You are on page 1of 85

RoyaumeduMaroc MinistredeLAgricultureetdelaPche Maritime

CONSEILGENERALDUDEVELOPPEMENT AGRICOLE

RpubliqueFranaise MinistredelAlimentation,delAgriculture etdelaPche


C O N S E I L G E N E R A L D E L A L I M E N T A T I O N , D E L A G R I C U L T U R E E T D E S E S P A C E S R U R A U X

LEONS DUNE LECTURE CROISEE DES EXPERIENCES


DU

TERROIRS ET ORIGINE :

MAROC ET DE LA FRANCE

POUR UNE

MDITERRANE DURABLE

Mai2010
1

SOMMAIRE
PREFACE ___________________________________________________________________________________ 3 I.INTRODUCTION _____________________________________________________________________________ 3 II.LECONTEXTEMEDITERRANEEN __________________________________________________________________ 5 III.LESTERROIRSETLESIDENTIFICATIONSGEOGRAPHIQUES:CONCEPTS,ENJEUXETDEBATSINTERNATIONAUX ___________ 8

1.Unintrtetunengagementinternationalcroissants _______________________________________ 8 2.Pourquoiunetellemobilisation?Lesatoutsetlesenjeuxdesterroirs_________________________ 10 3.Ledbatmondialsurlesindicationsgographiques:uneconfrontationenapparencede deuxvisionspourlemonde ___________________________________________________________ 15 4.Questcequunterroir? ______________________________________________________________ 20 5.Lapprocheterroirs:quellesgouvernancesetquellespolitiquespourlesterroirs? ___________ 25

IV.LEMAROCETSESTERROIRS:ENJEUX,NOUVEAUCONTEXTEETNOUVELLESDYNAMIQUES _______________________ 35

1. LesenjeuxpourleMaroc______________________________________________________________ 35 2. LengagementnouveauduDpartementdelAgriculturepourlesterroirs______________________ 38 3. Desexemplesdenouvellesdynamiquesauplanrgionaletlocal _____________________________ 40


3.1.LOriental___________________________________________________________________________ 3.2.LeSoussMassaDraa __________________________________________________________________ 3.3.LaprovincedEssaouira________________________________________________________________ 3.4.Chefchaouen/TangerTtouan _________________________________________________________ 41 43 47 50

4. Lacontributiondelarecherche_________________________________________________________ 55 V.UNEETUDEDECAS:LESPRODUITSDETERROIRSDANSLASTRATEGIEDEDEVELOPPEMENTDUSOUSSMASSADRAA ____ 57 VI.LESTERROIRSPOURUNMAROCETUNEMEDITERRANEEDURABLES:UNELECTURECROISEEDESEXPERIENCESDU


MAROCETDELAFRANCE ____________________________________________________________________ 71

Annexe1:Remerciementsetrfrences____________________________________________________ 79 Annexe2:MiseenuvredudeuximePilierduPlanMarocVertdanslesespacesmontagnards etoasiens.Propositionsd'action__________________________________________________ 81

P REFACE

LeConseilGnralduDveloppementAgricole(CGDA)duMarocetleConseilGnraldelAlimentation,de lAgriculture et des Espaces Ruraux (CGAAER) de France sont deux institutions surs contribuant chacune, auprs de leurs Ministres respectifs, la rflexion et au conseil sur les politiques publiques intressant lagriculture et le dveloppement rural. Elles ont dvelopp de longue date un partenariat intellectuel privilgi, que laccueil au CGDA de lex directeur du Plan Bleu a permis ces dernires annes de renforcer. Chaque anne, des experts des 2 pays sont ainsi mobiliss et contribuent une rflexion partage. Des missions sont aussi organises, en France et au Maroc, qui permettent une meilleure connaissance et comprhensionmutuelles. Cepartenariatintellectuelrevtuneimportanceparticuliredanslapriodeactuelle.Leslancementsen2008 duPlanMarocVertetdelUnionpourlaMditerraneontcreneffetunnouveaucontexte.Lanne2008a t aussi marque par la crise alimentaire mondiale, laquelle est venue nous rappeler limportance stratgiquedelalimentationetdelagriculturepournotreavenircommun.Lesdfisreleversurles2rives delaMditerranesonttrsimportants.IlsagitnotammentpourleMarocderussirlamiseenuvredu Pilier 2 du Plan Maroc Vert ddi au dveloppement solidaire de la petite agriculture, ce qui a justifi une rflexion approfondie du CGDA laquelle des experts minents du CGAAER ont apport leurs prcieuses contributions.Lesanalysesontconduitnotammentmettrelaccentsurlimportancequidevaittredonne auxproduitsetauxdynamiquesdeterroirsainsiquunemiseenuvreraisonnedelanouvelleloisurles signes distinctifs dorigine et de qualit. Ces questions sont en effet importantes pour toutes les zones de montagne, oasiennes et dagriculture sche, lesquelles concentrent lessentiel de la population agricole et ruraleetdoiventtrouverdenouveauxcheminsdedveloppementdurable. Mettantprofitladynamiqueintroduiteparailleursparlaprparationdu3meForuminternationalPlante Terroirs, le CGDA a constitu un panel dexperts marocains sur les terroirs et les 2 Conseils ont dcid dorganiserconjointementRabat,le10Marsdernier,unSminairederegardscroisssurlescooprations marocofrancaisesrelativeslavalorisationdesterroirsetdelorigine.CeSminaireatparticulirement fructueux. Il a montr les changements de fond en cours au Maroc; limportance des cooprations intellectuelleetdaction,etnotammentdescooprationsdcentralises,entreles2pays;etlancessitde consolideretdegnraliserlesacquis.Ilamontrgalementlancessairepriseencomptedelacomplexit danslarflexionetdanslaction,pourfairedesterroirs,delorigineetdesapprochesterroirsde vrais outils de dveloppement durable. Les participants au Sminaire ont par ailleurs considr que les cooprations entre les 2 pays pourraient inspirer utilement dautres pays de la rgion ainsi que la nouvelle UnionpourlaMditerrane. Les2Conseilstiennentparconsquentexprimerleurreconnaissancelensembledesexpertsetacteursde cooprationdes2paysquiontapportleurcontributioncetterflexionpartage.
MOHAMEDAITKADI PRESIDENTDUCGDA JACQUESBRULHET
VICEPRESIDENTDUCGAAER

I. I NTRODUCTION
LaMditerrane,onlerappelleradanslapremirepartiedecedocument,estunecorgion,confronte,dunepart, de nombreux problmes de non durabilit et, riche, dautre part, de nombreux atouts encore insuffisamment valoriss. Cest aussi une zone de fracture Nord/Sud et un espace de partenariats rgionaux et bilatraux, lesquels doiventnotammentsattachermieuxvaloriserlesatoutspartagsetapporterdesrponsesconcertesauxproblmes communs. La biodiversit, la qualit et la diversit des savoirfaire et des produits et la beaut des paysages culturels fontpartie incontestablementdesatoutsmditerranens.Leurvalorisation,danslamondialisation,estsusceptiblederedonnerune dynamiqueconomiqueetsocialeetunemeilleuredurabilitenvironnementalenombredergionsruralesensituation difficile.Lenjeuestimportantpourlargion,notammentauSudetlEst.Leszonesdemontagne,oasiennesetsemi aridesyoccupenteneffetuneplaceessentielleetmontrentdegrandesfragilitssocioconomiquesetcologiques,avec pourconsquences,desrisquespossiblespourlastabilitetpourlaprospritcommunes. Lesmarquesdintrtpourlesterroirs,lorigine,lesproduitsdeterroirsetlesapprochesterroirscomme nouveaux moteurs possibles dun dveloppement mditerranen durable sont donc croissantes sur les 2 rives. Cependant,ilsagitdequestionscomplexesquincessitentdtreexplicites.Lasecondepartiedudocumentsattache parconsquentprciserlesconceptsetlesdfinitions,ainsiqueltatdesdiscussionsinternationalessurlesindications gographiques,unequestionduneimportancemajeureauniveaudelorganisationmondialeducommerce. LeMarocestunpaysquidisposedungrandpotentielenterroirsgrcesonexceptionnellediversitetaumaintien de fortes traditions. Cest aussi un pays qui aprs avoir, depuis lindpendance, concentr sa politique agricole sur la grande hydraulique a adopt en 2008 une nouvelle stratgie, le Plan Maroc Vert, qui constitue une volution importante. La nouvelle stratgie, tourne vers les acteurs et au service de tous les agriculteurs, entend valoriser lensemble du potentiel agricole du pays et sortir lagriculture marocaine de sa forte dualit. Elle comprend par consquentunPilier2ddispcifiquementaudveloppementsolidairedelapetiteagriculture,lequeldonneune priorit aux produits de terroirs, comme outils de dveloppement durable des montagnes, oasis etzones dagriculture sche.Cetengagementnouveaudupaysncessitebeaucoupderflexionssurlecommentdesamiseenuvre.La rflexionsurleversquoietsurlecommentdoitlafoistirerpartidesexpriencesacquisespardautrespayset tenircomptedesspcificitsmarocainesetdesprogrsrcentsdjobtenuslocalement. LacooprationentreleMarocetlaFranceest,decepointdevue,importante.LaFranceaeneffetuneexpriencetrs ancienne sur lagriculture demontagne et sur les politiques de terroirs et dorigine. Et le partenariat intellectuel et les nouvellescooprationsdcentralisesentrergionsdes2paysontpermiscesderniresannesdesavancespartages me importantes.La3 partiedudocument,ensappuyantnotammentsurlesminaireorganisconjointementle10mars Rabat, sattache rendre compte des nouvelles dynamiques observes au Maroc. Un certain nombre dexemples concrets,sontainsiprsents.UnchapitreadditionnelestconsacraucasdelargionSoussMassaDraa,unergionen pointeauMarocpourlavalorisationdesproduitsdeterroirs. Ladernirepartiedudocumentestconsacreunelecturecroisedesexpriencesdes2pays.Ellemetendiscussion lesquestionsposespourfairedesterroirsetdesapprochesterroirsdevritablesoutilsdundveloppementterritorial durable au Maroc et en Mditerrane. Le chapitre montre que le Maroc est probablement dans une phase de tournanthistoriqueetquilestdoncessentieldeconsolideretdegnraliserlesrussitesenintgrantlancessaire prise en compte de la complexit dans la rflexion et dans laction. Il souligne en conclusion limportance des cooprations bilatrales et lintrt que pourrait reprsenter une dynamique rgionale plus forte au niveau euro mditerranen.Unetelledynamique,quipourraitsinspirerdeladoubleexpriencedecooprationfrancomarocaine, cooprationintellectuelleetcooprationdaction,pourraiteneffetcontribuerrapprocherles2rivespourdesprogrs dintrtcommun.

II.L ECONTEXTEMDITERRANEN

La Mditerrane est une corgion unique par ses spcificits gographiques et historiques, la richesse de son patrimoine,desadiversitetdesespaysagesculturelsetlesentimentcommundappartenancedesespopulationsau monde mditerranen. Ses spcificits font de la Mditerrane mille choses la fois. Non pas un paysage mais dinnombrables paysages. Non pas une mer, mais une succession de mers. Non pas une civilisation, mais plusieurs civilisations(FBraudel). Principalezonedefracturedelaplante,laMditerraneestaussiunespacedecooprationNord/Sudetunergionqui partageundestincommunaveclEurope.LaMditerraneaautrefoisvulanaissancedelagriculture,delaville,des sciences,delaphilosophieetdesreligionsmonothistes.Elleestaujourdhuiconfrontedesproblmesgravesdenon durabilit: La fracture Nord/Sud se double de dsquilibres internesmajeursentrelesarrirepaysmontagneux et arides, marginaliss, et les plaines et littoraux convoits(figure1). Les ressources vitales sont dgrades et menaces. Leauestsurexploitealorsquelapopulationausud et lest va encore saccrotre de prs de 100 millionsdhabitantsen30ansetquelechangement climatiqueannonceunerductiondelaressourcede prsde20%.Lechangementclimatiquevaenoutre accrotrelariditetlesrisquesdescheresses,alors que les systmes agrocologiques sont dj largement dgrads par la dsertification. Ltalement urbain et le dveloppement des infrastructures consomment une part toujours croissantedesmeilleurssolsagricolesdesplaineset dulittoral. La transmission de nombreux savoirfaire est menace. La vulnrabilit aux risques, inondations et feux, saccrot. Les taux de surpoids et dobsit et la prvalence des maladies qui y sont lies (certains cancers, diabte, maladies cardiovasculaires) enregistrent uneforteaugmentation. Lconomie mditerranenne parat fragile dans la mondialisationetsapartrelativedanslePIBmondial se rduit alors que celle de sa population se maintient.

Figure1:LittoralisationenMditerrane (source:PlanBleu)

Lafaiblessedelinnovation,celledesbudgetsconsacrslarechercheetaudveloppementetuneconomiedemeure tropminireetrentireensontunecausesouventmiseenavant.Bienquemondialementconnueparexemplepour lavaleurdesesrgimesalimentaires,desespaysagesculturels,desacuisineetdesabiodiversit,laMditerranena passunonplustirersuffisammentprofitdesesatouts.Aulieudereconnatrelavaleurdesesressourcesetdesessavoir faire et dinnover pour en tirer bnfice dans la mondialisation en intgrant lenvironnement, le dveloppement et la culture,laMditerranesesttropsouventcontentedecopierdesmodesdedveloppement,deproduction,degestion et de consommation exognes, standardiss et inadapts. Si une agriculture irrigue moderne a pu tre utilement dveloppe,lesressourcesdesarrirepaysnontguretvalorisesetladualitaveclagriculturetraditionnellesest creuse. De nombreux jeunes ruraux au Sud ne regardent plus que vers la ville ou vers ltranger. Le retard de dveloppement dune grande partie du territoire et le creusement des dsquilibres rgionaux limitent les marchs et entraventtoutleprocessusdeprogrsconomiqueetsocial. Ces volutions sont problmatiques notamment pour les rives Sud et Est confrontes la fois la forte croissance dmographique,lapauvreteneauetdemultiplesfragilits.Ellesaccroissentlavulnrabilitaurisquedinscurit alimentaire, dont on a pu mesurer en 20072008 toute la gravit potentielle pour la rgion. Elles contribuent aussi expliquer les fragilits rurales, socioconomiques et cologiques, dans les pays o les montagnes, les parcours et lagriculturepluvialeoccupentuneplaceessentielle,cequiestlecasdepratiquementtouslespaysriverainslexception notable de lEgypte, seul pays dont toute lagriculture est irrigue. La rgion se caractrise en effet par la place relativement exceptionnelle de systmes agrosylvopastoraux complexes (dans lesquels les surfaces naturellement vgtalises,utilisescommeparcours,reprsententuneressourceessentielleenmmetempsqueparlamosaquede milieuxetdeterroirs(figure2). Figure2SystmesagricolesetnaturelsenMditerrane (source:revuegographiquedespaysmditerranens)

Or,auSudetlEst,lespopulationsagricolesetruralesdesarrirepayspauvressontengnraltrsnombreusesetles taux danalphabtisme encore levs. Lasymtrie Nord/Sud peut aussi se mesurer aux diffrences deffectifs dans lagricultureetauxcartstoujourscroissantsdeproductivit:45%desactifsmarocainsviventeneffetdelagriculture contre 3% des actifs franais. Un libre change agricole rciproque pourrait dans ces conditions savrer dautant plus problmatique que les autres secteurs de lconomie ne peuvent dj offrir suffisamment demplois pour rpondre larrive massive de jeunes sur le march du travail, que les possibilits dmigrer sont infimes et que les villes et les finances publiques ne pourraient pas absorber un exode rural massif. Le dfaut de vision euromditerranen et linsuffisancedepolitiquededveloppementetdecooprationpourraient,danscesconditions,conduiredescriseset desinstabilitsmajeuresdanscertainspaysvulnrables. 6

Face la rarfaction des ressources naturelles et aux fragilits socioconomiques et cologiques, la Mditerrane est condamne des changements de fond et linnovation. Pour maintenir les quilibres urbain/rural, sortir de la pauvret,rduirelesrisquessystmiquesetaccrotrelarsiliencedesessystmes,ellenaguredautreschoixquecelui delapromotiondundveloppementmditerranendurableetdequalit. Largiondoitainsirorientersesmodesdedveloppement,degestion,deproductionetdeconsommationetapprendre conomiserleau,ettirerprofitbeaucoupmieuxdesadiversit,detoutessesrichessesetdesnouvellesopportunits demarch.CecipeutsignifierpourleSuddencessairesprogrsdanslespolitiques,institutionsetmthodespoursortir delagricultureduale,professionnaliseretstructurerlapetiteagriculture,mobiliserlescommunautslocalesetcrerdes valeursajoutespourlesgroupesconcernsainsiquedesservicesenvironnementauxpourlensembledelasocit. Un tel changement implique, pour les pays et les rgions rurales concerns, de donner une nouvelle priorit aux terroirs. Lengagement sur les produits de qualit permettra en effet de valoriser le potentiel mditerranen, damliorerlaccsaumarchdelapetiteagricultureetdecrerdelavaleurajoutecaptablelocalement.Lexprience rcente de lEurope mditerranenne en confirme limportance puisque le Portugal, lEspagne, la France, lItalie et la Grce, reprsentent eux seuls 80% de tous les produits indication gographique de lUnion europenne. La jeune exprienceduMarocaussi:lepaysenadailleursfaituneprioritnationaledanslecadreduPilier2dunouveauPlan Maroc Vert et lengagement, qui nest pas que national, mais aussi rgional et local, est dj riche de premiers enseignements. Lenjeudesterroirsvacependantbienaudeldesproduits.Sontaussienjeulagestiondurabledesressourcesnaturelles etdescosystmes,lapromotiondunealimentationdesantetlamiseendynamiqueglobaledeterritoiresruraux,y compris par de nouvelles synergies entre lagriculture, lartisanat et le tourisme. Les terroirs, par leurs produits et services,sontdoncuneportedentrepourundveloppementterritorialdurabledesystmesagrocologiquesetde nombredepetitesrgionsrurales. Cestainsitoutunvoletdelaproblmatiquedelarelationentremondemditerranenetdveloppementdurablequela questiondesterroirspeutvenirainsiinterroger.

