacggc
178021 caattggagt tgttataatt ttcccctttt caatgtctat aaagttcttc tcgtgtaaaa
178081 cgggaataaa agccgcttcc gttgctacgg ttccaattcg ttttcctttc atcagctctt
178141 ttaaatgttc atcatcaatt ttacgaccag ccgtttccat aaaagtaaga attgagcttt
178201 ctgtgtgtag agctggtttc tttgttttgg attcctgtaa ctcaaaatca tagatttgaa
178261 gttcttgtcc tttctgcagg ataggaactt taaatgtttc cacactttct tcctctactt
178321 cctcttggaa cacttctagg aaaccttttt ctcgaagcac actttctttt atttgataag
178381 tatttcccat tgcatcaata agggatacat ctcttaccag gtacactgca ggacgcatga
178441 aattgcccac aaaacgtttt accacgaggc tatatagttg tttttcaatc tctggacgac
178501 cttcctcttg atattgttta gtcgtcggta taatggcaaa atggcttgat acaagatcat
178561 catcaaatgt tttatgtttt atatcaatgg cgtcaatatc gacggattgt accagtaaag
178621 aataacgact cttagctagc gcctgcataa caccttttac ccgatccact tgttctgtag
178681 gtaaatgcct agacgaagag cgtggatagg ttatgaaacc ttcttcatac aagttctgaa
178741 tgtgtttttt tgcagtttca gcattaattt gtaattgtgc atgggcgtct ttgtacaagt
178801 ccgttaagtt gtatagcaat ttaggatttt gtttcctagt gccctcttta aattcctcaa
178861 ccgtgagata ttgatctttt aggttctccc ccaaactttt taatggagat gggtttaaca
178921 cctggtcttc tgttttcata actggtttaa gtcctaaatc tgttattagc tgcagatgat
178981 aataagattg ctccctatag ttttcaatcg ctaactcccg ctggcgtatc tcatgtagca
179041 aacacatttg tacacgtcca gatgacaata agaatttatt ttgtgctaat ttcgtggtac
179101 atcccctggt tatattcata cctaatagat aatccaaata ctgccttgct ttagcagaat
179161 aagctagtcc atcatactta gacgcgcttt ctaatcgatt gagagctgct tctagttctg
179221 cagcttcaaa ggaggattta tatacgcgag attgcttttt attcacccct gcgtattcgt
179281 acacttccct atagattaac tctccctcgc ggtccgcgtc acaaatattc acggcatggt
179341 caacatcagg tcgctgtaac agtttaacaa gtatttgtag ttgctctgca ttctcttgta
179401 tcaccttata cgatggctga aaaattaaag gtaaatgctc taactgaaac aacttatact
179461 ttggatccat ctcttccgga ttttttagtt caagcagatg tccacggcac caactgacaa
179521 tataatgatc attttcataa taaccgtaat aaggtttgct accaatgtac ttttgtgaat
179581 gacggaagcg tggcgatttc ataatttcat tggccacttt tggtttttct gcaataaata
179641 acgttttccc cataactttt tcctccttaa acaaaaaaag gacacaccta cgctatggtt
179701 atgcgtaggt gtgtcctttt gcaatctgat tttttagtat tgaattattt atatcataac
179761 attgcctcta tttatataca aatacaatca ttgttcaatg agacttctaa atatctattg
179821 gtttgtttaa acttcgccat gattttgcga tgtgccaagc gtttccccaa tttcaaaaca
179881 tttattgtta tgttttaacc agtagatcgt taagtattac gaggacttat aagacatttc
179941 aatacatcta ttgttatgtt ttaaccccga taatatatgg atttttaaca atgaattttg
180001 cgacaatccc ttatatatca acaatatcct gcttttttac cagcaaatta atgtattatg
180061 taacggtctt tgtgttacat ccttcaaagc attcagaatg cctatgtatc aatgtttttt
180121 aacattcgat actaccttac ggggcgttga cacttggtaa atttaccgtg tatcacttct
180181 ccatttatgg cgtggaaatc cgccaaacta ctaccttatt taattaatat tttccatctg
180241 ctctatatac tgttctttat attttgttaa atttaatttt tcttgtaact tcaattgttt
180301 ttgtattacc ttctcaatat tgtacacaga aatgtttttg gcagcattgt agtctgcatg
180361 aactttaaaa ctacattgct gacattcaaa ggtagattga ttttgccgat tatttttatg
180421 gatataccca cattcactac atcgttgact tgtataggat gggtcaattt tcaccacttt
180481 aatcccatat tgatttgcct gattcttgat tttttcctgc aaatcaaaat acgtccaatt
180541 ttttaggaat gcttgttctt tacttattcc ttgtaaatcc tctaattgta tagtgccaca
180601 attatatttt aaacactgtt gcactatata attggcatac ttatgattcg tagcatttct
180661 aaacttggct attttatcat ttagtacttc aattggttta attcgttttt tacggccttt
180721 acctatccta tttccactac aatacttacc ttggcgtaat aaacttatac gtctatgctc
180781 aatttttttc gaaaagcctc aatttcttca ccactaattg cctctcttac caaaccttta
180841 ttaaacgcaa aatagagaac atttattttc cccatatcta tgcccataat taaatcttca
180901 tcaaatttaa gttcttcttt tatatttgac ttataagtaa tagataaata ccatttcttt
180961 ttatgtttat ggagcatgca agcgcctttg gcatatgtac tatcaattat tctatctaaa
181021 attaccttca tactattttg ttttcttgtc gataatttca ctaagatttt accattgggt
181081 aaattgtttt cttttataaa ttttgatgaa aaaagagata cgcttgcgat ataatcacca
181141 ctcttttctt ttattatctg aatagagttt ccatgaatat caattggtaa attgtttcgg
181201 aatgaaggaa tggacatctc accactccaa atttcttttt ttctactatt ccaggtctta
181261 attgtcttct gtagagtagt ggacatattg gctttattaa tatcttgata ttcttctttt
181321 aactgatcat aaatatatcc acttatggtt ttttgagtac acccatataa ttgttgggca
181381 cttggatatt ggccagtatc tttaaagtgc ttcaatgatt gattatcata ttcccacaat
181441 ttttgtatag ttctattccc aatagttcta aaatgatatg aaagtgtacg taaatatatt
181501 tcaaacgtct tccattctat atttacagga cagactattt ggtatttcat tacttttaca
181561 gctatgctca aatatgtcac ctcaccatta tattaatcaa tacatcaata taaccgtttt
181621 attaaaaaat atactctttt tagcttttat ccttatttgt gctgcattaa aatatatact
181681 aaaatgtagt accctgtccc actcgtaacg gaactaatgt tttaatattt aaagaaaaga
181741 cgattgttta tcataaatgt aaggatatta ttctaattcg aaaaaaattt tccatataaa
181801 tatccgttcg acaatatatg acattttata aatgtatatt gtgttatgat atcgaaggat
181861 ttatctacag taggaggaac gcataaatat gttaaaaaaa ttatcag
//