BCH2333B Midterm #2 February 17th, 2017

Student name (Last, First): _______________________________

Student number: ____________________________

Instructions:
Calculator permitted (Faculty approved or any other kind)
Molecular model kits are permitted

Cellular phones, unauthorized electronic devices or course notes (unless an open-book exam) are not allowed during
this exam. Phones and devices must be turned off and put away in your bag. Do not keep them in your possession,
such as in your pockets. If caught with such a device or document, the following may occur: academic fraud
allegations will be filed which may result in you obtaining a 0 (zero) for the exam.

By signing below, you acknowledge that you have ensured that you are complying with the above statement.

Sign here:______________________________________

1
BCH2333B Midterm #2 February 17th, 2017

True/False questions (total points: 15)

1.) The primary driving force for the formation of lipid membranes in aqueous solution is the electrostatic attraction
between polar, charged head groups.

True

False. If false, explain why.

2.) Globular proteins comprise of a greater percentage of parallel -sheets compared with anti-parallel -sheets.

True

False. If false, explain why.

3.) The nucleic acid sequence 5-GCATCAACGCAAT-3 will have a lower melting point temperature than 5-
ATCGGCAATTAAT-3.

True

False. If false, explain why.

4.) Compared with an helix, a helix is tall and narrow.

True

False. If false, explain why.

5.) Position C1 on ribose forms a -glycosidic bond with a nucleobase

True

False. If false, explain why.

2
BCH2333B Midterm #2 February 17th, 2017

Multiple choice | fill in the blank questions (total points: 32).

Note: multiple choice questions may have more than one correct answer.

6.) Polysaccharides are important for which of the following reasons:

a. An efficient way to store energy
b. Decreases diffusion rates across membrane surfaces
c. Regulates osmotic pressure in cells
d. Increases entropy when lipid membranes fold
e. All of the above
7.) Circle the aromatic compounds below that are bases normally found in RNA.

8.) What is the overall charge on peptide AGQRDE at pH 7?

a. +2
b. +1
c. 0
d. -1
e. -2
9.) Which bases pair together in DNA?
a. Adenine and Uracil
b. Guanine and Cysteine
c. Thymine and Adenine
d. Guanine and Adenine
10.) Circle or highlight residues with non-polar side chains on this peptide.

FDVSLTVDFEVVA

11.) What is the most likely secondary structure for the peptide in question 10?
a. helix
b. sheet
c. Type I -turn
d. Type II -turn
e. Polyproline II helix
12.) Which of the following interactions is the strongest?
a. Hydrogen bonds
b. Van der Waals interactions
c. Electrostatic interactions
d. Covalent bonds

3
BCH2333B Midterm #2 February 17th, 2017

13.) Which of the following amino acids is least likely to participate in an helix?
a. Tryptophan
b. Methionine
c. Proline
d. Glycine
e. Alanine
14.) Given the 6 amino acid sequences below, match three of these sequences with the motifs below:
a. SGGTGVGGKGGSCPKGADGAPG
b. NLEEAFEHLASPGAVSNIETMANSL
c. QRVTIWVGGTPEELKKLKEEAKKPNIRVTF
d. NYKTRAEVKFEGCREVTLNVRIELKG
e. DRVYAHPFGEHAPNLKNYSAGFIM
f. SLRFDVSLTIDPGVEVTVSINADF

Sequence: _______ _______ _______

15.) What secondary structures are typically found in each of the three allowed areas of the Ramachandran plot?

4
BCH2333B Midterm #2 February 17th, 2017

Fill in the blank (total: 8 points).

16.) A 310 helix has _____ residues per turn, and has a pitch of ____ Angstroms.

17.) An helix has _____ residues per turn and has a pitch of _____ Angstroms.

18.) A helix has _____ residues per turn and has a pitch of _____ Angstroms.

19.) In an helix, the Phi angle is approximately _____ and the Psi angle is approximately ______.

Short answer questions (total: 15 points).

20.) Draw the structures of adenosine and cytosine. Indicate whether they are found in RNA, DNA, or both.

21.) In class, we discussed how to schematically represent a nucleic acid strand. Provide a schematic drawing for the
following nucleic acid strand: 5-ATCGCTTA-3

5
BCH2333B Midterm #2 February 17th, 2017

22.) In class, we discussed the energy diagram of a folded protein where four stabilizing interactions and one
destabilizing interaction contribute to protein folding. Draw the energy diagram, and label the energies and
provide the approximate magnitude of these energies (in KJ/mol). Provide the approximate, overall G for the
folded protein.

6
BCH2333B Midterm #2 February 17th, 2017

Long answer questions (Total: 30 points).

23.) Draw guanosine diphosphate and cytosine diphosphate forming Watson-Crick base pairing.

24.) Draw the four tautomeric forms of cytosine.

7
BCH2333B Midterm #2 February 17th, 2017

25.) Given the amino acid sequence below:

a. Circle the hydrophobic amino acids in the following peptide chain.

ILRLEREIEDLQKMK

b. Place the sequence onto the helical wheel diagram

c. Identify the dimer interface is on the helical wheel diagram.

d. What kind of interaction stabilizes the dimer interface?

8
BCH2333B Midterm #2 February 17th, 2017

26.) Given the structure of glucose below:

a. Draw the Fisher projection of glucose

b. Draw the epimer of glucose

9
BCH2333B Midterm #2 February 17th, 2017

27.) Non-Watson Crick base pairing, or Wobble base pairing, can occur between guanine and uracil. Draw the
structure of guanine and uracil and show hydrogen bonding between these two bases.

10