III. L ES T ERROIRS ETLES I DENTIFICATIONS G EOGRAPHIQUES : CONCEPTS , ENJEUXETDEBATSINTERNATIONAUX

1. U NINTERETETUNENGAGEMENTINTERNATIONALCROISSANTS
Les terroirs sontils importants dans notre monde moderneet pour notre avenir ? Sils peuvent susciter de la sympathie,ilsrestentpourbeaucoupunsimplerservoirdetraditions,associdesproduitsdenichedimportance sommetoutetrssecondaire. Cependant,encedbutde21mesicle,unnombretoujourscroissantdeterritoiresetdacteursdesgouvernements, des autorits locales et des communauts, des consommateurs, des agriculteurs, des restaurateurs, certaines grandes entreprises,despersonnalitsindpendantes,desscientifiques,desONG,desinstitutionsinternationalesconsidrent les terroirs et les produits identifications gographiques (IG, quil sagisse dIGP ou dAOP, voir dfinitions ci dessous)commedesquestionsdimportancestratgique. Encadr1.DfinitionsdesIGPetAOP(dfinitionsdelUnioneuropenne)
AOP Appellationdorigineprotge IGP Identificationgographiqueprotge

Nomduneairegographique(lieu,rgion)quisertdsignerunproduitagricoleouunedenrealimentaire dont la qualit ou les caractres sont dus essentiellement ou exclusivement au milieu gographique comprenant les facteurs naturels et humains et dont la production, et la transformation et llaborationontlieudanslairegographiquedlimite dont une qualit dtermine, la rputation ou une autre caractristique peut tre attribue cette originegographique.

et dont la production et/ou la transformation et/ou llaboration ont lieu dans laire gographique dlimite

SuivantlexempledelaFrance(pionniredepuis1sicledespolitiquesdevalorisationetdeprotection),delEuropedu Sud,puisdelUE,desEtatsennombrecroissantprennentdesmesurespourpromouvoiretprotgerleursproduitsde terroirs.Ainsiparexemple: LeCostaRica,laColombie,lEthiopielIndonsie,laRpubliquedominicaineetcertainsEtatsduBrsilonttpionniers pourfairerespecterloriginedeleurscafs(chaquergiondeproductionestuncru). De grands pays asiatiques comme la Chine et lInde ont mis en place des systmes importants de promotion et de reconnaissancedesidentificationsgographiques. LIndeprotgeson riz basmati et le th darjeeling, la Jamaque son cafblue mountain, le Sri Lanka son th de Ceylan,leKenyasoncafGethumbwini. Le Maroc considre les produits et les dynamiques de terroirs comme dimportance majeure pour le Pilier II du Plan Maroc Vert (sa nouvelle stratgie agricole) ddi au dveloppement solidaire de la petite agriculture. Deux nouvelles divisions de son administration centrale ont t cres pour soccuper respectivement de la labellisation et du dveloppementdesproduitsdeterroirs.Iladjfaiten2009delhuiledargansapremireIGP(indicationgographique protge)etdunehuiledolivelocale(lhuiledeTyoutChiadma)sapremireAOP(appellationdorigineprotge),et dautresproduitssontvenuslesrejoindreen2010. 8

Des collectivits territoriales et acteurs des terroirs, premiers intresss, sont aussi mobiliss. Au Nord comme au Sud, de nombreusesrgions,provinces,professionnels,communautsetgroupesdacteurssengagentpourladfense,lavalorisationetla promotiondeleursterroirs.Demultiplesactionsdecooprationdcentraliseappuientdesdynamiquesrgionalesetlocalesdans lespaysduSud. Des personnes de progrs agriculteurs, agronomes, sociologues, gographes, rudits locaux, consommateurs avertis, personnalitsdediversesorigines,...,crentdesmouvementspourlesterroirsoupourleursproduitsavecunsuccscroissant.Ces mouvementssontlocaux,rgionaux,maisaussiinternationaux.Cestlecasnotammentde: Slowfood,mouvementinternationalcrenItalieen1986.Slowfoodregroupeplusde100.000membres,sopposeaux effetsdgradantsdel'industrieetdelaculturefastfoodquistandardisentlesgots.Ilpromeutlegot,lescultures localesetuneagriculturecapabledeprserverlabiodiversitetdoffrirdesperspectivespourlesrgionslespluspauvres. La dynamique Plante Terroirs, mouvement international initi en France en 2003, par lassociation Terroirs et Cultures. Plante Terroirs uvre pour la reconnaissance, la promotion et la valorisation des terroirs, des biens et des services de terroirs dans le monde, mobilise un rseau important dexperts et dinstitutions de recherche et dveloppement et organise tous les 2 ans un Forum international. Des institutions franaises de recherche ou de 1 dveloppementtellesqueleCNRS,lINRA,lINAO,leCEMAGREF necessentdenrichirlarflexionscientifique. Les terroirs et les indications gographiques sont aussi une affaire importante pour plusieurs institutions internationales: Quiditterroirditavanttoutpluralit,diversitetrsiliencefaceauxaspectsrducteursduncertainmodede dveloppement.LUNESCO,dfenseurdesculturesetdeladiversit,estdoncenpremirelignepoursoutenirle concept de terroirs et le mouvement Plante Terroirs. Elle considre les terroirs comme lun des foyers sur lesquelsnouspouvonsrenouvelernotrerapportlaplanteetlundeslaboratoiresdecesnouvellessocitsdu savoirmmedejouerunrleessentielpourcontribuerrestaurerlecrditdelascienceauprsdupublic.Elle prconiseainsideplacerlarciprocitetlchangeaucurdesrelationsentremondesagricoleetscientifique. Le FIDA (fonds international pour le dveloppement agricole), lICARDA (International Center for Agricultural Research in the Dry Areas) et des institutions des Nations Unies soutiennent des approches terroirs pour promouvoir une agriculture durable et rduire la dsertification. Ils exprimentent en Tunisie, Syrie, Jordanie, Madagascar, Mauritanie, Mali, Guine,, des modes de gestion concerte des terroirs villageois par les communautslocalessappuyantsurdeslecturessociofoncirespermettantdeclarifierlesmodesdoccupation agricoleetpastorale,lesdroitsfonciersetlesdroitsdusage. LOMPI (organisation mondiale de la proprit intellectuelle) et lOMC (organisation mondiale du commerce) offrent un cadre de ngociation pour les indications gographiques, unsujet, on le verra plus loin, de dispute majeuredanslesngociationsrelativeslaconcurrenceetlargulation,cequienditlongsursonimportance stratgique. La FAO a publi en 2009 un guide pour promouvoir la qualit lie lorigine et des indications gographique 2 durables etelleappuiecertainspaysdanslamiseenuvredeleurpolitiquedeproduitsdeterroirs.

Ainsi, la mondialisation qui uniformise et standardise, se surajoute une mondialisation de la diffrenciation ; laffirmationduglobal,rpondaussiuneaffirmationdulocal. Lavenirauraitildoncbesoindesterroirs?
CNRS:Centrenationaldelarecherchescientifique,INRA:institutnationaldelarechercheagronomique,INAO:institutnationaldelorigineetdela qualit,CEMAGREF:Institutderecherchepourlingnierieenagricultureetenenvironnement.
2 1

Territoires,produitsetacteurslocaux:desliensdequalit

2. P OURQUOIUNETELLEMOBILISATION ?L ESATOUTSETLESENJEUXDES TERROIRS


Cettemobilisationcroissantepeutsexpliquerparaumoins4grandesraisons.

2.1L A R E US S I T E E C O N O M I Q U E D E S P R O D U I T S D E T E R R O I R S
Lesproduitsdeterroirsontpoureuxtroisatoutsquicontribuentleurrussiteconomique. L A D E M A N D E I M P O R T A N T E E T C R O I S S A N T E D E S M A R C H E S . Lexpriencefranaisemontrequelesproduitsindicationgographique(IGP,AOP),peuventreprsenterdesvolumes significatifs(26milliards,20%dutotaldumarch)avecdesprogressionsnettementsuprieures(510%paran)aux produitsdemasse(produitsgnriques). Tableau1.Lemarchalimentairefranaisen2004 Chiffredaffaires Typedemarch Rpartition

Tauxannuels

decroissance (milliardseuros) Marchdemasse 97 75% 01 % Marchdesproduitssant 6 5% 1520% MarchdesproduitsIG 26 20% 510% Total 129 100% 12% Source:Rastoin,2007,daprsLagrange,IRQA,2003INAO,CERQUA,CEPRAL,Agence Bio,INSEE

Encore ne sont pas inclus dans ces chiffres les produits de terroirs autres que ceux IG. Or ceuxci reprsentent des marchs significatifs et souvent croissants. De nombreux produits locaux vendus sur les marchs de proximit sont en effet des produits de terroirs qui nont certes pas besoin didentification gographique protge pour exister et prosprer. Les consommateurs savent les apprcier et ont confianceet les producteurs nont donc pas besoin de certificationsofficiellesquicotentcher.LesuccscroissantdesAMAP(associationspourlemaintienduneagriculture paysanne) et des paniers hebdomadaires pour fournir les consommateurs urbains de lgumes de proximit et de saison,peutdailleurstresignal:prsde10%desmarseillaisyontaujourdhuirecours. La grande distribution apporte aussi sa contribution spcifique. Ainsi, Reflets de France, premire marque de distributeurconsacreauxterroirs,creen1997parlegroupeCarrefour,avusesmarchsdcupleren10ans.Avec plusde300produitspourunchiffredaffairesde320millionsdeurosen2006,elleestdevenueunedes30premires marquesvenduesenFrance. D ESPRODUITSNONDLOCALISABLES Les produits de terroir ont un immense atout au plan de lconomie: ils ne peuvent tre dlocaliss. Ainsi, tout investissement les concernant est de lintrt long terme du territoire concern. Leur valorisation permet donc une 10

accumulationdurablepourlesacteursduterritoireconsidr,pourlesressourcesnaturellesspcifiquesceterritoireet pourleterritoireluimme. DESPRIXNETTEMENTSUPERIEURSAUXPRIXSTANDARDS LelaitpourdesproduitsIG(indicationsgographiques)estpay15%pluscherenmoyenneenFrancepermettantdes revenusmajorsde14%pourleursproducteurs.Lavantagedeprixestde51%pourhuiledolivedeNyons. Cependant, les russites sont trs ingales. Des tudes rcentes montrent que les produits forte typicit, qui correspondenteffectivementdesterroirsauvraisensduterme,portspardesacteursprofessionnelslocauxbien organiss,ontleplusgrandsuccs.AinsilesproducteursdefromagesAOPaulaitcrutraversentsansproblmeslacrise actuelledulait.Lexigencedanslauthenticit,laqualitduproduit,lescapacitsdelorganedegestionprofessionnelle sontdesassurancesdesuccs.

2.2

L A N E C E S S I T E D E P R O T E G E R L E S P R O D U I T S D E T E R R O I R C O N T R E L E U R S U C C E S

Silesproduitsdeterroirsevendentpluscher,cestquilsdisposentdunecertainequalitetdunecertainerputation.La rputationcredelavaleurajoutemaisellesusciteaussidesconvoitisesetdesrisquesdusurpation,decontrefaonset detraficsentousgenres.Ainsidesproduitspeuventtrednaturs,falsifis,copis,auxdpensdesproducteursetdes territoiresresponsableset,infine,desconsommateurs;etlesrputationsdtruites. Lusurpation est un risque majeur: les producteurs des bassins agricoles traditionnels dcouvrent souvent avec tonnementquedegrandesentreprisesdautrespaysoudeleurproprepays,sansaucunlienavecleurterroir,nhsitent pasvouloirsenapproprierlenompardesmarquespourbnficierdefaoninduedunerputationconstruiteavecle temps, fruit de beaucoup defforts collectifs. Le risque de trafics et de falsifications en est un autre: le succs ces derniresannesdelhuiledarganapuengnrer. Cesdrivesncessitentdesrponsesjuridiquesfortes:lesproduitsdoiventtreprotgsetlesconsommateursrassurs. Laprotectionpeutavoiraussiungrandavantage:celleduneplusjusterpartitiondelavaleurajoutedanslafilire,au bnficeduterroiretdesesacteurs. Des politiques publiques sont donc ncessaires pour labelliser non pas seulement une provenance mais bien une origine. Encadr2.Provenanceetorigine Lorigineestbienplusquuneprovenance:elleindiqueaussiunequalit,uneauthenticit,certaines caractristiquesdanslesmodesdeproduction,detransformationetdlaboration.Lorigineestdonc rattacherauconceptdeterroir. Les Etats et les acteurs des filires/territoires sont donc amens, pour contrer les risques, sengager bien davantage dansdespolitiquesdeterroirsetdelabellisation. 11

2.3

L E S C O M P O R T E M E N T S D E S C O N S OM M A T E U R S

Lesdiffrencesdeprixentreproduitsdorigineetproduitsgnriquesmontrentquelhommeestuntredeculture.La qualit,legot,leplaisir,lagastronomie,lanature,lebeau,leressourcement,unealimentationdesant,etc,sontdes choses qui comptent. Et le consommateur peut avoir aussi envie de soutenir, par ses achats, des petits producteurs locaux, des entreprises et des territoires qui ont su, dans le monde global, maintenir une qualit et une authenticit. Lurbanisationetlalittoralisationgalopantesetlapertederepresquienrsulteainsiqueleseffetsdestructeursdela mondialisationsurlaculture,lenvironnementetlapetiteagriculture,renforcentbienentendulesprisesdeconsciences etledsirdengagement. Nombredeconsommateursentendentainsidonnerdusensleurvieetcequilsachtent:lesvaleurssensorielles, motionnelles,culturelles,esthtiquesetthiquespeuventfairelamoitiduprixdesproduitsetdesservices! Enachetantetenconsommantunproduitdorigine,leconsommateurpntregalementdansunpetitmorceaude laplantequilpeutimagineravecsespaysages,seshommesetsesfemmes,sonarchitecture,sessavoirfaire,productifs et culinaires, ses ftes, etc. Il soutient ainsi, par son achat, le rsultat dun long processus dinteraction entre une communautetunmilieu,c'estdireunterroir. Le terroir et la demande du consommateur ne se limitent pas aux produits alimentaires: le terroir, ce sont aussi des produits artisanaux et des services, notamment touristiques.Le dveloppement remarquable du tourisme rural (dont lagrotourisme)danscertainspays,notammentlItalieetlaFranceentmoigne,etsonessor,auMaroc,estsouligner. Lademandedeservicesestaussienvironnementale:lesconsommateursdesterroirssaventapprcierunpaysageetun environnementdequalitetilspeuventvouloirsouteniruneagriculturequicontribuemaintenirlabiodiversitetdes paysagesculturelsdequalit,ouconserverleseauxetlessolsetrduirelesrisquesdefeuxetdinondations.

2.4

L I M P O R T AN C E S T R AT E G I Q U E D E S T E R R O I R S E T D E A G R I C U L T UR E , P O U R L E S R E G I ON S L E S P L U S P A U V R E S DURABLE

L O R IG I N E P O U R L A P E T IT E ET POUR LE DEVELOPPEMENT

UNOUTILDEDEVELOPPEMENTRURAL La demande croissante des consommateurs et des marchs, le caractre non dlocalisable des produits et services de terroiretlesvaleursajoutesgnresseconjuguentpourpermettrecertainesrgionsruralesdifficilesetleurpetite agriculture, qui semblaient condamnes au dclin ou au traitement social du fait de leur handicap permanent, de retrouverunedynamique,unprojet,uneprosprit,unefiert. LescahiersdeschargesdesIGimposentquelaproductionet/oulatransformationet/ouleconditionnementseffectuent surleterroirdlimit:ilspermettentainsipresquetoujoursunerpartitionbeaucoupplusquitabledelavaleurajoute, aubnficedesacteursduterroiretduterroirluimme.Lesproduitsdorigineontaussilegrandavantagedepermettre une offre demplois nombreux et valorisants. Lexprience franaise confirme limportance des produits IG pour le dveloppementrural(encadr3). LexempledelAubrac(encadr4),quiaservidecadreetdillustrationauxtravauxdu1erForuminternationalPlante Terroirs, et celui dautres petites rgions comparables est rvlateur des retournements historiques possibles dans certaines rgions de montagnes qui nont pas pour elles les ressources du ski alpin ou de lindustrie lourde. Ces retournementspeuventpermettrelmergencedepanierdebiensetdeservicesaveclaclefdesgainsmultiples possibles. 12

Les approches terroirs et les produits dorigine sont donc considrs comme dune importance stratgique pour le dveloppementruraletpourlamnagementduterritoire(maintiendesquilibresurbain/rural). Encadr3.LesIGenFrance:unoutildedveloppementrural Les AO et les IG, reflets de la diversit naturelle, culturelle et agricole, sont devenusdes outils majeurs du dveloppement, y compris dans les zones rurales isoles. La reconnaissance des lieux comme porteurs de valeurs(IGPouAOP)etlintelligencedesdynamiqueslocalespermettenteneffetdegnrerdimportantes plusvaluesetservicesenvironnementaux.EnFranceoncompteautotal80IGPpourunchiffredaffairede1 milliardet25.000producteurs,48AOClaitires(22000producteurs,440transformateurset180affineurs etunC.Ade2milliards),et39AOCagroalimentaires(13500producteurset0,2milliard). CedveloppementpeutprofiterdetrspetitesexploitationslexempledeloignondouxdesCvennes (130producteursquiexploitent41hadeterrasses),dupimentdEspeletteproduitpardesfemmesrurales duPaysBasque(depuislepassageenAOCen1997,lenombredeproducteursestpassde3090et6PME onttcres)oudelhuiledolivedeNyons.Ilpermetaussidedonnerunerentabilitdesproduitsde hautemontagne(lAOCbrebisBargesGavarnieestleveenestivesurpturagescollectifsentre1600et 2600metlebufFingrasduMezencaudessusde1100m)etdaccrotreleprixdeventedesouventplus de 30% ce qui permet de revitaliser des territoires entiers (Roquefort, Nyons), protger la biodiversit, rduirelaconsommationdeproduitsphytosanitaireset,parlentretiendesparcours,maintenirlaqualit despaysagesetrduirelerisquedincendie(exempledufromagedechvrePlardondesCvennes)

Encadr4.LAubrac:unexemplederenouveauparleterroir, unpanierdebiensetdeservices Paysolesrigueursdelexistenceenmontagne,lacohrencedespratiques,lecaractreprofonddune forme de civilisation ancestrale, le respect des valeurs, ont forg le sens du travail, de lhospitalit et de laccueil (A Valadier), lAubrac, plateau daltitude enclav et isol par la neige lhiver, est situe au carrefour du Cantal, de la Lozre et de lAveyron et de 3 rgions (Languedoc, MidiPyrnes, Auvergne). LAubracestaussilenomduneracebovineconnuepoursonadaptationlamontagneetpourlaqualit de sa viande. La rgion dans les annes 1960 se meurt: la tentative dadoption du modle productiviste (vaches holstein, ensilage, engrais,) ny peut rien: les jeunes migrent, lAubrac nest pas une rgion comptitivesurlemarchagricolemoderne. Cependant,50annesaprs,leprixdulaitestledoubleduprixmoyenenFrance,laproductiondefromage de Laguiole est revenue 700 tonnes contre 25 tonnes, la cooprative jeune montagne qui produit fromagedeLaguioleetaligotacr80emploisnouveaux,letroupeaudevachemrederacepureAubrac estde150.000ttescontre18.000en1978,laligot,plattraditionnelbasedefromageetpommedeterre, estvendudanstoutelaFranceenfraissousbarquetteetensurgel,avecunecroissancedemarchde20% par an, le couteau de Laguiole qui valorise le 5me quartier emploie 200 personnes contre 3 en 1980. La maison de lAubrac, qui reoit 94.000 visiteurs par an, les nombreux gtes ruraux, maisons et chambres dhtes, les vnements festifs, une restauration de haute qualit (la rgion compte un des rares restaurants3*duguideMichelin),lareconnaissancedelAubraccommesiteremarquabledugotetde Laguiolecommevillegourmande2001ajoutentlattractivitterritorialeetladynamiqueculturelle, conomique et sociale. Les lus et socioprofessionnels sollicitent actuellement les 3 rgions concernes pourlacrationdunparcnaturelrgional. Ce magnifique succs a t permis par quelques hommes de progrs qui ont pu, localement, initier une nouvelle dynamique, impulse par une recherche cooprative pluridisciplinaire. Les tudes ralises en 13

2007parleCEMAGREF(institutderecherchepourlingnieriedelagricultureetdelenvironnement)ont montrdepuisqueproduitsetservicesduterroirsevalorisentmutuellementmalgrunprocessusdachat spar. Si lagriculture et les produits de qualit ont t les lments pilotes du panier de biens et de services territorial, les restaurateurs ont permis den renforcer la valeur et la diffusion en mettant en partageuneculturealimentaireetunegastronomieterritorialises. UNENJEUPOURLESPAYSENDEVELOPPEMENT CequivautpourlesrgionsruralesdifficilesdespaysindustrialissdelEuropemditerranennevautsansdouteencore biendavantagepourcellesdespaysendveloppementetentransitiondontlesnombreusespopulationsruralespauvres desmontagnesetdeszonesaridesdoiventpouvoirtrouverdenouveauxhorizonsconomiques,sociauxetculturelspour sinscrireavecsuccsdanslamondialisationpluttquedendevenirlesprincipalesvictimes. Cesrgionsruralesmarginalisestrspeuplessontaussisouventconfrontesdesproblmesgravesdedgradation environnementale, notamment des collectifs et des forts. Face lchec des politiques technicistes de lutte contre la dsertification, les approches terroirs tendent simposer comme des alternatives ncessaires pour responsabiliser les communauts, restaurer localement les systmes de production et produire des services importants pour les populationsetpourlesconomiessituesenaval(conservationdeleauetdessols,productiondeau,rductiondela vulnrabilit aux inondations, gestion durable de paysages culturels de qualit,) au bnfice de lensemble des collectivitsnationales.Cesapprochesinvitentlacomprhensionetlareconnaissancedesusagessociofonciersdes terroirs des communauts et la contractualisation de plans de gestion ngocis, accompagns le cas chant de paiementspourservicesenvironnementaux. Lesenjeuxdesterroirsetdesidentificationsgographiques,onlesaitauMaroccommeenTurquie,enIndeouenChine, sontconsidrablescarlepoidsetlavulnrabilitdelapetiteagricultureetdeszonesdifficilessontmajeures,etledfi relever immense. Cest celui de la professionnalisation de centaines de millions de paysans, de la cration de valeur ajoute et de la gestion durable des ressources naturelles. Il en va la fois de la durabilit environnementale, des quilibres urbains, du devenir des finances publiques, de la scurit alimentaire et de la stabilit future, et donc aussi dunerussiteoudunchecdelatransitionconomiqueetsociale. UNENJEUGLOBALDEDEVELOPPEMENTDURABLE Lesterroirspeuventtreaussiloccasiondunmaintien(etdelaproduction)deladiversit,etderenouveauculturelet scientifique, et leur contribution la scurit alimentaire quantitative et qualitative (alimentation de sant)est trs importante. Producteurs de biens publics, les terroirs sont ainsi placs au cur des questions de dveloppement durable. Cette contribution, dj importante, pourrait saccrotre car la monte structurelle annonce des prix du ptroleetdesengraisetpesticidesetladifficultcroissantequaurontlesindustrielsdelindustriechimiquemettresur le march de nouvelles molcules efficaces pourraient bien venir rinterroger le modle agroindustriel actuellement dominantetlesparadigmesquilontfond. Ainsiplusieurschercheursminentsplaidentpourunenouvelledoublerencontreentreagronomieetcologie,comme entresavoirsformelsetsavoirslocaux,pourproduireplusetmieuxenmettantprofitlespotentialitsproductives de chaque systme agrocologique, de chaque terroir. Ils invitent ainsi promouvoir une rvolution doublement verte,uneagricultureproductivehautevaleurenvironnementale(onparleaussidintensificationcologique) et uneagronomie intgrale. Une telle agriculture suppose dagir audel de la seule exploitation, lchelle du paysage, et de mettre profit la diversit culturelle et naturelle. Il sagit l, pour lagriculture, dun possible changementncessairedeparadigmeversuneagriculturedurable(figure3).Lagriculturedeterroirs,capable,mieux 14

quedautres,demettreprofitlescapacitsproductivesdescosystmes,pourraitdoncdeveniruneclefmajeuredela futurescuritalimentairemondiale. Figure3.Agriculturedurable:ledplacementdeparadigme dunevisionrductionnisteversunevisionholistique

Lagriculturedurable:

Cherche concilier productivit et conservation


desressourcesnaturelles

Cherche

conserver et valoriser la diversit biologique et culturelle pour une plus grande rsilience et adaptation des systmes agricoles et alimentaires.

Estbasesurundialoguedessavoirsentresavoirs
locaux et savoirs formels. Systmes intensifs en connaissances.

Sinscrit dans de nouvelles formes darticulation


entremonderuraletmondeurbain.

(Source:prsentationdeGCalvolarunionUNESCOpourleforumPlanteTerroirsdeChefchaouen,Rabat,2009)

Lesraisonsqui,auNordcommeauSud,donnentdelactualitauxterroirs,nemanquentdoncpasetellesexpliquentles mobilisationscroissantes.LesdiffrencesdesituationdmographiqueetconomiqueentreNordetSudimposent cependantdesvoiesdecheminementdiffrenci.Ilnesagitpasseulement,pourlespaysduSud,desavoirrussirdes sauts,ilfautaussitrouverdesvoiesdedveloppementetdegestionetvalorisationdesressources,adaptesleurs atoutsetleurscontraintesdmographiquesetcologiques.LesterroirsduSudontnotammentsouventpoureuxune richesseenbiodiversitetenmainduvrefamilialeetdescommunautsencoresolidaires.Limportancedesconcepts de services environnementaux et de biens publics, sont souligner et de nouveaux quilibres seront trouver entreproductionsvivriresetproductionsdemarch.

DEBAT MONDIAL SUR LES INDICATIONS GEOGRAPHIQUES : CONFRONTATIONENAPPARENCEDEDEUXVISIONSPOURLEMONDE 3

3. L E

UNE

3.1L E S P RO D U I T S D OR I G I N E : D E S B I E N S P U B L I C S
Nos socits produisent et consomment 2 grands types de produits: des produits gnriques et des produitsdorigine: leurs dfenseurs respectifs saffrontent durement dans le dbat et dans la ngociation internationalerelatifslaconcurrenceetlargulation. Ledbatestvifcar,audeldesenjeuxcommerciauxcourtetmoyenterme,seconfrontentaufond2visionsdiffrentes pourlemondequiinterpellentbienaudeldesseulsaspectsdecommerce.Dunct,despaysneufsetdegrandes multinationalesontfaitleurpuissancesurlesproduitsgnriquesetenontlaculture:primautestdonneaubienpriv (lamarque,lebrevet)etunlibrechangesanspriseencomptedeloriginenidesprocdsetmthodesdeproduction. Delautre,unnombrecroissantdepaysdevieillehistoireetdevieillecivilisationetdescommunautslocalesdecespays entendent protger leurs produits dorigine pour des raisons qui ne sont pas seulement conomiques mais aussi
3

CechapitresappuielargementsurlelivreLegotdeloriginercemmentpubli(INAOetSOPEXA).

15

culturelles, cologiques, sociales et damnagement du territoire (quilibre urbain/rural). Sans protections en effet, les imitations se multiplient, les rputations se dtruisent et des savoirfaire (productifs, culinaires,), des produits de qualit,desterritoiresetdesenvironnements,fragilesetuniques,sontmisenpril.Or,cesproduitsdorigine,fruitsdune longueinteractionentrenatureetculture,relventdesavoirfairecollectifs.Lessavoirfaire,maisaussiparexemplele patrimoine gntique local, appartiennent ainsi la fois chacun et la communaut, au territoire: il sagit donc de bienspublics. Ainsi, au paradigme du libre change la non discrimination (laquelle nest pas, loin sen faut, exclusive dingalits) sopposeceluidelenvironnementetdelaculture:lancessairereconnaissanceetprotectiondesbienspublics,globaux, rgionaux et locaux (chaque situation peut ncessiter une rponde approprie), lesquels peuvent justifier une certaine discriminationetdesrgulations.

3.2L E S P RO D U I T S D OR I G I N E : L A N E C E S S I T E D E P O L IT IQ U E S I N N OV A N T E S
Fruitsdemisesenvaleurpatientesetadapteschaquelieu,devaritsoudesavoirfaireetderussitescommerciales, lesproductionsdorigine,toujoursissuesdeproductionsdabordvivrires,ontsouventunpassplurisculaire.Ds lantiquit gyptienne, phnicienne, grecque et romaine, le dveloppement du commerce et des civilisations mditerranennesconduitsintresserloriginedesaliments.Cellecidevientsourcedeprestigeetdemytheset,dj, objetdusurpationsoudecontrefaons.AinsiGalienpeutilremarquerquelesexportationsdemieldesCyclades,devin deFalerneetdepersildeMacdoinesontcurieusementbiensuprieureslaproductiondesairesconcernes. LAFRANCE,PAYSPIONNIER Le Moyen Age conserve un intrt pour lorigine puisquau 13me sicle le Comt ou le Parmegiano sont reconnus et protgs. Cependant, aprs des sicles de rgulations locales par les corporations, les pages, etc, la phase librale introduiteenFranceparlarvolutionde1789,lasuppressiondesprivilgesetleprimatabsoludonnlinitiative individuellepuisaulibrechangeconduisentlafindu19mesicleuneuniformisationmenaanteetlacrisedansde nombreusesrgionsrurales.LaFrancevaalorsinnover,nonsansttonnements,crisesetloissuccessives(loisde1905,de 1919, de 1920, de 1919 sur le champagne, de 1925 sur le roquefort): elle sera en 1935, grce M. Joseph Capus, un agronome devenu snateur, le premier pays instaurer un cadre national rationnel et visionnaire pour dfendre et promouvoirlorigine. Ladoptionen1935dudcretloisurlesAOC(appellationsdoriginecontrle)structureeneffetleurreconnaissancesur quatreprincipesfondamentauxtoujoursdactualit: La dfinition duneaire et de conditions de productions pour maintenirla qualit nedes usages,des facteurs naturels et des savoirfaire. Ce nestdoncplus la provenance qui est dfendue mais bien lorigine,c'estdire uneprovenanceassortiedexigencessurlaqualit,larputationetlescaractristiquesduproduit,enbrefun terroir. Descontrles. La cration dune institution compose de membres de la profession, de personnalits qualifies et de reprsentants des administrations, seule mme de dcider, sous lautorit de lEtat, des conditions de production. Cette institution, devenue en 1947 lINAO(Institut national des appellations dorigine, aujourdhui Institutnationaldelorigineetdelaqualit),avu,depuis,sonchampdecomptenceslargilensembledes produitssignesdorigineetdequalit. Une gestion collective obligatoire de lappellation, par un syndicat local de dfense du produit, aujourdhui appelorganededfenseetdegestion(ODG)etregroupantlesacteursdelafilire/territoire.

UNEXEMPLESUIVIPARLUNIONEUROPEENNE Le 14 juillet 1992, un accord est trouv au niveau de lUE grce un compromis: aux AOP (appellations dorigine protge)sajoutelanouvellecatgoriedesIGP(indicationsgographiquesprotges).Cellecipermetdeprotgerdes produits de terroir qui, lexemple du scotch whisky (obtenu en Ecosse partir dorge malte importe), ne peuvent 16

rpondreauxexigencesdesAOPetdontlaprotectionsupposeparconsquentdescahiersdeschargesmoinsexigeants (voirplushautladfinitionofficielledesAOPetIGP). Larformede2003durglementeuropenpermettraensuitedtablirunerciprocitdanslesprocduresavecledroit international. Ainsi, lUE reconnatelle aujourdhui le th darjeelingde lInde, et elle pourra reconnatre demain, lIGP ArganeduMaroc.Ilrestecependantencoreducheminparcourirpourtablirrciprocitettransparence,notamment parlaccrditationmondialedesorganismescertificateurs.

3.3 L A M OB I L I S A T I O N I N T E R N AT IO N A L E E T L E D E B A T M O N D I A L S U R L E S IG
LAMOBILISATIONINTERNATIONALE Auniveaumondial,plusieursinitiativesonttprisesenfaveurdesIG.Ainsi,laconventiondeStresasurlesfromages (1951)puislarrangementdeLisbonne(1958)dfinissentlesappellationsdorigine.Signescependantparseulement7et 22pays,leurportedemeurerelative.LOMPI(organisationmondialedelapropritintellectuelle)danslesannes1970 prend ensuite linitiative de proposer un trait pour ouvrir le bnfice des IG aux pays en dveloppement, malheureusementsanssuccs. CestfinalementauniveaudelOMC(organisationmondialeducommerce),creen1994Marrakech,queledbatet la ngociation internationale reprennent. Les ngociations, pineuses, permettent daboutir laccord ADEPIC qui reconnat la lgitimit de la protection des IG (indications gographiques, y compris les AO). Cet accord est dune importance fondamentale car il est le seul vritable contrepoids luniformisation des marchandises quentranera lapplicationdelaccordsurlesobstaclestechniquesaucommerce(OTC)galementadoptlOMC. LaccordADEPIC,rsultatduncompromisdifficile,estcependantloindesatisfairelespartisansdesIG.Ilpermeteneffet deprotgerefficacementlesseulsvinsetspiritueuxsousIGpourlesquelstouteusurpationdenomestcondamnedans tout Etat membre sans que la preuve du prjudice doive tre administre. Pour les autres produits, la protection demeure faible: elle na rien dautomatique et elle peut ncessiter des dmarches fort coteuses, fastidieuses et aux rsultatsincertains.Larticle22delaccordstipuleeneffet,pourcesproduits,quedesmarquescontenantuneindication gographiquepeuventtreinvalidessilutilisationdecetteindicationdanslamarqueestsusceptibledintroduirele publicenerreurquantauvritablelieudorigine.Leplaignantdoitdoncprouverdevantletribunaldupaysolecasse produitqueleconsommateuresttromp. LUEmiliteparconsquentpourltablissementdunregistreinternationalavecforceobligatoirepourtouslesproduits sousIG,c'estdirequelledemandelextensiondelaprotectionforteaccordeauxvinstouslesautresproduits.Elle voit naturellement sopposer elle les pays du groupede Cairns (Etats Unis, Australie, Nouvelle Zlande,Argentine), lesquels,deleurct,essayentdedonneruncaractregnriqueauxproduitsquilesintressent(exleparmesan)parle biaisdautresaccordsinternationaux,notammenttraversleCodexalimentarius. Quant aux pays en dveloppement et transition, un nombre toujours croissant dentre eux peroit maintenant limportancedesIGpourleurdveloppementetilsendeviennentdespromoteursetdesdfenseursactifs. Ainsiparexemple: les5paysdelaccorddeCarthagne(Bolivie,Equateur,Colombie,Prou,Venezuela)ontadoptds1993une rsolutionsurlesIG,exemplessuivisdepuisparnombredepaysmditerranens(Turquie,Tunisie,Maroc,)et asiatiques(Inde,Chine,Vietnam,Cambodge,). Plusieurs pays africains, sud amricains et asiatiques ont soutenu la cration de lassociation ORIGIN (organization for an international geographical indications network) cre paralllement aux ngociations lOMC.ORIGINregroupeaujourdhuiplusde80organisationsdeproducteursoriginairesde30Etats,soitenviron 2millionsdepersonnes.Ellesestdonn2objectifsprincipaux:militerpouruneprotectionplusefficaceetplus 17

pousse des IG aux niveaux national, rgional et international, et promouvoir les IG comme instrument de dveloppementdurableetdeprotectiondespratiquesetsavoirslocaux. LEDEBATENTREADVERSAIRESETPARTISANSDESINDICATIONSGEOGRAPHIQUES Lespointsdedbatpeuventtrersumscommesuit 4 . Encadr5.AdversairesetpartisansdesIG:lesargumentsdeladisputeinternationale

AdversairesdesIG
Chaque entreprise doit pouvoir utiliser en toute libert un nom gographique moins quilnesoitdjutilisparunemarque

PartisansdesIG
La proprit individuelle sur les IG ressort du droit public qui garantitunegalitdetraitementetjouequelquesoitlepays (richeoupauvre)etleproduit. Lquit demande que tous les produits bnficient du niveau deprotectiondesvins. LesIGsontunmoyenpournombredepaysendveloppement et rgions dfavorises daccder au march et de fixer les populationsrurales. Les brevets et marques demandent de lourds investissements en recherche et dveloppement inaccessibles la petite agriculture. IGetmarquesnesontpasconcurrentesmaiscomplmentaires. Les IG protgent un produit et un patrimoine collectif mis en march par des entreprises pouvant utiliser des marques. La coexistencefonctionnebien(exduchampagneouducognac)et amliorelinformationduconsommateur. LesIGpermettentdespetitsproducteursetPMEdaccder un outil de protection et de promotion qui leur serait sinon inaccessible. Lobjectifnestpasdemettresurpiedunebureaucratiemaisun systme lgislatif dont la forme est laisse lapprciation de chaqueEtat.LeregistredelaccorddeLisbonnegrparlOMPI estpeucoteux. Dans le systme actuel, le cot de protection juridique contre uneusurpation(ilfautprouverdanslepaysdelusurpateurque leconsommateuresttromp)dunproduitatteint6080.000 euros.LintrtpourlesproducteursdesIGesttelquilpourrait justifierdestaxessurlesproductionsprotgespourfinancerle systmemultinational. Les IG ne portent pas sur la provenance mais sur lorigine: elles garantissent une qualit, caractristique ou rputation. LavaleurdesIGnestpasduequlalocalisation:elletientle plussouventdescotsdeproductionpluslevs. Ilnesagitpasdeclubscartoutoprateurtablidanslaire dlimite peut avoir accs lIG sil respecte le cahier des charges. Les IG sont des multiplicateurs efficaces de bien tre qui permettent une plus juste rpartition de la valeur ajoute danslesfilires.Ellesontuneffetstructurantimportantsurle dveloppement rural, protgent les petits producteurs et maintiennent lancrage au lieu, au contraire des marques, dlocalisablesparnature.

Philosophieetdroit

IGetdveloppement

Les IG sont une entrave au libre commerce et empchent des noms de devenir gnriques

IGcontremarquesprives?

Les IG tuent les marques et la coexistence est nfaste. Elle cre de la confusionchezleconsommateur

Unecoteusebureaucratie?

Un systme multinational denregistrement et de protection des IG serait coteux et lourd.Ilengendreraitdesdpensespourles producteurs et in fine pour les consommateurs

LesIGcontrelalibre concurrence?

LesIGfaussentlaconcurrenceetconstituent desobstaclesaucommerce. Les IG jouissent dune rente indue qui augmenteleprixauconsommateur LesIGsontdesclubsfermsquilimitent loffresurlemarch

Tableauralispartirdelanalysedudocument:legotdelorigineINAOetSOPEXA

18

Informationdu consommateur

PourlesadversairesdesIG,leconsommateurmoyenneconnaitpasloriginehabituelledunproduit(parexun consommateur nozlandais moyen nest pas tromp par un roquefort de Nouvelle Zlande puisquil ne sait pasqueleroquefortestuneproductiontraditionnelledusuddelaFranceproduiteseloncertainssavoirfaire spcifiques).PourundfenseurdesIGreconnatreunetelleinterprtationdelaccordADEPICseraitdonner uneprimeauproducteurleplusmalhonnteetauconsommateurleplusstupide Lidologielibraleadmetunedfinitionrglementairedesproduitsdelagriculturebiologiquealorsquececine setraduitpasforcmentparunediffrencedegot.CommentpeutellealorscontesterlesIGaumotifquils ne se distinguent pas forcment par leur qualit mais parfois par dautres aspects (valeurs socitales, aspect bnfiquepourlenvironnementetledveloppementrural)?

U N E C O N F R O N T A T I O N E N T R E 2 V I S I O N S P O U R L E M O N D E LaconfrontationentrepaysneufsdugroupedeCairnsetpayspartisansdesIGpeutsexpliquerparlesidologiesetpar lesintrtsdominantsquirsultentdesdiffrencesdvolutionshistoriquesetdelagographie.Lespaysdugroupede Cairns,paysdotsdevastesespacesnaturels,onttcolonisspardespionnierseuropenspauvresattirsparlalibert et par les esprances de fortunes. Linitiative individuelle est au centre des nouvelles valeurs et lEtat ne doit pas lentraver,ladisponibilittechnique(mcanisation)etfoncire(lesindignesdesrgionsconcernessontprivsdeleurs droits et extermins ou parqus dans des rserves) permettent de crer des structures productives agricoles incomparablesaveccellesdEurope,dAfriqueetdAsie.Lesproduits,sansancragehistoriqueetculturel,sontgnriques et la libre concurrence sexerce pour faire baisser les cots de production,, en limitant la diversit. Comme le disait Ford: tous les acheteurs de mes voiturepeuvent choisir la couleur quils souhaitent conditionquelle soitnoire. Comme aucun texte ne protge les noms gographiques, ceuxci deviennent vite gnriques. La seule protection des entrepreneursestlamarqueetlebrevet. Lemodlelibraletlesproduitsgnriquesontmontrleurefficacitconomiqueetgnrdesfirmestransnationales dune puissance sans prcdent, ce qui a facilit lextension du modle et de ses produits aux autres continents et apport une contribution la rduction de la pauvret. Cependant, ils ont en mme temps gnr des problmes multiples:appauvrissementdepopulationsruralesetcreusementdesdsquilibresrgionauxdufaitdelincapacitde lapetiteagriculturetraditionnelledenombreuxpaysrsisterlaconcurrencemondiale,montedegravesproblmes environnementaux et dune alimentation peu favorable la sant et des problmes de surpoids et des maladies lies, pertes de biodiversit et de savoirfaire, dnaturation irrmdiable de produits dorigine qui nont pas pu ou su se protger,.Bref,beaucoupdexternalitsngativesetpeudexternalitspositives. Le cas de la fta peut illustrer lopposition de logique entre modle libral / produit gnrique et modle dIG: en imitation de la fta grecque, on a produit en Europe de louest et ailleurs de la fta industrielle et abaiss le cot globaldetransformationde25%en10anspardestechniquestellesquelutilisationdulaitreconstituoulasuppression delaffinage;doncunproduitbienloindelaftatraditionnelle. Si le modle de concurrence librale garde son attrait pour nombre de pays, la ncessit de prserver les ressources vitales(climat,nergie,biodiversit,savoirfaire,eau,sols,),dappuyeretdefixerlapetiteagricultureetdepermettre undveloppementquilibrdespaysestdeplusenpluscomprisecommeunencessitincontournable.Ilenvaeneffet du maintien des cohsions, de la scurit alimentaire et de la stabilit collective. Lattrait de systmes dIG biens publics,estdonccroissantpournombredepays. Le monde devra, dans tous les cas, imprativement encourager des modes de dveloppement, de production et de consommationplusdurablespourrussirledcouplageentrecroissanceduPIBetconsommationderessources(et productions de dchets et missions) et produire des externalits positives: services environnementaux et territoriaux, alimentation de sant Dans ces modles innovants, les identifications gographiques, et les approches terroirs,aurontuneplaceimportantetenirsiellesparviennentaccrotreleurlgitimitentermesdebienspublicsou deproductionsdetelsbiens. Cecinesignifiepasquilconvientdopposerlesproduitsgnriquesauxproduitsdeterroirsetquilnyapasplacepour plusieursmodlesagricolesetalimentaires.Bienaucontrairecarles2grandstypesdeproduitssontcomplmentaireset la nouvelle agriculture sera plurielle. Dans chaque pays en effet, la diversit des territoires invite une diversit de modles productifs et les consommateurs sont demandeurs des 2 types de produits. Pour que produits gnriques et doriginepuissentcoexister,ilfautcependantquecesdernierspuissenttreconsidrsetprotgs. Laquestiondesterroirsetdeleursproduits,celledesapprochesterroirs,etlesfuturesdcisionsprisesauxniveaux internationaletrgionalsurlesIG,sontdoncduneimportancecentralepourledveloppementdurable.Etcesdcisions pourraientbienmodelerlessocitshumainesetnotreplantepourlongtemps. 19

3.4L E S IN D I C A T I O N S G E O G R AP H I Q U E S : U N R I S Q U E P O U R L E S T E R R O I R S ?
Les IG sont un outil fondamental pour le dveloppement des terroirs mais ce peut tre aussi un risque. De nombreux experts considrent en effet que leur dveloppement exclusif sur un terroir donn peut conduire une situation de monoproductionaveclesnombreuxrisquesquecelapeutentraner: Risquesconomiquescar,encasdecrisedumarchsurleproduitdonn,cesttoutelargionquiensubitles consquences, Risquessociauxcaronpousselesagriculteursabandonnerlesculturesvivrires,cequinestpasnonplussans risques, Risques environnementaux car on peut dvelopper des mcanismes pervers, agronomiques ou cologiques, banaliseretaffaiblirlescosystmes,dgraderdespaysagesdehautequalit.

DenombreuxexemplesinternationauxquinoaenEquateur,cacaoausudduCameroun,thausudestduRwandale montrent.Leproduitdeterroirpourraitdonctresusceptible,danscertainscasextrmes,detuerleterroir! Larussitedudveloppementdurabledesterroirsimposeparconsquentdepenseretdagirmultiproductions(sans se limiter aux seuls produits IG),systmes etdonc paniers debiens etde services. Les politiques agricoles de terroirsdevraientdonctreautantdespolitiquesdeterritoires(etdoncaussidesocitruraleetdenature)quede filires,etnepasselimiterauxseulesidentificationsgographiques.

4.Q U EST CEQU UNTERROIR ?

4.1L A D E F I N I T I ON D U T E R R O I R
Laconceptualisationduterroirnmergequau19mesicleavecledveloppementdelapdologie,lasciencedusol. Le terme prend alors une dimension essentiellement de gographie, le terroir tant considr comme un lment du finage. Leterroir est considr immanent: les hommes ne fontquen rvler les potentialits. On estdonc loin du terme populaire terroir que lon retrouve dans des expressions telles que accents de terroirs, ou produits de terroir. Cependant,grceautravaildescientifiques,unevolutiondutermevasoprer.Leterroirdevientaussicompriscomme lexpressiondunesocithumaineetdesonorganisationsociale,desespratiques,desesactivitsetdesonhistoire.Les terroirs sont alors apprhends comme des espaces particuliers, au sein desquels certaines productions et activits se dveloppent et sinscrivent dans des cultures locales: le terroir devient un concept qui tisse des liens entre culture et nature(voirlafigurecidessousproposesparTerroirsetCultures). Figure4.Leterroir,systmedinteractions(sourceTerroirsetCultures)

20

Ladfinitionactuellementretenue,laborelUNESCOdanslecadredespremiresrencontresinternationalesPlante TerroirssuiteuntravailconjointdelINAOetdelINRAFrance,estlasuivante. Encadr6.Ladfinitionduterroir UnTerroirestunespacegographiquedlimit,dfinipartird'unecommunauthumainequiconstruit aucoursdesonhistoireunensembledetraitsculturelsdistinctifs,desavoirs,etdepratiquesfondssurun systmed'interactionsentrelemilieunatureletlesfacteurshumains. Les savoirfaire mis en jeu rvlent une originalit, confrent une typicit et permettent une reconnaissance pour les produits ou services originaires de cet espace et donc pour les hommes qui y vivent. Lesterroirssontdesespacesvivantsetinnovantsquinepeuventtreassimilslaseuletradition.

4.2 L E S T E R R O I R S : T E R R IT O I R E S D E P R O D U I T S , D E N A T U R E L L E S E T D E P A N I E R S D E B IE N S E T D E S E R V I C E S G E S T I O N
DES RESSOURCES

Cettedfinitioninvitecomprendreleterroirdansuneacceptionlarge.LestravauxduCGDArelatifsauPilierIIduPlan MarocVertontconduitmettreenavanttroisgrandesentresdelectureetdaction,possiblesetncessaires. Lapremireentre,agrocologique,estcelledelagestiondesressourcesnaturellesetbiologiques.Pourquunterroir existeetproduise,ilfautdabordquelacommunautconcernesacheengrerlesressourcesdunefaondurable.Ceci suppose toute une srie desavoirfaire qui peuventaller de la manire de conserveret mettre enculture les sols la slectionetprservationderacesetcultivarsadaptsauxcontraintesetncessitslocalesetlagouvernancecollective deleauoudesparcours.Lenjeudelagestionestsouventdouble:produiredavantagepourassurerlalimentationde communauts croissantes en nombreou pour vendre davantage sur les marchs; rduire les risques, par exemple dinondations.Cedoubleenjeu:rduirelesrisquesetproduireplusestnotammentletraitcommunessentielde toutes les montagnes mditerranennes. Les efforts considrables raliss au cours de lhistoire par les communauts pour crer et conserver des sols, matriser leau, diversifier le patrimoine gntique, dvelopper la petite irrigation, larboriculture et lagrosylvopastoralisme peuvent sy regarder comme livre ouvert. Il en a rsult des paysages construits et une exceptionnelle diversit de terroirs, de races et de varits locales (rien quaux alentours de Chefchaouen,ondnombrerait133varitsdiffrentesdefigues)etdergimesalimentaires. Une deuxime entre est celle des produits issus du terroir. Cest celle des produits de terroir et des multiples spcialitsculinairesetautresquilesaccompagnent.Certainsproduitsoccupentuneairegographiquelarge,dautres, extrmementlocale. 21

Une3meentreestcelleduterritoire:panierdebiensetdeservices:leterroirestunensembleterritorialcomplexe fruitdinteractionsmultiplesentrenatureetculture;ilneserduitpasdessavoirfairedanslagestiondesressources naturellesetdanslaproductiondedenresalimentairesetspcialitsculinaires.Ilpermetetilabesoindautresproduits, notammentartisanaux,ainsiquedunediversitdesavoirfaireetdeservices.Lespaysages,ycomprislhabitatrural, lepetitpatrimoinebti,sont,entreautreschoses,lesfruitsdecetteinteraction.Ilpeutaussimettredisposition,outre sesproduits,touteunesriedeservices,dontletourisme,lequelpeutcontribuerassurerlapromotiondesesproduits.

4.3Q U E L QU E S C O M M E N T A I R E S S UR L A D E F IN I T I O N
Unespacegographiquementdlimit

Leterroirestunespace,concret,gographique,dontleslimitesnesontpasprexistantesmaisrelventdesvolutions historiquesetsouventd'unengociationetdecompromissociopolitiques.Laquestiondeladlimitationestdautantplus complexequeleslimitesprendreencomptenesontpasforcmentlesmmeslorsquonabordeleterroirsouslangle delagestiondesressourcesnaturelles,desproduits,oudespaniersdebiensetdeservices:

Le douar au Maroc, c'estdire le terroir villageois ou espace sociofoncier de base, espace de la


communautlocaleetdelajmaa,estparexempleunespaceincontournablepourlagestiondesressources naturelles.Lesairespastoralessontunautreespaceimportantconsidrer.

Ladlimitationdelairedunproduitdeterroirpeutvarierbeaucoupdunproduitlautre:lhuiledolivede
TyoutChiadmaestproduitesurunterroirde100hectaresalorsquelesafrandeTaliouineconcerneunedizaine decommunesetlhuiledarganunespacede800.000hectares,doncunimmenseterroircomposluimme dune multitude de petits terroirs. La dlimitation dune indication gographique peut faire lobjet de ngociationslonguesetdifficiles,car,selonquelalimitepasseraiciol,despropritairesetproducteursseront fortementpnalissoubnficiaires.

La dlimitation du terroir, territoire du panier de biens et de services, peut tre tout aussi discute. Il
sagitsouventdespacesnaturelsethumains,valle,plateau,oasis,massif,,montrantunecertainesingularit. CestlecasparexempledelAubrac(unplateau)oudoasismarocaines.LepaysjebliduRif,commelemassif duSiroua,avecsonlevagedaltitude,salainequiagnrletapisdeTazenakhtetlesafrandeTaliouine(quise retrouveaussibienversantatlantiquequeversantendoriqueetquiestaussiutiliscommecolorantdestapis) pourraientparexempletreconsidrscommedesterroirs.Unterroir,panierdebiensetdeservices,peut galementcorrespondreunepetitergionruralecentresurunepetitevillerecouvrantplusieursmilieuxagro cologiquesmaisayantdveloppunecertaineidentitproprequienfaitcequelonpeutappelerunpays. Unequestionimportanteestcelledesterroirsdestinationstouristiques,dontladimensionpeutvolueravec letemps.AinsilesHautesCvennes,redynamisesparleurparcnationalformentunensembleforteidentit (etmultiplesproduitsdeterroirsetterroirs)quiestaussidevenuunedestinationetungrandpanierde biensetdeservices. Ainsilesterroirscommeterritoiresdeprojetsouprojetsdeterritoires:

peuventilsavoirdesdlimitationsmultiples,complexes,etembotes, relventengnraldedimensionsinfraousupracommunalesetnecorrespondentpas,saufexceptions,des
dlimitationsadministratives. Unecommunauthumaine,destraitsculturelsdistinctifsfondssurunsystmedinteractionsentrelemilieu natureletlesfacteurshumains

Sans hommes, il ny a videmment pas de terroirs. Le terroir est construit (dans cet espace) par une communaut humaine.Cettenotiondecommunauthumaineestlieladfinitionclassiqueduterroir,tourneversl'agriculture: letravaildel'hommemetenvaleurlespotentialitsagricoles.Autourdecetravail,secrentdesliensdesolidarit,des identits,deshistoires et des rgles collectives partages. Cette communaut humaine est intgre une socit plus largequiimposesesrglesgnrales. Dessavoirfairequirvlentuneoriginalitetconfrentunetypicit 22

Les savoirs, partags et transmissibles, ne sont pas figs dans le temps, mais sont un processus continu d'volution et d'innovation, fonds sur des interactions constantes entre facteurs humains et du milieu et sur l'accumulation d'expriencesindividuellesetcollectivesdansletemps.Cesinteractionsconstantesdonnentauxproduitsdeterroirsune originalitquilesdistinguedesautresetdoncunetypicit(encadr). Encadr7.Qu'estcequelatypicit?

La typicit d'un produit issu de l'agriculture est la proprit d'appartenance un type distingu et identifi par un groupe humain de rfrence possdant des savoirs distribus entre les diffrents acteurs de la filire; un savoir-tablir, un savoir-produire, un savoir-valuer, un savoir-apprcier. Elle ne doit pas tre confondue avec la conformit une norme et admet une varit interne au type. Parmi les multiples expressions de la typicit, la typicit lie au terroir est une construction particulire qui concrtise l'effet du terroir pour un produit donn. (F. Casablanca, INRA/INAO, Terroirs et Cultures). Plus simplement, un produit typique :

est reprsentatif de sa catgorie, prsente des spcificits, qualitatives et quantitatives, la fois culturelles, sociales, organoleptiques, de transformation, etc. qu'il est possible de classer selon une typologie, possde des caractristiques qui le distinguent de produits similaires : il est original, voit sa typicit reconnue par un groupe d'acteurs impliqus (consommateurs, producteurs, transformateurs...). Une reconnaissance pour les produits et services originaires de cet espace, et donc pour les hommes qui y vivent

Les communauts des terroirs se reconnaissent travers leurs savoirfaire et leurs produits. Cependant, la reconnaissancepeuttreaussiexternenotammentquandlesproduitsetservicesdesterroirs,grceleurtypicitet leurmisesurlemarch,saventsedonnerunerputation.Larputationdesproduitspeuttresifortequellefait aussilarputationdesterroirseuxmmesvoiredeterritoirespluslargesoleursproduitssontcommercialiss,crant ainsiunerentequibnficieauxacteurslocauxetrgionaux.Larputationdesservicesvasouventdepairaveccelledes produits.Unproduitdequalitinvitedesrecettesculinairesdequalitetundveloppementdunerestaurationde terroir.Aveclamontedelacrisecologique,ondoitparailleurssattendreunemeilleurereconnaissancedesservices environnementauxdesterroirs. Desespacesinnovantsetvivantsquinepeuventtreassimilslaseuletradition

Leterroirentretientunerelationautempspourlemoinsambigu:eneffet,l'histoiretientunrleprimordialdansle rapport au lieu d'un produit car lancrage historique du bien ou du service contribue sa typicit et le lie au terroir. Cependant, un terroir nexiste que parce quil est innovant et la question de la profondeur historique retenir se pose. Laquestionestdlicate:quelleestladurepartirdelaquelleilestpossibledeconsidrerquelebienestpleinement intgrdansl'histoiredelargion?Lalgislationeuropenneconsidrequeleminimumestletempsd'unegnration, soitunetrentained'annes,alorsqu'enpratique,cesancragessecomptentsouventtantensiclesqu'endcennies. Or,enEurope,lesgrandschamboulementsagricolesquionteulieulafindu20esicleetquiontprofondmentmodifi l'organisationdesexploitationsagricolessontantrieursunegnration.Lesproduitsissusdecetyped'exploitations sontilspourautantancrsdanslaculturelocale?Unedespistespoursortirdecedilemmeestdeprterattentionla reconnaissancedecesproduitslocaux,maisaussilatransmissiondessavoirfaire(mmesicesderniersontvolus) quiysontassocis.Cettequestionestdlicate,danslamesureountravailderecensement,derecherchedestraces qu'onpulaissercesproduitstraditionnelsestncessaire.Orceciestardupourdeuxraisons:d'abordcarlatransmission de ce type d'histoires est essentiellement orale ; ensuite, car longtemps, ces productions dites typiques taient souventusagedomestique(lesamet,siropderaisinproduitdanslargiondeChefchaouenetdeSallafindu me 19 sicleenestunexempleemblmatique).Ainsi,pourmenerbienunepolitiquedeterroir,ilsembleimpratifde sefondersurdesrcitsorauxetsurlacultureorale,d'autantplusauMarococelleciestdominantenotammentdans lesrgionsenclavescommelesmontagnes.Ils'agitdoncd'treconscientdel'importanced'unteltyped'informationet de les considrer tout autant que les sources crites et/ou scientifiques. Ainsi, l'un des points cruciaux lors du 23

recensementdesproduitsdeterroirestl'attentionetlaminutieapporterl'analysedel'ancragedunproduitdansla culturelocale,deparsaprsencehistoriqueetsareconnaissanceparlesacteursentantqueproduitlocal. Silaquestiondelancrageautempsestimportanteetcomplexe,celledelinnovation,sagissantdesterroirs,lesttout autant.Ledveloppementdesterroirsnesignifiepaseneffetunarrt,voireunretourdansletempsetilnesagitpas plus de driver vers une complaisance passiste qui magnifierait les modes de vie ancestraux, enfermant les espaces concerns dans une reprsentation de muses poussireux que de vouloir copier des modles de production ou dalimentation dominants ne permettant pas de conserver et de valoriser ce qui faitla vritable valeur potentielle des terroirsetdeleursproduitsetservices. Linnovationestunconceptfondamental:eneffet,lesterroirsdaujourdhuinexistentqueparcequilsontthierdes espacesdinnovationetilsnepeuventcontinuertrequeparconstructionetinnovationpermanente.Lesinnovations mettreenuvrepeuventconcernerplusieurschamps(encadr).Ellessontincontournablespour:

inscrireavecsuccslesterroirsetleursproduitsetservicesdanslconomiemoderne, russirladaptationdesterroirsauchangementclimatiqueetrpondreauxnouveauxenjeuxdudveloppement
durableenproduisantdenouveauxservicesenvironnementaux,

aiderlescommunautsrduirelapnibilitdestchesquotidiennes,voirleursrevenusamliorsetfaire
ensortequelesjeunessinvestissentpourdevenirlesacteursdunenouvelleagricultureetdunenouvelle ruralit. Encadr8.Terroirsetinnovations
Linnovationdanslagestiondesressourcesnaturelles Les terroirs, dont une caractristique essentielle est limportance de la petite agriculture et souvent le maintien de communautslocalesencorerelativementsoudes,sontdesespacesprivilgispourinnoverdanslestechniquesetdansla gestiondesressourcesnaturelles:agrocologie,agroforesterie,gestioncontractualiseaveclescommunautsdesressources naturelles,valorisationdunetrsrichebiodiversit,gestionetvalorisationlocaledelamatireorganique,etc.Linnovationdoit aussiconcernerlaressourceboisnergieavec,parexemplelaconstructiondehammamsforteefficacitnergtique.Elleest incontournablepourarrterlesdgradationsdesressourcesnaturelles,maintenirourestaurerdesterroirsproductifs,produire desservicesenvironnementauxetrussirladaptationauchangementclimatique. Linnovationdanslestechniquesdetransformation De nouvelles techniques de transformation sont indispensables pour rduire la pnibilit de nombreuses tches, qui, si elles semblent authentiques et pleines d'un charme dsuet pour les citadins dracins, sont en ralit lourdes, puisantes et chronophagespour les petits producteurs ruraux. Elles doiventcependant permettre de conserver lauthenticit et la typicit desproduits.Lescommunautsdoiventainsimontrerdescapacitsdecrativitetd'innovation.Lexempledeschtaignesdes Cvennes peut tre donn. Les nouvelles techniques mises au point localement ont permis de rduire considrablement la pnibilitdutravailetletempsconsacrauramassage,autri,auschage.Desmoulinsinnovantsontputremisaupointetdes farinesdegrandequalitproduitesycomprispourexporterauJapon.Dautrestechniquesontpermisderhabiliterdesvergers traditionnelset desvaritslocalesdehautequalit.L'huiled'olivedeTyoutChiadmapeuttreaussiciteenexemple:une nouvellehuilerieestencoursdeconstruction,avecdesmeulestraditionnelles(etnondesappareilsdetriturationmodernes), despressestraditionnellesavecdespaniersenfibredecoco,maismcaniques.Ladcantationsefaitsansfiltre,etl'ensemble du processus,s'il suit le processus traditionnel de fabrication de l'huile d'olive, rpond auxnormes sanitaires ncessaires la commercialisation(d'exportationetdansdesgrandessurfaces). Linnovationdansleconditionnement,lapromotionetlacommercialisation La mise en place de ftes de terroirs est dune importance stratgique pour mobiliser les communauts, faire connatre les produitsetsavoirfaire,enaccrotrelarputation,souvrirlextrieuretnouerdenouvellesrelations,ycompriscommerciales. Ilsagitaussidinnoverdansleconditionnementetdanslesmodesdecommercialisation.Lesdattesmisesenbotescarton,le safran en botes plastique transparente de trs petite dimension, laligot conditionn frais sous vide ou surgel, sont autant dinnovationsquidonnentdelavaleurauxproduitsetpermettentdenlargirlesmarchs.Laqualitdupackagingestun pointtoujoursimportant.Dessiteswebetdesmaisonsdeterroirssontdautresinnovationsutiles.Undespointsamliorer

24

pourlamiseenmarchestsouventlalogistique(organisationdelachanedefroid,transports). Linnovationdanslagouvernance Pour que les terroirs puissent tre, des gouvernances locales trs pointues ont d dans le pass tre inventes. Cest le cas notammentenMditerraneolesquestionsdegestiondeleau,dessols,desparcours,trscomplexes,ncessitentdesrgles collectives prcises permettant dassurer production, matrise des risques, quit et durabilit. De nouvelles formes de gouvernancedoiventaujourdhuitretrouvescar lemondechangeetdenouveauxacteurssontapparusquibousculentles rglesanciennes.Lesinnovationsintroduiresontnombreuses,quilsagissederestaurerunegestiondurabledesressourceset de sadapter au changement climatique, de crer des IG, daccder avec succs aux marchs ou de produire de nouveaux services (tourisme,) et formes de dveloppement territorialis. Elles ncessitent souvent de nouvelles relations entre communautslocalesetautoritspubliquesetdenouvellesrgles.

5. L APPROCHE TERROIRS : QUELLES GOUVERNANCES ET QUELLES POLITIQUES POURLESTERROIRS ?

5.1G O U V E R N A N C E L OC A L E E T A P P R O C H E A S C E N D A N T E
Lesterroirssontunechose,lesapprochesterroirsquienpermettentlamiseendynamiqueensontuneautre. Lexpriencefranaisepermetdemettreenexerguelimportancedelagouvernancelocale.DanslAubracparexemple, cest un groupe de jeunes agriculteurs entrans par lun dentre eux, M. Andr Valadier, qui a cru et os (pour reprendrecettebelledevisedelaCOPAG,unexempleremarquablededveloppementauMarocmaissurdesproduits gnriques). MValadieraprsunvoyageauxPaysBasavaitcomprisquelAubracnepourraitjamaistrecomptitifsurlesproduits gnriques. Il fallait donc revenir aux sources plutt que de suivre des modles de dveloppement inadapts et sans avenirpoursargion.Legroupe,unedizainedeproducteurs,sopposantauxschmasalorsvhiculsparlespolitiques agricoles productivistes et leurs divers promoteurs (recherche, chambres, syndicats, techniciens,), crrent la cooprative jeune montagne pour relancer la production de fromage de qualit qui priclitait. Lexigence dauthenticitpourleproduit(fabricationpartirdelaitcru,arrtdelensilageetretouraufoin,respectdestapesde fabrication traditionnelle et daffinage et respect du produit) et linnovationdans les process (transformation du 5 fromageencooprativeetnonplusenburon ,miseaupointdemachinesspcifiquespourlesalage,miseaupointde nouveaux procds en surgel et frais sous vide pour laligot, etc), dans la gouvernance (rgles de gestion de la cooprative) et dans la promotion et commercialisation furent les facteurs fondamentaux du succs. Cette initiative, contrecourant,eutparsuiteuneffetdentranementsurtoutleterritoire:lAubracretrouvasesvaleurs,safiert,une prosprit et un avenir et montra que la petite agriculture de montagne pouvait avoir de lavenir et quil ne sagissait doncpasdelacataloguercommedetypesocial. Cette russite locale a cependant t permise aussi par des appuis externes. Ainsi, le crdit agricole, le directeur dpartementaldelagriculturequiaidalacooprativeobteniruneaidedelANVAR(agencedelinnovation)etensuite lINAO(institutnationaldelaqualitetdelorigine)pourlareconnaissanceenAOPetIGPdufromagedeLaguioleetdela viande dAubrac, jourent un rle important. La recherche contribua aussi fortement au succscar lAubrac, espace dautrefois, qui semblait condamn un dclin irrmdiable, intressa en 1960 le CNRSet une quipe pluri institutionnelleetpluridisciplinaire:leurstravaux,enrvlantlacohrencedespratiquestraditionnelles,enmontrrent lintelligence,et,lassociantdesinnovations,aidrentaurenouveaulocal. Ce cas et bien dautres montrent que les terroirs ne peuvent trouver leurs voies par des approches par le haut (descendantes ou top down) standardises. Dj considres comme dpasses pour mener bien un projet de dveloppementclassique,ellesnepeuventpermettredegnrerdesdynamiquesdeterroirslesquellesncessitentune comprhension du potentiel local et la mobilisation dacteurs locaux pour des approches innovantes. Lapproche terroir suppose par consquent des approches territorialises de type bottom up (ascendantes): il sagit donc dinscrirelagouvernanceagricole(ouartisanale,touristique,)auniveaulocal/territorialetdaiderlespetitsagriculteurs
5

Leburonestunepetitecabaneconstruitesurlestivequipermetlafabricationsurplacedufromage.

25

et les communauts locales, seuls bien connatre leurs terroirs, exprimer leurs besoins et laborer leurs propres projets.

5.2 L A Q UE S T I O N D E S P O L IT I Q U E S P U B L I Q U E S
Lapprocheterroirpeuttreaussibienentravequefaciliteparlespolitiquespubliques.Parexemple,lesoutienapport parlUEaumasensilageaeudesimpactstrsngatifssurlesterroirs.Acontrariolespolitiquesagricolespeuventjouer un rle positif dterminant. La question agricole est en effet au cur de la question des terroirs (dans leurs 3 dimensions: les produits, la gestion des ressources naturelles, le dveloppement territorial) et les politiques agricoles disposent de capacits multiples (services de terrain, tablissements de recherche et de formation, administration dconcentre,agencesdepaiement)quipeuventtremisesprofit.Ellespeuventaussimettreenplacedenouveaux dispositifs(institutions,financements,mthodes)adaptsspcifiquementauxterroirsetauxindicationsgographiques. Ainsi les pays qui ont su renouveler leurs politiques et institutions agricoles peuvent tre trs gagnants et donner aux dynamiques de dveloppement des terroirs une dimension nouvelle, une cohrence densemble et une ambition renforce. Dautres politiques peuvent aussi jouer un rle utile, notamment celles despaces protgs et damnagement du territoire.Lesapprochesterroirsgagnentdunefaongnraleuneplusgrandedcentralisationetsubsidiaritde dcisionetdaction.Limplicationcroissantedesrgionsetledveloppementdelintercommunalit(quineselimitepas aucasdesparcsnaturelsrgionaux)sontdesmoteurspossiblesdeprogrs. Lexpriencefranaisemontrequelesoutilsdepolitiquepourmettreenplacedesapprochesterroirssontenfaittrs nombreuxetdiffrentselonles3grandesentresrappelesplushaut:cellesdesproduits,desressourcesnaturelleset desterroirs,paniersdebiensetdeservices(tableau).Ilconvientdoncdexaminersuccinctementchacundeces3cas. Encadr9.Unelargepanopliepossibledepolitiquesetprojets Entre Terroirs: territoiresde produits Projets,formesdegouvernancelocale Projetsagricoleslocaux:exploitations,coopratives, GIE ProjetsdIG:organesdedfenseetdegestiondesIG, associationsinterprofessionnelles Projetsartisanaux Contratsdemiseenmarch,politiquesdemarques, maisonsdeterroirs, Ftesdeterroirs Plansdegestionconcertedesressourcesnaturelles etchartes,oprationsgroupesdamnagement foncier, Associationssyndicales,associationsfoncires pastorales, Cooprativespastorale,associationsdusagersdeau agricole,associationdedouar,associationdeterroir, groupementagricolededfenseenvironnementale, LectureSocioFonciredesTerroirs(LSFT) ProjetsLEADER(liaisonsentreacteursdu dveloppementdelconomierurale)delapolitique agricolecommune Parcsnaturelsetparcsnationaux Programmesdemassifs,programmesdepays Paysdaccueil,intercommunalit Politiques Politiquesagricoles(Pilier2delaPAC). Politiquesdindicationsgographiques: commissionsouinstitutionsnationales, reconnaissancesofficielles, Politiquespourlartisanat Dcentralisation.Parcs

Terroirs: territoiresde gestiondes ressources naturelles

Politiquesagricoles,pastorales, forestiresetdegestiondesressources naturelles(Pilier2delaPAC) Reconnaissancedesdroitsdusage, Paiementspourservices environnementaux.Parcs

Terroirs: territoiresde paniersdebiens etdeservices

Politiquesagricoles,despacesprotgs etdamnagementduterritoire. Politiquesderecherche Dcentralisation

26

Rechercheinterdisciplinaireterritorialise. Entretiensdeterroirs.Prospectiveterritoriale

5.3L E N T R E E P A R L E S P R O D U I T S : C L E F S D E SU C C E S E T T Y P E S D A C T I O N S P O S S IB L E S
P O U R L E S IG

P R I N C I P A U X F A C T E U R S D E S U C C E S E T D E C H E C S D E S IG Lexprience acquise en France montre que la dmarche IG ncessite beaucoup de cohrence, de dialogue et de persvrance. Il faut pouvoir en effet sappuyer sur un produit source didentit locale reconnue, une structure ferment (futur organe de dfense et de gestion) et conduire un vritable travail de diagnostic avec changes entre acteursetconfrontationdesconnaissances.Cecisupposeunimportanttravaildanimationlocaleetunappuispcialisen inscrivantleprojetagricoledansunprojetdeterritoireetdefilire.Lecahierdeschargesetlairegographiquedoivent treencohrenceaveclespratiquesquifontsenslocalement,toutenayantlesoucidepermettreauplusgrandnombre derejoindreensouplesseladynamique(approcheinclusiveetnonpasexclusive). Desinstituionsnationalespeuventdevoirsimposer.Ainsi,lacrationenFrancedelINAOajouunrledterminant.Sa composition et la procdure suivie: travail daccompagnement du porteur de projet en amont, lancement dune procdure nationale dopposition, mise en place dune commission denqute et de commissions dexamen des projets composesdeprofessionnels,personnalitsqualifiesetreprsentantsdeladministration,nominationdeconsultantset dexperts dlimitation chargs de proposer laire gographique, consultation publique, vote bulletin secret par le comitnational(lequelcomprenddespersonnalitsqualifiesindpendantes)ettransfertpourdcisionfinaleauMinistre si2/3devotesfavorables,lequelnepeutmodifierlecontenuduprojetdecahierdescharges,organisationdescontrles, ont contribu renforcer la crdibilit et la porte de cette politique. La russite suppose de pouvoir disposer dune ingnierie de terrain importante: ltablissement compte par exemple 270 agents entirement financs par lEtat dont 70%rpartissur21sites,avecdesingnieursprojetsetdesingnieursdlimitation.Sonexpriencemontreaussi lintrt de pouvoir utiliser des experts et de mandater des commissions denqutes composes de professionnels exprimentsquiviennentapporterunregardextrieuretappuyerllaborationdesprojets. Lesprincipauxfacteursdesuccsetdchecsdesindicationsgographiquespeuventtrersumscommesuit(encadr). Encadr10.Principauxfacteursdesuccsetdchecsdesindications gographiques(exp.franaise) Principauxfacteursderussite: Unetypicitlieauterroir:ladiffrencedoittreobjectivesansavoirtrescientifiquementdmontrableet chiffrable.Elletientautypedeproduit,aumodedeproduction,etc. La motivation et la cohsion desdemandeurs et des partenaires de la filire. Une organisationcollective est ncessaire. Il faut un moteur, parfois extrieur. Associer dans la rflexion les acteurs de la filire en aval ou dautresacteursduterritoire(restaurateurs,)estunebonnechosecar,partenairesduprojet,ilscontribueront sarussite.Cependantlecaractredesproduitsnedoitpastredfiniparlaval. Un marchpertinentetdesconsommateurs informs. Produits, rputation,notorit: leconsommateur doit avoiruneidedecedontilsagit. Unappuidespouvoirspublics.LEtat(lesrgionsdanscertainspays)aunrleessentieljouerenrelationavec lesprofessionnels.

27

Delarigueuretdelatransparence.Ladmarchevolontaireetcollectivedoitconduiredescahiersdescharges strictslaborsparlesproducteursencadrsparlespouvoirspublics.Lesprocduresdecontrledurespectdu cahierdeschargessontlesystmedegarantieduproduit. Un process plusieurs tapes et acteurs: une structure ferment (le demandeur), laccompagnement du demandeurpardesfrontetbacksofficesqualifis(filiretechnologiquedelagriculture),leGouvernement,qui dcide ou non de la reconnaissance, les autorits dautres pays et la Commission europenne pour la reconnaissancedanscespaysouenEuropedelIG. Dutemps:autotal,lamiseenplaceduneIGpeutprendrede210ansdedmarche:elledemandedetrs nombreuses runions, tests, etc, pour mettre tout le monde daccord. Le temps est fondamental pour la russite. Delengagementetunedynamiquelongterme:lareconnaissancenestquelafindunetapeetledbut duneautre.Lasuiteestaussiimportantequelaphasededfinition. Principauxfacteursdchec: Labsencedenotoritduproduit,voirelavolontdautoritslocalesdimposerunnom. Lafaiblereprsentativitduporteurdeprojet. Desacteursdominantsauseindelafilireetunestratgiedecomptition,voiredexclusion Undossierfaitpardesexperts.

LesIG,outilsdedveloppementdurable LesuccsduneIGPnepeutcependantsanalysersouslesseulsanglesconomiqueetsocial.Pourdevenirunvritable outil de promotion dune agriculture et dun dveloppement rural durables, lIG doit intgrer la 3me dimension de la durabilit, c'estdire la dimension environnementale. Cette intgration peut justifier lintroduction de prescriptions environnementales dans le dveloppement des IG. La France a dailleurs dcid dintroduire cette disposition dans sa prochaineloidorientationagricole. Cepeuttreimportantnotammentpourcertainsproduitssensiblesdontlaqualificationpourraitconduireaccrotre les pressions sur les ressources naturelles (et donc les dgradations des cosystmes), alors que, bien pense, une IG peuttreaucontraireloccasiondunedynamiquederestaurationetdegestionplusdurabledecesressourcesetdefaire allerdepaircrationdevaleurajouteetdurabilitenvironnementale.Ainsi,parexemple,pourlalabellisationdeviande de parcours sur des espaces dgrads par la dsertification. La mise en place dune IG peut devenir ainsi un enjeu extrmementimportant. Raisonneretagirdveloppementdurable,cestaussicomprendrelefonctionnementdesystmessouventcomplexes (cestlecasengnraldessystmesagrosylvopastoraux)etlespossibilitsdemarchpourbienpositionnerlastratgie dIG. Labelliser un produit donn peut en effet conduire la cration de dsquilibres (socioconomiques ou environnementaux) ou au contraire permettre un progrs pour lensemble du systme. Ainsi par exemple pour un levagecaprinvocationmixte(laitetviande)etdiffrentstypesdeproduitspossibles(fromagesaulaitcruouaulait pasteuris):quellestratgieadopterpourunprogrscollectifsocioconomiqueetenvironnementalsurlensembledu territoire? U N E P A N O P L I E D O U T I L S E T D A C T I O N S P O S S I B L E S P O U R P R O M O U V O I R L E S IG

28

Plusieurs forums (par exemple la consultation technique sur le dveloppement rural, lorigine et les produits agro alimentairesdequalitenAsie,organiseBangkokdu8au10Juin2009)etdocumentsrcentssesontattachsfaire ressortirlagrandepanopliedoutilspossiblespourfavoriserledveloppementdesIG.Letableaucidessous,propospar laFAOdanssonguidede2009,estdonntitreindicatif. LedveloppementdesproduitsdeterroirsneserduitcependantpaslamiseenplacedIG,loinsenfaut,etcelleci vient souvent dailleurs consacrer une ralit dj de fait. Laction en amont pour aider la petite agriculture se professionnaliseretsestructurerestdterminante.Cestalorstoutelaquestiondudveloppementagricolequiest pose, et par consquent celle de lorganisation de la filire technologique, des nouveaux rles donner la vulgarisation agricole pour en faire des front offices de qualit, de la ncessit de back offices et de centres de ressources performants et de financement adapts. La valorisation des produits locaux par de petites structures cooprativespouvantlecaschantseregrouperavecletemps,estuneprioritdontlestravauxrelatifsauPilierIIdu PlanMarocVertontmontrtoutelimportancestratgique. Encadr11.Exemplesdoutilspolitiquesetdactionspossibles(sourceFAO,2009) Etape I D E N T I F I C A T I O N Objectifdelapolitique
Sensibiliserlesproducteurset autresacteurslocaux,surles caractristiquesetlepotentiel desproduitsIG

Actions/outilspossibles
ConcevoirdesprojetsdappuitechniquepourlacaractrisationdesproduitsIG RenforcerlesconnaissancessurlesproduitsIGdanslesadministrationspubliques Soutenirlimplicationdesacteurslocaux(notammentvialesassociationsde producteursetdeconsommateurs,etc.)dansllaborationdinventairesnationaux SoutenirlamiseenplacedegroupesIGlocauxpourdbattredesspcificitsdes produitsIGetdeleursliensavecleterritoire. Soutenirdestudesdestinesanalyserlinfluencedesressourceslocalesdansla qualitspcifiqueduproduitIG Encouragerledbatentrelesacteurslocauxsurlimportancedesressourceslocales danslaqualitspcifiqueduproduitIG Promouvoirlidentificationetlacaractrisationdespratiquesdeproductionslocales Fourniruneassistancetechnique,desprogrammesderecherche RflchiraulienaveclcosystmecommelundescritresdespcificitdelIG Soutenirlapriseencomptedescritresenvironnementauxdanslecahierdescharges IGsurlabasedejustificationstechniqueetconomique RflchirlintrtdecreruneestampillepouridentifierlesproduitsIGautourde certainesvaleurs(parex.:bon,quitable).

Amliorerlesconnaissances surlinfluencedesressources locales(biodiversit,capacits humaines,etc.)danslaqualit spcifiqueduproduitIG (caractrisation) IntgrerdansladmarcheIG lesinitiativesmenesen faveurdelaprotectiondela biodiversitetdela prservationde lenvironnement

29

Amliorerlinformationdela socitsurleconceptIG

EncouragerlescampagnesdinformationsurlesIGetleursignificationetlesdiffrences entrelesoutilsjuridiques RendreaccessiblelinformationsurlesIGexistantes,leurCdCetlorganisationIGau traversnotammentdesitesInternetetautresoutilsdinformationaccessibleaupublic Responsabiliserlesacteurslocauxenamliorantlaccslinformation CrerdesforumsdediscussionlocauxpourlesIGetencouragerlaparticipationactive desdiffrentstypesdacteurs,enparticulierdespetitsproducteurs Encouragerledveloppementdesgroupesdacteurslocaux RflchirdefaonapprofondieauxeffetsduCdCsurlarpartitiondesbnficesentre lesacteurs FournirdesinformationsclairessurlesdispositifsdeprotectiondesIGetleurs avantages/inconvnients Proposerdesformationsaupersonneldesadministrationslocalesafinderenforcer leurscomptences,notammentpourladiffusiondinformationauxproducteurset consommateurs Fournirdeslignesdirectricessurlaprocduresuivrepourdposerunedemandede protectiondelIG(viadesbrochures,sitesInternet,formation) Fournirdesexemplespratiquesdedmarchesdequalificationrelativesdessystmes IGsimilaires Dvelopperdespolitiquesinnovantespourencouragerdesactionscollectiveset multidisciplinaires Fournirdesmcanismesfinancierspourrenforcerlaccsauxdmarchesde candidaturespourobteniruneIG FourniruneassistancetechniquepourlesdmarchesdequalificationIG Utiliserlesforumsdediscussionlocauxetrgionauxpourvaluerlesforcesetles faiblessesdesdispositifsetdescandidaturesdIG

Q U A L I F I C A T I O N

Permettrelaparticipationde lensembledescatgories dacteurslocauxpourla dfinitionduCdC

Amliorerlesconnaissances surlesdispositifsdeprotection desIGetlimiterlaconfusion entrelesdiffrentsoutils juridiqueslisauxnoms gographiques

Soutenirlesdmarcheslocales pourlademandede reconnaissanceofficielleet protectiondelIG


R E M U N E R A T I O N
Prendreencompteles contraintesdelafilireIGen termesdecommercialisation Soutenirlesinitiatives collectivesenmatirede marketing Favoriserlareconnaissancedes produitsIGparles consommateurs Faciliterlvaluationdes impactsdeladmarcheIGet lvolutiondusystmevers plusdedurabilitconomique, socialeetenvironnementale Soutenirlvaluationdeladmarche,parexempleenfacilitantlaralisationdtudes dimpacts,enorganisantdesforumsspcialiss,etc.. Identifierdespratiquesplusdurablespourlesystmeetencouragerlesacteursdu systmeIGlesadopter FaciliterlarvisiondesexigencesdescahiersdeschargesdesIGenregistres, notammentenproposantuneprocduresimplifiedervision PromouvoirlexistencedunlogonationalpourlacatgoriedesproduitsIG. Mettreenplacedesformationsspcifiques Soutenirlesinitiativescollectivesdepromotioncohrentesenfonctiondesvaleurs ciblesparleproduit Mettreenplacedesprogrammesdefinancementsoucrditpourlesinvestissements structurelsouimmatriels Soutenirlorganisationdeproducteurs(cooprativeslocalesetautrestypes dassociations

R E P R

30

O D U C T I O N D E S R E S S O U R C E S

FaciliterlutilisationdelIG enregistrepardeplusenplus deproducteurslocauxetde plusdecatgoriesoutypes dacteursconcerns Soutenirlacrationdevaleur pourleterritoiredansson ensemble,enfaisantappel limageduproduitIG Renforcerlengagementdela communautlocaleenversle produitIG Soutenirlarpartition quitabledesbnficesdelIG entrelesdiffrentescatgories dacteursdelafilireetausein dechaquecatgorie Encouragerlintgrationde pratiquesdeproductionplus durablesdupointdevue cologique Encouragerlintgrationdecritresplusdurabledanslecahierdescharges,par exemplepourlemballage,lnergie,letransport,etc Promouvoirlesliensentrelesressourcesnaturellesetlesattributsdequalitduproduit etlesutilisercommeuneressourcemarketing,lecaschant. Encouragerlesaccordsdecooprationauseindelafilireetavecdautresproducteurs etassociations Encouragerlamiseenuvredassociationprofessionnellespourgarantirdes ngociationsquitablesetefficacesentrelesdiffrentsacteurs Garantirquelesacteurslesplusfaiblessevoientgarantirlemmeaccs linformation,lassistancetechniqueetausoutienfinancier Accorderdelavaleurdespratiquesayantuneimportanceculturelle,commedes festivals,desvnementsducatifs SoutenirlesftespopulairesassociesauproduitIG Encouragerledveloppementdutourismebassurlesressourceslocalesliesau produitIG EncouragerlesacteursdusystmeIGmettreenplacedessynergiesavecdessecteurs complmentairesetdautresproduitsIG CrerdesroutestouristiquesaxessurladcouvertedesproduitsIGetautres attractionslocales Encouragerledveloppementdecircuitstouristiquesautourdlmentculturelsetde savoirfairetraditionnels Dvelopperdesprogrammesdesoutienfinanciertemporairespourlesproducteurs dsireuxdutiliserlIG Ciblerdesinitiativesvisantrenforcerlescapacitsdesproducteurslesplusfaibleset lesplusmarginaliss,notammentenleurfournissantdesinformations,uneassistance techniqueetfinancire Mettreenplacedescentresdeformationpourladiffusiondescomptencespratiques liesauxproduitsIG

5.4 L E N T R E E P A R L A G E S T I O N D E S R E S SO U R C E S N A T U R E L L E S : Q U E L S T Y P E S D A P P R O C H E S T E R R O I R S P O U R U N E AG R I C U L T U R E E T U N P AS T O R A L I S M E D U R A B L E S ?
Leterroir,territoirepertinentpourlagestiondesressourcesnaturelles,ncessitedautrestypesdapproches.Ilsagit dintervenir en amont des produits pour promouvoir une agriculture et un pastoralisme durables, producteurs de biens et services cologiques (biodiversit, qualit de leau, conservation des sols, gestion conome et efficace de leau,). Lapprocheterroirpeutyapporterunecontributionmajeurecarellepermetde:i)dpasserlchelledelexploitation quinepeutseulesuffireunegestionresponsabiliseetdurabledesressources,ii)mobiliserlescommunautspourun progrscollectifpartag. Elle simpose notamment dans les espaces agrocologiques complexes et dgrads comprenant des espaces dusage collectifcommelesparcoursolescommunautslocalessontdesacteursessentielsdesdcisionsdegestion.Lapproche terroirpourlagestiondesressourcesnaturellesestainsiunequestionimportantepourlAfriqueetpourleSudetlEst delaMditerrane. Les approches terroirs peuvent consister en des actions de dmonstration locale, par exemple de pratiques agro cologiquestrsconcrtescommelesemisdirectsouscouvertvgtaloulagroforesterie,aveclesoucietlespoirdune diffusionterritorialeprogressivesurleterroirconcern.Cependant,pourpermettreunegestiondurableetunemeilleure valorisationdesressourcesnaturellesetbiologiquesetuneproductionsignificativedeservicescologiques,lapproche doitpouvoirconduirellaborationdevritablesplansdeprogrsdesterroirs.Desplansdeprogrsquiporteront 31

sur lensemble des exploitations concernes et leurs surfaces agricoles utiles (SAU) mais aussi, le cas chant, sur les espacesdeparcoursetforestiersutilissparlescommunautslocales. EnFrance,lancessitdapprochescollectivesaconduitinitierds1970lamiseenplacedOGAF(oprationsgroupes damnagement foncier), permettant, sur une zone donne, dtablir un diagnostic, de faire ressortir les atouts et contraintes et de faire exprimer les proccupations, puis de rechercher des solutions et de fixer des objectifs et un programme daction. Ces oprations ont montr une grande efficacit pour un dveloppement agricole durable en montagne.AlaRunion,cesontdesoprationslocalesdamnagementdeterroirs(OLAT),dfiniesetmisesenuvre pardesgroupementslocauxdagriculteursaveclappuidemdiateursetformateursterritoriauxetdechercheursquiont t mises en uvre avec succs pour rduire lrosion et promouvoir une agriculture durable. Le regroupement des agriculteurs dans une association syndicale, considre comme le matre douvrage du projet permet den faire les acteurs principaux du projet. Cest ainsi lassociation, qui, une fois le projet agr, reoit les fonds publics et met en uvreleplandeprogrsaveclappuidesanimateurslocaux(vulgarisationagricole). EnAfrique,denombreusesapprochesparticipativespourlagestiondesterroirsonttmisesenuvrecesdernires dcennies, principalement dans le cadre de projets de dveloppement financs par les organismes daides internationales. Ces expriences ont pratiquement toutes t fondes sur une connaissance de lespace, base dune meilleuregestiondesressourcesnaturellesetdespotentialitsterritoriales. Dansdenombreuxprojets,ilenarsultunediversitdecartes:cartesdessols,desunitsmorphopdologiques,de la vgtation, de loccupation des sols, de la rpartition du peuplement, etc. Ces cartes ont permis leurs auteurs de rendre le systme concern plus intelligible. Cependant, instruments lusage danalystes extrieurs, ces cartes ont souvent jou contre la communication avec les acteurs paysans et form cran entre lespace reconstruit par les chercheursettechniciensetlespacetelquiltaiteffectivementperuparlescommunautsconcernes. Lesapprochesparticipativesontdonctamenesdcouvrirquilfallaitinverserlamthodeenpartantdaborddes savoirs paysans et des logiques internes des terroirs telles que comprises localement. Cette inversion de logique a finalement conduit la nouvelle approche dite de lecture sociofoncire des terroirs (LSFT) aujourdhui exprimente dansdesprojetsenMauritanie,auMali,enGuine,MadagascaretauLaos,ainsiquauNigeretenTunisie.LICARDA, associeauprojettunisien,atsuffisammentconvaincudesapertinencepourlappliqueraujourdhuienSyrieeten Jordanie. Lalecturesociofonciredesterroirsservleeneffettreunoutildecommunicationaveclespopulationsexceptionnel. Endvoilantlacartementaleduterroir,elleestdevenueunevritableclefdentredansledialogueparticipatif pourunemeilleuregestiondesressources.Ellepermeteneffetdemettrejourlesdnominationsvernaculairesetles toponymesquiconstituentlecorpusdelagographiementaleduterroir.Onpeutalors,encomprenantlescatgories utilisesparlescommunautspourdcrirelesdiffrentesstratesconceptuellesdeleurespacecaractrescologiques, modesdoccupationagricoleetpastorale,droitsfonciers,droitsdusage,etc,aboutirdesschmascomprisetvalids parlapopulation,schmastransformsensuiteencartessurleterrain,aveclaidedeGPS.Ainsilaconnaissanceintime deleurterroirselonleurproprecatgorisation,peuttremisejour,constituantlabasedunegestionngocie desressources. LeremarquableprojetdedveloppementagropastoraldelaTunisieduSudEst,financparleFIDA,illustrelepotentiel des projets internationaux pour promouvoir un dveloppement territorialement durable dans des zones pourtant dgradesparladsertificationetextrmementfragiles.AujourdhuitestenJordanieetenSyrieparlICARDA,cetype deprojetdonnedenouvellesbasesderflexionpolitiquepourlesgouvernementsdespaysconfrontsauxproblmesde dsertificationetdedveloppementrural(encadr). Si le projet tunisien tait un grand projet (cot de 36 millions $ des E.U. sur 7 ans), lapproche de lecture socio fonciredesterroirspeuttretoutfaitadaptepourlchelledebasedelagestiondesressourcesnaturelles,c'est direleterroirvillageois(auMaroc,ledouar). Lesapproches,quellesquesoientleurschelles,peuventaboutirlamiseenplacedechartesterritorialesdegestion durable des ressources et, le cas chant, celle de paiements pour services environnementaux (PSE). En effet lapplicationdecertainesrglesdegestion(parexemplelamiseenrepos)oulamiseenuvredecertainesactions peuvent reprsenter des cots ou des manques gagner significatifs pour les communauts concernes avec des bnfices surtout externes au terroir (services environnementaux). Des PSE peuvent aussi tre justifis de faon transitoirepouraideraupassagedunemodegestionnondurableuneagricultureouunpastoralismedurables. Enfin,lesrflexionsduCGDAontconduitsoulignerlintrtpotentieldepolitiquesdefiletssociauxsetraduisantpar destransfertsmontairesdirectsavecconditionnalitsocialeetenvironnementale. 32

Encadr12.LeprojetdedveloppementagropastoraldelaTunisieduSudEst

Le projet, devenu oprationnel en 2003, sest donn pour objectif central dengager un processus de dveloppementdurablesolidementprisenchargeparlescommunautsconcernes.Aceteffet,leprogrammea misenplacedesmoyensetinstrumentspour: promouvoirlagestionparticipativeetdurabledesparcoursetdesressourceseneau, assurerunemeilleureintgrationdellevageetdelagriculture, valoriserlesproduitsetatoutsdelargion. La stratgie a insist, avant tout, sur les modalits de la mise en uvre participative du programme daction, avecpourobjectifdepositionnerlesorganisationsdegestiondesterroirsaucurduprojet.Cesteneffetdela capacit de ces organisations que dpend tout le processus dune mise en uvre des actions susceptibles de favoriserunegestiondurablesdesparcoursetdesautresressourcesnaturelles. Pour convaincre le gouvernement et linstitution financire du ralisme et de la faisabilit de cette approche, lopration test propose comme prprojet, sest rvle capitale. Initie par une quipe pluridisciplinairecoordonneparlINRAdeTunisie,elleaeneffetpermisdidentifierlesinterlocuteurscollectifs avec lesquelson pouvait engagerunprocessus participatif. Elle a, enmme temps,permis dexprimenter les mthodologiesetdetesterunenouvelleformedorganisationdescommunautsconcernes. La nouvelle approche de lecture sociofoncire des terroirs a t ainsi intgralement applique, ce qui a permis,lafindecettepremirephase,depouvoirdisposerdunguideoprationneletdunecapacitde formation des ressources humaines. Il a donc alors t possible, ds le dmarrage du projet, de passer directementlaformationdesmdiateursterritoriauxetdappliquergrandechellelamthodologiedj teste. La russite du projet a t rendue possible, dune part par la dtermination et lengagement personnel du responsableduFIDApourlaTunisie,quiadusouventcombattresapropreorganisation,et,dautrepart,parle pragmatismeetleralismedontontsufairepreuvecertainsdirigeantstunisiens.Ceralismelesanotamment conduitsaccepterlareconnaissancedesanciennestribuscommebasesocialedelamnagementduterritoire agropastoral,alorsquelapolitiquetunisiennerejetait,depuisundemisicle,lesrfrencesausystmetribal. LadiffusiondelamthodologieauProcheOrientaensuiteconduitlICARDAtraduireleguideoprationnel enanglaisetenarabe.

5.5 L E N T R E E P A R L E S T E R R I T O I R E S : Q U E L L E S A P P R OC H E S T E R R O I R S P O U R L A C R E A T IO N D E P A N I E R S D E B I E N S E T D E S E R V I C E S ?
Lesapprochesterroirspourlacrationdepaniersdebiensetdeservicesdoiventpermettrelarencontredesdiffrents acteurs intresss, quils soient agriculteurs, forestiers, acteurs du tourisme et lartisanat, lus locaux, ONG, administrations,etc.Lobjectifpeuttrelarecherchedunemeilleuresynergieetcohrencedaction,voirellaboration dun vritable projet de territoire sappuyant sur une vision partage des volutions souhaitables du systme, notammentdanssadimensionconomique(agriculture,tourisme,artisanat,)etenvironnementale(protection,gestion durabledesressources,liminationdepointsnoirs,). Plusieurs types dinstitutions, financements et mthodes peuvent contribuer utilement lmergence de telles dynamiquesterritoriales.Onpeutnotammentciter: lesprojetsdedveloppementruralintgrmisenplacedansdenombreuxpaysendveloppementaveclappui dediffrentsbailleurs(FIDA,Banquemondiale,UE,),aveccependantdesrussitesingales. Lespolitiquesagricolesdedveloppementrural(Pilier2delapolitiqueagricolecommune)etnotammentleurs voletsLEADERquiimposentlaconstitutiondeGAL(groupesdacteurslocaux). Lesparcsnaturelsetlesparcsnationauxqui,dansdenombreuxpays,notammentenEurope,sontdevenusdes outils importants pour lmergence de projets et de dynamiques de dveloppement durable. Leurs relles capacits(moyensfinanciersetingnierie)etuneforteautonomiededcisionetdegestionpardconcentration (parcs nationaux) ou dcentralisation (parcs naturels rgionaux) leur permettent en effet de devenir de vritableslaboratoiresdedveloppementdurable,capablesparexempledlaborerdescharteshorizon 33

de 10 ans, et dappuyer ensuite le montage de nombreux projets locaux, conomiques et environnementaux contribuantleurralisation.Cetypedoutilsestparticulirementintressantpourreconnatreetvaloriserle patrimoine naturel et culturel, promouvoir des paniers de biens et de services territorialiss, renforcer les synergiesentrenature,agricultureettourisme. Dautresformesdintercommunalitquelesparcsnaturelsrgionaux. Les commissariats de massifs mis en place en France dans le cadre de la politique interministrielle pour la montagne avec pour avantage la possibilit dagir sur un champ trs large du dveloppement (tourisme, artisanat,agriculture),delamnagementetdelenvironnement.

Cesapprocheslorsquellesdisposentdescapacitsncessairesvolontpolitiqueclaire,autonomiedeplanificationetde dcision(encadrepardesdispositionsnationales),ingnieriedeterrainqualifie(lerledelintermdiationlocaleest fondamental),taille critique,souplesse financire, etquelles ont le temps pour elles, peuvent avoir des rsultats trs positifs. Elles peuvent en effet permettre de faire merger des partenariats de rflexion et daction et des visions partages,etimpulseruneagriculturedurableetundveloppementconomiquepluscohrent,plusconvergent,etplus durable. Pour permettre ces rencontres dacteurs et ces nouvelles visions, certaines mthodes comme lesentretiens des terroirspromusparlAssociationTerroirsetCultures,oudesexercicesdeprospectivesterritorialestelsqueproposspar exempleparlePlanBleu(mthodeImagine),sontparticulirementpertinentes.

34

IV. LE M AROC ET SES TERROIRS : ENJEUX , NOUVEAU CONTEXTE ET NOUVELLESDYNAMIQUES

1. L ESENJEUXPOURLE M AROC

1.1 L E D E S E Q U I L I B RE R E G I O N AL E T A G R IC O L E D I M P A S S E S D E T R AN S I T I O N P O U R L E P A Y S

E T L A F R A G I L IT E R U R A L E : D E S R I SQ U E S

Le Maroc est un pays 4 grandes dimensions. Ses dimensions saharienne, atlassique et mditerranenne, autrefois minentes,ontconnudepuisle15mesicleunlentprocessusdemarginalisation.Au20me,celuicisestaccentuetle Marocatlantiqueestdevenulelieudecentralitdelpoquecontemporaine,lieudaccumulationdactivits,derichesses etdepouvoirs. Le dsquilibre de dveloppement a accentu la dualit de lagriculture marocaine. Sur le total de 1.500.000 exploitations,moinsde10%ontaccslinformation,aucrdit,auxsubventions,auxmarchsetlatechnologie.Ces exploitationsmodernesseretrouventpourlessentieldanslesplainesbienarrosesduMarocAtlantique(lebour favorable)etdanslesnouveauxgrandsprimtresirrigusquirsultentdelapolitiquedumilliondhectaresirrigus conduitedepuis50ansAcetteagricultureprivilgiesopposelespetitesexploitationspeuprofessionnalises,relevant principalementdes3grandsagrosystmesmontagnard,semiarideetsaharien/oasien.Letableaucidessousmontreque ces 3 grands ensembles moins favoriss regroupaient eux seuls, en 1996, 70% des exploitations du pays, 80% de la populationagricole,et80%delapopulationrurale,soit9,7millionsdepersonnes. Tableau2.LescinqgrandsagrosystmesduMaroc:surfaces,exploitationsetpopulationsrespectives
Montagnes Nombre exploitations (1000) Exploit moins de 3ha (%) Population rurale (million) Population agricole (million) SAU (million ha) SAU irrigue (million ha) SAU/sup totale agro-sys (%) Prsahara et Sahara (oasis) Plaines et plateaux semiaride bour favorabl e Grands primtres irrigus Total

437 65% 3,72 2,68 1,66 0,22 15

85 82% 0,86 0,57 0,24 0,14 ---

520 44% 5,12 3,71 3,84 0,08 29

288 47% 3,05 1,90 2,28 0,10 60

100 47% * * 0,71 0,71 100

1.493 53% 12,75 8,87 8,73 1,25 12%

2/3 de la SAU 35% de la SAU irrigue 70% des exploitations 80% de la population agricole et rurale

1/3 de la SAU 30% des exploitations 20% de la population agricole et rurale

EstimationseffectuespourlAtlasdelagriculture(CGDA,2009)surlabasedesdonnesdurecensementde1996.Lespopulationsagricolesetrurales dusemiarideetdubourfavorableincluentcellesdesgrandsprimtresirrigusrespectifs.

Leretarddedveloppementpeutsemesurerauxtauximportantsdepauvretoudanalphabtisme,suprieursceux des villes, ou la part trs faible demplois ruraux non agricoles. Plus de 80% des actifs ruraux sont en effet encore agriculteurs,cequiconfirmelafaibleprofessionnalisationdunepetiteagriculture,restepourlessentieluneagriculture de subsistance (conomie paysanne). Ce retard contribue expliquer les trs faibles niveaux de productivits et le creusementcontinudescartsaveclaproductivitdesagricultureseuropennes.Enoutre,denombreuxjeunesattirs par les lumires de la ville et de lmigration, se dtournent de lagriculture, au point mme que la transmission de certainssavoirfairetraditionnelsestmiseenpril. Danscecontexte,sansmatriseetsanspolitiquesdedveloppementfortes,louverturecommercialeagricolersultant de la signature de nombreux accords de libre change pourrait avoir des effets dsastreux. La vulnrabilit socio conomiqueestdoncimportante. A la vulnrabilit socioconomique sajoute la vulnrabilit environnementale. Les 3 grands agrosystmes montagnards,oasiensetsemiaridessonteneffetdeszonescologiefragile,gravementdgradesparladsertification 35

etmenacesparlechangementclimatique.LaMditerrane,notammentleMaghreb,vaeneffettretouchedeplein fouet.Ilpourraitenrsulterunesuccessiondegravesscheressesetuneaggravationdesproblmesdepnuriedeauqui viendrontajouterleurseffetsceuxrsultantdelamondialisation. LtudeprospectiveAgriculture2030:quelavenirpourleMaroc?raliseen20062007parleHautCommissariatau Plan et par le CGDA a ainsi alert sur les risques des scnarios de type au fil de leau ou marchs triomphants, lesquelsconduiraientlepaysdescrisesagricolesetruralesgravesetdevritablesimpassesdetransition.Lesvilles et les conomies des plaines et les littoraux ne pourront pas en effet recevoir sans graves consquences une masse supplmentairedepopulation,considrableetnonprvue,etlebudgetdelEtatfinancerlesfiletssociauxncessairesau maintiendelastabilitsociale. Laprospectiveadoncinvitun3mescnariodouverturematriseetdenouveaupacteagricoleetruralenmettant notammentlaccentsurlancessitde:i)passerdunepolitiquedoffreunepolitiquededemandedevantnotamment viser les petites et moyennes exploitations agricoles, ii) la ncessaire conomie de leau, et iii) un dveloppement territorialisvalorisantlesproduitsdequalit.

1.2L E P I L I E R 2 D U P L A N M A R O C V E R T : UN D E F I F ON D A M E N T A L A R E L E V E R P O U R L E P AY S
LamiseenuvreduPilier2duPlanMarocVert(nomdelanouvellestratgieagricoledupaysadopteenavril2008), ddi au dveloppement solidaire de la petite agriculture, ainsi que celle de la Stratgie interministrielle pour la montagne,reprsententparconsquentpourlepaysundfimajeurrelever.LePilier2supposeeneffetderussirdans les meilleurs dlais la professionnalisation de prs de 700.000 exploitations, tout en crant dimportantes valeurs ajoutes et en assurant une gestion beaucoup plus durable des ressources naturelles. Sa russite est la clef du dveloppement rural car la professionnalisation de la petite agriculture entranera, de facto, celle des autres mtiers (commerce,artisanat,transports)etdonclacrationdenombreuxemploisrurauxnonagricoles. LampleurdudfiduPilier2etlaquestioncentraleducommentdesamiseenuvreontconduitleConseilGnral me duDveloppementAgricoleyconsacrer,ennovembre2007,son7 Sminaireinstitutionnelenappuyantlarflexion sur la problmatiques des montagnes et des oasis. Le document qui en rsulte (Pilier II du Plan Maroc Vert: de la stratgie laction) dveloppe les enjeux et les principaux axes daction et surtout la question de la rorganisation possibleetdelamobilisationdesmoyensetpolitiquesdesoutien. Les propositions portent notamment sur la rorganisation de la filire du savoir, les financements, les procdures dlaborationetdevalidationdesprojetslocaux(lePilierIIdemandelmergencededizainesoucentainesdemilliersde projetslocaux),etc.Laccentestnotammentportsurlancessairerformedelavulgarisationagricoleetsurlesrles donnerauCentrederessourcesduPilierIIencoursdecrationIfrane.Lamiseenplacedestructuresdeproximit dotesdenouvellesfonctions(frontofficesdequalit)etlerenforcementdescapacitsdelensembledesacteurs constituentdesfacteursclefsdunemiseenuvrerussie.LamatricedespropositionsissuesduSminaireestdonne enannexe.

1.3D E S AT O U T S P O U R U N D E V E L OP P E M E N T R U R A L P O S T M O D E R N E
Pour permettre des communauts nombreuses de mieux vivre de ressources en quantit limite et menaces de dgradations,ilnestpasdautressolutionsquelapromotiondundveloppementdequalitcologiquementdurable. La valorisation des terroirs et produits de terroirs et la mise en uvre dapproches terroirs sont donc des priorits au cur du Pilier II du Plan Maroc Vert, quil sagisse de mieux valoriser conomiquement le potentiel en produitsdequalitoudeproduireplusetmieuxenassurantunerestaurationetunegestionplusdurabledesressources naturellesetbiologiques. LeMarocnemanqueheureusementpasdatoutspourdesprogrsdanscettedirection.Ilanotammentpourlui: Une diversit biologique (cest le 2me pays le plus riche en biodiversit de toute la Mditerrane, aprs la Turquie),agricoleetculturelleexceptionnelles, Lemaintiendefortestraditionsettouteslesrichessesquiysontlies,

36

Unetrsgrandediversitdeterroirs,deproduits(agricolesetartisanaux)etdesavoirfaire,ycomprisculinaires, diversitquiconstitueunlmentessentieldel'identitculturelledelapopulationmarocaine,desonhistoire, desestraditionsetdesonmodedevieetquicontribuelaprservationdelabiodiversitanimaleetvgtale etaudveloppementdurable, Despaysagesculturelsetnaturelsdunequalitexceptionnelle, Des communauts montagnardes et oasiennes encore peu dstructures et toujours fortes dune solidarit active, Des premires russites de valorisation locale des produits de terroir par de petites coopratives et un dveloppementdutourismerural, LintrtcroissantexprimparlesdcideurssurlesterroirsetlenouveaucontextecrparlePilier2duPlan Maroc Vert, la nouvelle loi sur les signes dorigine et de qualit, la Stratgie Montagne et lUnion pour la Mditerrane. Lesbnficesdecooprationsbilatralesfortesauniveaucentraletdcentralis,lesquellesvontdelarflexion stratgiqueenamontlactionconcrtesurleterrain Lappui que de nombreux bailleurs et partenaires du Maroc sont prts consentir pour la mise en uvre du Pilier2. Une demande importante et croissante des marchs (national, touristique, international) pour les produits de terroir du panier mditerranen et les nouvelles opportunits commerciales rsultant des accords de libre change.

Cet important potentiel est permis par lextrme diversit de la gographie, de la gologie et des climats (les 4 dimensions du pays ny sont pas pour rien), et des apports des gnrations successives. La diversit de races et de varitscultivesestnotammentremarquable. Ildoitaussibeaucoupauprocessusdemarginalisationdcritplushaut.Celuiciapermislemaintiendesfortestraditions et de communauts moins dstructures. La marginalisation a aussi provoqu le dveloppement dune culture de la pnurie dont il est rsult une solidarit active entre les individus organiss en communauts. Les institutions communautairestraditionnelles,bienquenonreconnuesjuridiquement,demeurentactivesetunmouvementassociatif, importantbienquetrsingal,aprisjour.Lamarginalisationpourraitdonc,paradoxalement,constituerunatoutpour russirlepassageuneconomiepostmodernedeterroirs.

1.4L E S E N J E U X D U N E P O L IT I Q U E D E T E R R O I R A U M A R O C
LepremierobjectifdelengagementduMarocsurlesterroirsestdecontribueramliorerlesrevenusdescommunauts et la durabilit des agrocosystmes. Les enjeux sont la fois de rduction de la pauvret, de russite de la professionnalisation de la petite agriculture, de scurit alimentaire et de maintien des cohsions et de la stabilit collective. Unepolitiquedeterroirspourraitavoiraussidautresmritesimportants.Desproduitsdeterroirseretrouventaussisur les zones littorales et les plaines: leur valorisation et protection peuvent permettre de renforcer leur place sur les marchsetderduire,lecaschant,lesrisquesdtalementurbainetdepertesirrversiblesdeterresagricoles. Les enjeux sont aussi ceux de lalimentation, de la culture et de la sant. La promotion des produits de terroirs doit contribuer la prservation dun patrimoine gastronomique, artisanal, culturel et paysager unique et une meilleure information et protection du consommateur. Raffirmer travers les terroirs la valeur des spcialits locales, de la convivialitpartageetdesrgimesalimentairesmarocainsetinnoversurcettebasepourunealimentationmodernede sant, pourraient par ailleurs permettre une transition alimentaire et nutritionnelle mieux matrise. Le Maroc est en effetconfront,commedautrespaysmditerranens,unefortecroissancedesproblmesdesurpoidsetdobsitet

37

desmaladieslies 6 .Lereculdesmodesdalimentationtraditionnelsetladoptiondemodlesalimentairesexognessans rapportsaveclesculturesdupaysyontcontribu.Lereculrelatifdelhuiledolive(auprofitdeshuilesdegraine),de lorge et du bl dur (au profit du bl tendre), des fruits, du petit lait la campagne, et la consommation en forte croissance des sodas et dautres produits industrialiss peu favorables la sant sont rvlateurs des changements observscesderniresdcennies.

2. L ENGAGEMENT NOUVEAU DU D EPARTEMENT DE L A GRICULTURE POUR LES TERROIRS


LePlanMarocVert,adoptenavril2008,aenclenchunenouvelledynamiquedudveloppementagricoleauMaroc. Il initie et conforte une agriculture diversifie, durable et ouverte sur les marchs extrieurs. Il engage une forte mobilisationdesagriculteurs,descapitauxetduprogrssocial.Cettenouvelledynamiquesadressetous.LePlanMaroc incitenotammentlamiseniveausolidairedelapetiteagriculture,enparticulierdansleszonesdemontagne,arideset oasiennes, espaces dans lesquels lagriculture prsente des spcificits remarquables et des produits prsentant des qualitsuniques(produitsdeterroir),souventtmoinsdelonguestraditionsetdesavoirfairesculairesdespopulations localesmaisquisouffrentdunimportantretarddedveloppement.. La mise en uvre du Plan Maroc Vert sest accompagne en 2009 dune importante rforme du Dpartement de lAgriculture.Cellecisest,cestade,concrtisenotammentpar:

Une diminution sensible du nombre de directions centrales et la cration de deux nouvelles divisions (les
La cration du Centre de ressources pour le Pillier II (CRPII) est en cours et la rforme de la vulgarisation agricole est actuellementltude. divisions labellisation et dveloppement des produits de terroirs) au sein de la nouvelle direction du dveloppementdesfiliresdeproduction, La cration de nouvelles directions rgionales dotes dune forte autorit et comprenant chacune un service ddiauxproduitsdeterroirs, LacrationduneAgencededveloppementagricole.

2.1

L A S T R A T E G I E D E D E V E L O P P E M E N T D E S P R OD U I T S D E T E R R O I R

LanouvelleDivisionenchargedudveloppementdesproduitsdeterroirscreen2009alaborunplandaction.Celui ciadabordfaitleconstatdufortpotentielexistantauniveaudupays(cosystmesetbiodiversit,savoirfaire,gammes deproduits,demandecroissantedumarchnationaletinternational)etdesfaiblesses,notammentlafaiblessedutissu professionnel, lorganisation opaque des circuits de commercialisation (multitude dintermdiaires), la dimension trs artisanaleetlepeudinvestissements,lechevauchementdesinterventionsetlemanquedecoordination. Lobjectiffixestdaiderlorganisationdesacteurspouroffrirdesgammesdeproduitsdequalit,fortevaleurajoute destines aussi bien au march national quau march international. La stratgie retient galement pour principes de dvelopper la connaissance des produits, doptimiser la commercialisation, de mettre en place un cadre adquat et stimulantpourlesprofessionnels,decrerdessynergiespositivesavecdautressecteursdelconomieetdecontribuer laprservationetlagestiondurabledesressourcesetdesproduits. Samiseenuvresuppose:i)uneforteimplicationdesprofessionnelsetdespouvoirspublics(nationaux,rgionauxet locaux) et des partenaires internationaux et, ii) des concepts innovants et des outils de dveloppement performants: approcheparticipative,dmarchespartenarialeetcontractuelle,formesnouvellesdefinancement,bonnespratiquesde productionetdevalorisationdesproduits,approcheterritorialeintgrededveloppement,etcLeplandactionqui sengageen2010aprvu6axesdaction(encadr13).
6

SereporterpourplusdinformationsauDossierLesnouveauxdfisalimentaires;Situationdelagriculturemarocainen6,MAPM/CGDA;avril 2008.

38

Encadr13.Sixaxesdactionpourledveloppementdesproduitsdeterroirs

- Ralisation dtudes, dassistance technique et de conseils : tudes rgionales didentification des produits et et
dlaboration de plans de dveloppement, assistance technique pour ladoption des bonnes pratiques agricoles et lamlioration des process de valorisation; conseils pour la mise niveau des units de production et de valorisation ;

- Lancement dun programme de Recherche&Dveloppement pour laborer des fiches technico-conomiques et


accompagner les porteurs de projets

- Appui direct aux initiatives locales menes par les groupements dagriculteurs - Appui la commercialisation (tudes, dveloppement de partenariats pour laccs au march, soutien au transport ) - Organisation et promotion du secteur : appui lorganisation des acteurs du secteur ; organisation des sminaires,
foires, forums et manifestations ; conclusion de partenariats institutionnels pour la promotion et le financement du secteur.

- Contribution au dveloppement durable du secteur : renforcement des capacits des intervenants du secteur; actions
pour la prservation des ressources naturelles et la protection de lenvironnement; programme de sensibilisation de la socit civile.

2.2L A N O U V E L L E L O I S U R L E S S IG N E S D O R IG I N E E T D E Q U A L I T E
Lapublicationdelaloin2506,relativeauxsignesdistinctifsdorigineetdequalit(SDOQ)desdenresalimentaireset des produits agricoles et halieutiques, promulgue par le dahir n10856 du 23 mai 2008, a permis un grand pas en avant.Elleaeneffetcrlecadrejuridiqueindispensablequipermetleurreconnaissanceetleurprotection. La loi sinscrit dans une vision de dveloppement rural, de promotion de la qualit des produits et de protection du consommateur,enproposantunsystmecollectivementaccessibletouslesproducteursettransformateursdeproduits agricoles,danslairegographiqueconsidre.Ellevisenotammentassurerdesrevenuscomplmentairesauxpetits agriculteurs. Laloisestainsidonn4grandsobjectifs:

Prserverladiversitdesproductionsagricolesethalieutiquesetprotgerlepatrimoineculturelquileurestli
Sa rdaction a bnfici de lexprience historique de pays partenaires du Maroc. LINAO a notamment apport son appui.Laloireprendladistinctioneuropenneentrelindicationgographique(IG)etlappellationdorigine(AO).Elle ajoutelapossibilitdereconnaissancedulabelagricole(LA).Cessignes,reconnusparladministration,fontlobjetdune publicationetpeuventtreutilisspartoutproducteuroutransformateurdunproduitagricole(alimentaireouusage cosmtiqueoumdicinaldanscertainscas)ouhalieutique,pourvuqueceproducteuroucetransformateurrespecte,au coursdellaborationduditproduit,lesexigencesducahierdeschargesattachausignedistinctifconcern. LaloicreuneCommissionnationaledessignesdistinctifsdorigineetdequalitdontlacompositionetlemodede fonctionnementonttfixsparledcretn208404du25dcembre2008.Ledcretn208403du25dcembre2008 prcisepoursapartlesprocduresdereconnaissanceetdagrmentdesorganismesdecertificationetdecontrle LacommissionestcomposenotammentdemembresreprsentantleMinistredelAgricultureetdelaPcheMaritime et dautres autorits gouvernementales concernes, de reprsentants professionnels (fdrations des chambres dagricultureetdespchesmaritimes,confdrationmarocainedelagricultureetdudveloppementrural,6membres dorganisations professionnelles), de lINRA et de lINRH (institut national de recherche halieutique). Le prsidentde la Commission(leMinistreousonreprsentant)peutfaireappelunouplusieursexperts.LaCommissionestchargede 39 par la reconnaissance et la mise en valeur de leur origine, de leurs caractristiques et de leurs modes de production, promouvoir le dveloppement agricole par une valorisation des caractristiques lies au terroir ainsi que les modesdeproductionetlessavoirfairehumainsyaffrents, accrotrelaqualitdesproduitsetcontribueramliorerlesrevenusgnrsparleurvalorisationauprofitdes oprateurslocaux, renforcerlinformationdesconsommateurs.

donnersonavissurlesdemandesdereconnaissanceetdagrmentdesorganismesdecertificationetdecontrledes produitsbnficiantdesSDOQ.Ellepeutproposertoutemesureconcourantlavalorisationdunsignedistinctif. Par ailleurs, la loi charge le Ministre de l'agriculture et de la pche maritime, une fois l'indication gographique ou l'appellationdoriginereconnue,deprocdergalementunenregistrementauprsdelOfficemarocaindelaproprit industrielle et commerciale (OMPIC), aprs la publication au bulletin officiel. Par cet enregistrement, lEtat devient le propritaire de lindication ou de lappellation et sassure ainsi qu'un utilisateur priv ne peut semparer, titre personnel,delappellationdunterroir,dunetraditionoudunsavoirfairequisontunhritagecollectif. LaCommissionnationaleestoprationnelleetelleserunitrgulirementdepuislapublicationdudcret.Deuxarrts de reconnaissancede lIGArgane et de lAOhuiledolive Tyout Chiadma ont t publis en janvier 2010et dautres le seront bientt pour lAO Safran de Taliouine, lIG Clmentine de Berkane, lIG dattes Majhoul de Tafilalet et le Label Agricole Agneau Laiton. Trois organismes de contrle et de certifications ont par ailleurs t agrs (Ecocert Maroc, NormacertetleBureauVritasMaroc). Figure5.ProcduredereconnaissanceetlogosofficielsdessignesIGPetAOP
Procdure de Reconnaissance dun SDOQ
- Groupe de producteurs - Collectivit locale - Administration
6 mois

Avis favorable Diffusion journaux

1 Dpartement de lAgriculture 3 2 Commission Nationale (CN)


(entit consultative)

Dcision de reconnaissance du Signe 4


Enregistrement lOMPIC / Catalogue Publication /B. Officiel Enregistrement au Registre du Dpt. de lagriculture

IG ou AO Protg protge

La division de la Labellisation est charge du dveloppement et de la promotion des labels (Indication Gographique Protge IGP, Appellation dOrigine Protge AOP, Label agricole, Production Biologique, ). Son action vise principalement:i)encadrerlalabellisationdesproduitsagricolesetenassurerlesuivi;ii)assurerlesecrtariatdela CommissionNationaledesSDOQ;iii)tabliretpoursuivrelesprogrammesdecooprationaveclesorganismesetexperts trangers;iv)tablirconjointementaveclesprofessionnels,lescahiersdeschargesetlesprojetsdetextesofficielsqui dfinissent les conditions de production des produits sous signes distinctifs dorigine et de qualit; v) organiser des campagnesdeformation,dinformationetdesensibilisationauxdiffrentslabelsquiexistent(IGP,AOP,LA,production biologique,etc.)etvi)assurerlapromotiondesconceptsportsparlesdiffrentssignesdistinctifsd'origineetdequalit.

3. D ESEXEMPLESDENOUVELLESDYNAMIQUESAUPLANREGIONALETLOCAL
LesrformesnationalespourlesproduitsdeterroirsetlengagementduDpartementdelAgricultureauniveaucentral ont t prcds de plusieurs initiatives locales et rgionales, inities ou soutenues par diffrents acteurs: certains chelonsdconcentrsduMinistre(directionsdpartementales,officesdemiseenvaleuragricole),rgionsetacteurs delacooprationdcentralise,agences(agencededveloppementsocial,agencedusud,),agriculteurs,scientifiques, bailleurs,ONG, 40

Les engagements de lOriental, du Souss Massa Draa, et des Provinces dEssaouira et de Chefchaouen, ont t notammentremarquables.

3.1

LO R IE N T A L

AlapointenordestduMaroc,bordeparlamerMditerraneetparlAlgrie,largiondelOriental,reprsente11,6% du territoire national (prs de 83.000 km2) et 6,4% de la population (1,9 millions). La rgion se caractrise parsa trs faiblesurfaceagricoleutile(8%),parlimportancedeszonespastoralessemiaridesetparlampleurduchmageetde lmigration. Le taux de chmage est de 15.3% contre une moyenne nationale de 10.8%, et, parmi les rsidents marocainsltranger,28.3%sontoriginairesdelOriental. U N E C O O P E R A T I O N D E 20 A N S A V E C C H A M P A G N E A R D E N N E LOriental a dvelopp depuis 20 ans une coopration soutenue avecla rgion Champagne Ardenne, 2me rgion agro alimentaire franaise. La coopration sinscrit dans uneperspective de long terme etdans lespolitiquesnationales, en conformit avec la lgislation internationale et celle de lUnion europenne. Lagriculture a t retenue comme une priorit,etlesactionsdecooprationmobilisantlesacteursdes2rgions,ontportsur: lalutteantiparasitairepourfairedelOfficergionaldemiseenvaleuragricoledelaMoulouya(ORMVAM)un pledexcellenceaveclappuidesservicesrgionauxduMinistrefranaisdelagriculture, lemballage et le conditionnement: diagnostic, technicien spcialis, formations avec lappui de lESIEC, seule coledelemballageauniveaudelUE, lamiseenplacedunobservatoirergionaldelagriculture,quiserviradoutildesuividuPlanMarocVertdansla rgion, lapromotionetlavalorisationdesproduitsdeterroirs. Deuxproduitspharesdelargion,rputslchellenationalevoireaudel,ont ainsifaitdepuis4anslobjetdedmarchesdevalorisationpourunelabellisation IGP: la Clmentine de Berkane et la Viande dagneau Bni Guil. Des missions en France (Corse), la formation danimateurs pour les 2 produits et la mobilisationdunorganismedecertificationsontvenuesappuyerladmarche. L I G P C L E M E N T I N E D E B E R K A N E LaprovincedeBerkaneavec15.800hadevergersdont11.000hadeclmentine, et30%delasurfaceirrigueengrandehydraulique,estla3mergionagrumicole du pays. La filire est bien organise avec une association professionnelle (ASPAM)quiregroupe4.200producteurs,4groupesdexportationet16stations de conditionnement, dont 7 coopratives. La production dagrumes slve en moyenne 210.000 tonnes, soit 13% du total national. Cest la principale productionexportabledelOriental:80.000tonnessontexporteschaqueanne dont65.000tonnesdeclmentinesurlemarchdelUE(25%)etdelaRussieet duCanada(75%).Lamargebruteestde550millionsDhetlafilirereprsente2 millionsdejournesdetravail. Le projet dIGP a t initi pour: i) lutter contre la concurrence dloyale et protgerlaclmentinedeBerkanedesusurpations,ii)informerleconsommateur surlorigineetlaqualitduproduit,etiii)promouvoiretprserverunpatrimoine nationalet rgional: le terroir et les savoirfaire de ses agriculteurs. Le premier motifatlaluttecontrelusurpationcarcelleciestdjuneralit. Lideduprojetestneenenjuin2006loccasiondelavisitedanslOrientaldu prsidentdelargionChampagneArdenne.Ilsenestsuivi,dsseptembre2006, lamiseenplacedunprogrammedeformationetdinformationdespartenaires, 41

puislavalidationduprojetparlecomittechniquergionaldesagrumesenoctobre2007,laconstitutionenavril2008de lassociation de lindication gographique protge de la clmentine de Berkane (organe demandeur de dfense et de gestion)etlaprparationducahierdeschargespartirdejuillet2009.Ledptofficieldelademandedereconnaissance atfaitenseptembre2009suiviennovembre2009delavalidationduprojetparlaCommissionnationaledesSDOQ. Le cahier des charges justifie le lien lorigine par les conditions pdoclimatiques, les ressources en eau, les pratiques particulires de production et la rputation historique de la clmentine de Berkane. Les lments de traabilit sont assursauniveaudesvergers,desstationsdeconditionnementetdelemballageetleplandecontrleestorganis3 niveaux: autocontrles par les oprateurs (producteurs, stations), contrles internes par lODG (association de lIGP), contrlesexternesparlorganismedecertification(NormaCert). Encadr14.Dfinitiondelatraabilit La traabilit est la capacit de suivre un produit de sa production jusqu sa consommation. Elle permet de retrouver, pour un produit donn, la trace de toutes les tapes de sa fabrication et de la provenance de tous ses composants. L E P R O J E T D I G P V I A N D E D A G N E A U B E N I G U I L Les Hauts plateaux de lOriental reprsentent un systme agro cologiquesemiaridede3millionsdhectares.Lasteppearmoise pour (celleci donne sa saveur la viande), alpha (50%) et atriplex, peu productive, dsole en annes sches, est dgrade par la dsertification. La race dovins Bni Guil, race endmique cosystme, dune exceptionnelle rusticit et rsistance, compte autotal1200000ttes. Les pratiques dlevage tmoignent du savoirfaire sculaire des leveurs. La viande est rpute pour ses qualits gustatives, sa saveur et son peu de gras. La filire est organise autour de 32 cooprativescouvrantlensembledusystmeagrocologiqueet14 groupementsdleveursderaceBniGuilencadrsparlAssociation nationale ovins caprins (ANOC), laquelle compte 950 leveurs adhrents dans lOriental. La mise en march de la viande est effectue par des chevillards et des bouchers chevillards. La distribution sopre essentiellement dans les circuits traditionnels et60%delaviandeestconsommedanslOriental. LeplandactionpourlamiseenplaceduneIGPatinitien2006 par dcision des rgions Oriental et Champagne Ardenne. Le principal objectif de lIGP est den faire un moteur de dveloppementpar lamliorationdesrevenus.Laprservation des parcours, espre du fait de lamlioration des revenus, est un secondobjectif. Dixsessionsdesensibilisationetdeformationonttorganiseset 2animateursforms.DeuxassociationsnoyauxpuislANOConteu la charge de porter le projet dIGP. Le cahier des charges a t rdig et le plan de contrle est en cours dlaboration. Le projet sestavrplusdifficilemenerqueceluidelaclmentinecarde nombreuxleveurscraignaientdtrediscrimins.Denombreusesrunionsontdonctncessaires. 42

DESPERSPECTIVESSURDAUTRESPRODUITS Un3meproduitdeterroirdelOrientalfaitactuellementlobjetdunprojetdIGP.Il sagit de la datte Aziza de loasis de Figuig, projet dvelopp par la cooprative agricole Al Massira. Cest un produit uniqueet rare : cette datte nexiste que dans cet oasis avec un total de seulement 3000 pieds de palmiers. LIG, outil de dveloppementlocal,permettralaprservationetlavalorisationdecepatrimoine. Denombreuxautresproduitspourrontdanslesprochainesannesjustifierdactions de coopration comparables. On peut citer notamment: les nfles de Zegzell, les truffesdesHautsPlateaux,lesplantesaromatiquesetmdicinales,laviandecaprine de Talsint, plusieurs miels et huiles dolives de terroirs. La production de crales biologiques dans les zones sches de lOriental est une autre piste importante. En effet,lesbesoinsdefarinebiologiquedanslUEsontlevsetlOrientalpourraittirer profitdesonenvironnementprserv.

3.2

LESOUSSMASSADRAA

Le Souss Massa Draa, de la cte atlantique aux montagnes de lAnti Atlas et aux oasis du Draa, est une rgion de contraste.Silargion,commebeaucoupdautresauMaroc,comprenddeszonesruralespauvrestrspeuples(leszones de larganeraie, des montagnes et des oasis du Draa), elle se caractrise surtout par le dynamisme de son agriculture irrigueetexportatricedesplaineduSoussetduMassaetparceluidelacapitalergionale,Agadirgrandportedepche etgrandestationtouristiqueenmmequecentreuniversitaireetagroindustriel. Ledveloppementrapidedelargionsevoitcependantfortementmenacparledsquilibreentreoffreetdemandeen eau. Celuici a dj conduit labandon de plusieurs milliers dhectares dagrumes sur le Souss. Or, la forte croissance dmographique, conomique et touristique va venir encore accrotre la demande alors que le changement climatique rduira les ressources mobilisables. Sans politique nouvelle de gestion de la demande en eau et volution vers un dveloppementdequalitfortevaleurajoute,lesdsquilibreshydriquesetlesrisquesdinstabilitsnepourrontque saccrotre. UNENOUVELLEVISIONREGIONALE,UNECOOPERATIONAVECLAREGIONAQUITAINE Profitantdelanouvelledynamiquededcentralisation,leConseilrgionalvaalorssattacherfairemergerunenouvellevisionpour largion.Sonprsident,devenuenSeptembre2007Ministredelagricultureetdelapchemaritime,vaeneffetinitierunedouble dmarchestratgiquededveloppementdurablevisant:i)lconomiedeaudirrigationetii)lapromotiondesproduitsdeterroirs. Largiondisposeeneffetdunimportantpotentielvalorisableetseuleunestratgiedecrationdevaleurajoutepeut,dansun contextederaretdelaressourceeneau,permettreundveloppementruraldurable.Suitelaralisationdunetudeprsenteau Conseilrgionallorsdesasessiondejanvier2007,lastratgiesedonnepourobjectifsdeprotgertermetouslesproduitsduterroir duSoussMassaDraetlesavoirfairedespopulationsdelaRgion,dansleurspcificitetleursingularitgographique,pardes signesdistinctifsdorigine.Leprochainchapitre,entirementconsacrlaprsentationdelanouvelledynamiqueimpulseparle Conseilrgional,montreraquellesdcisionsontpuendcouler. Les enjeux mis en avant dans la stratgie sont pluriels : promotion dun dveloppement conomique et social durable pour les populationsruralesdfavorises,gestionconomedelaressourcehydriquedansuncontextederaret,maintiendelabiodiversit locale,prservationdesspcificitsculturelles.Etlamiseenuvredelastratgiergionaledevratreloccasionderussirlafois: une restructuration des filires de production: renforcement des coopratives, cration dunits de transformation, valorisationparunestratgiedesegmentationetdidentificationsousSDOQ, 43

un dveloppement du march rgional, national, et tranger et de la chane de valeur au Maroc avec recherche de dbouchshautevaleurajoute.

LacooprationtablieaveclargionAquitainevavenirappuyerlamiseenuvredelanouvellestratgie.Aprslorganisationen novembre2006dunatelierdesensibilisationlamiseenplacedunepolitiquergionaledesproduitsduterroir,desAssisesde lOriginesontainsiorganisesendcembre2006Agadir,encooprationaveclaRgionAquitaineetaveclaparticipationdelINAO. LimplicationdelargionAquitaine,traversnotammentlafdrationrgionaledescooprativesagricoles(FRCAA),vaalorsporter surlavalorisationdunpremierproduitdeterroirderputationmondiale:lhuiledargan. PourlAquitaineetsescooprativesagricoles,ilyaunintrtfortcequelespolitiquesdoriginedesproductionsagricolesrayonnent danslemondepourprotgerlactivit,lerevenuetlesproductionsdespaysanslisunterroir.PourlargionduSoussMassaDraa, lescooprativesdarganetlesfemmesduSouss,ilsagitdinitierunepolitiquededveloppementdurableetdetesterlapertinence des outils en matire de politiques dorigine. Il sagit donc, dans lesprit des partenaires, dune coopration de type gagnant/gagnant. L I G PA R G A N E Larganeraie du Maroc, classe rserve mondiale de la biosphre par lUNESCO, est un espace bois de 800.000 ha recouvrant unepartiede largionSoussMassa Draaet delaprovincedEssaouira,uniqueaumonde. Larganier est en effet un arbre endmique auMaroc.Cestaussiunrsistantadapt au climat semiaride et capable de traverser des priodes de scheresses. Larganier, arbremultiusages,maintientlessols,sertde rempart contre le dsert et nourrit les hommes et le btail. Les diffrentes productions de larganeraie fournissent au total plus de 20 millions de journes de travail dont 7,5 aux femmes pour la productiondhuile. Lhuiledargan,fruitdunsavoirancestralestlunedesplusgrandesrichessesdelargion.Traditionnellementproduite parlesfemmesruralesdelarganeraie,elleestunesourcederevenusimportantepourlesfamillesruralesconcernes(2 millions de personnes). Suite aux efforts rcents de structuration du tissu, dvelopps notamment dans le cadre du projetarganierfinancparlUnioneuropenneetmisenuvreparlAgencededveloppementsocial,oncompte aujourdhui environ une centaine de coopratives fminines. La production exporte est denviron 300 tonnes par an pourunchiffredaffairelexportentre40et50millionsdedirhams.Unegrandepartiedelhuileestexporteenvracet non transforme, la valeur ajoute tant ralise par des entreprises dautres pays, notamment dans le secteur de la cosmtique. Cettehuile,afaitlobjet,cesderniresannes,dunemobilisationmdiatiqueetcommercialesansprcdentpourses vertuslafoisalimentairesetcosmtiques.Lesprixsurlemarchmondialontparsuiteexplos.Cependant,largionde larganeraie, et notamment les femmes rurales, nen ont gure tir grand bnfice, et de nombreux trafics se sont dvelopp.Enoutre,lcosystme,dgradparladsertificationetuneinsuffisancedereconnaissancedesavaleur,na pasvusasituationsamliorer. Dans ce contexte, la mise en place dune IGP ARGANE (argane est le nom traditionnel en amazigh de lhuile dargan)rpondunobjectifessentiel:fixerlavaleurajoutesurleterritoireauprofitdesfemmespourpermettrele dveloppementconomiquedescooprativesetrapproprierlenometlanotoritauxacteursterritoriauxdelafilire. LadnominationARGANEdevradonctrerserveuniquementauxproduitsissusdelazonegographique(c'estdire lensembledescommunesdelarservedebiosphreUNESCO)respectantlecahierdescharges.

44

LIGP a dautres objectifs importants et complmentaires: i) structurer la filire et promouvoir une dmarche collective de commercialisation, communication et promotion, ii) prserver la biodiversitdusystmearganier,iii)renforcerlepositionnementde lhuile dArgane sur le march mondial, et lutter contre toute usurpation commerciale du nom, iv) apporter aux consommateurs desgarantiessurlorigine,latraabilit,laqualitetlquit. La mise en uvre du projet IGP va conduire lorganisation dateliers avec tous les partenaires concerns durant lanne 2007 puisllaborationducahierdescharges.Enjanvier2008estcrle groupement demandeur (organisme de dfense et de gestion), savoir lAssociation Marocaine de lindication gographique de lHuiledArganeAMIGHA,lequelrassembleleConseilrgional,les groupementsdecooprativeetleurassociationetunionnationales et un collgue dindustriels. Un comit dappui comprenant notammentlesadministrationsdconcentresdelagricultureetdeseauxetfortsestparailleursinstaur.LAMIGHA, qui regroupe les diffrents partenaires de la filire notamment les coopratives fminines, est le lieu des dcisions stratgiques.Samissionestdinitier,deporteretdemanagerladmarcheIGP.Acetitre,AMIGHAvadevoir:i)laborer lecahierdeschargesdelIGP,porterlademandedereconnaissanceauprsduDpartementdelAgricultureduMarocet delUEetveillersonapplication,ii)participerauxactionsdedfenseetdeprotectiondunomduproduitlchelle nationaleetinternationale,iii)mettreenuvredesactionsdepromotionetcommunicationcollectivesetiv)structurer etlaborerlastratgiedelafilireencoordinationaveclesproducteursetlestransformateurs. En juin 2008 sont mis en place un panel national de dgustation de lhuile dargan et une formation sur les analyses sensoriellesdelhuileparlelaboratoireITERGdeBordeauxFrance,cequiconduitladterminationdesdescripteursdu produit. De mars juin 2008, des ateliers de travail sont tenus pour la finalisation du cahier des charges IGP Argane, lequelestapprouvenoctobre2008parleConseildAdministrationdAMIGHA.Lecahierdescharges,pourpermettreau territoire de capter la valeur ajoute, garantit que toutes les oprations de ramassage des fruits de larganier, de production,detransformationetdeconditionnementdelhuiledargandoiventtreralisesdanslairegographique delIGP.Ilgarantitgalementqueseulelhuileextraiteexclusivementpartirdesamandesdesfruitsdelarganieradroit lIGPetquelacollectedesfruitsdoitavoirlieuentrelesmoisdejuinetfinseptembre,queleschagedoitsefaireau soleiletquelestockagenedoitpasexcder36mois.Lhuiledoitavoiruneteneurenacidegrasoliquede43,3%49,1% enacidegraslinolniqueestde29,3%36,0%etentocophrolsde4090mg/100g. Latraabilitseraassurepardesprocduresdesuiviauxdiffrentestapesdeproductionetlescontrlesexternespar Normacert. En fvrier 2009, lIGP ARGANE est officiellement reconnue, puis, en janvier 2010 a lieu la premire certification de cooprative. Linscription auregistre OMPIC est faite enfvrier 2010 et la demandede reconnaissancepar lUEest en cours.LasortiedespremiersproduitssignsIGPARGANEestprvuepourjuillet2010. Larussiteduprojetvaencorencessiterdeseffortsimportants.Ilsagiteneffetdeconvertirunsuccsdeprocdure en victoire conomique, et de passer dune prsence politique une efficacit fonctionnelle. Ceci va ncessiter des progrs en marketing et en organisation conomique promotion, dveloppement de limage et des circuits de distribution, de structurer loffre et de conforter le management dAMIGHA qui doit pouvoir garantir son autonomie fonctionnelleetorganiserdefaonefficacesarelationavecletissudecoopratives,malgrlloignement. De20102011,AMIGHAetsesacteursvontnotammentsattacher:i)positionnersurleplancommercialetmarketing lIGPArgane,ii)organiserlemarchcosmtique,iii)finaliserlesdmarchesdereconnaissancedelIGPauniveaudelUE, iv)russirlesngociationsaveclesutilisateursactuelsdunomARGANEetv)rendrepluscomplmentairesetcohrentes lesactionsdesfinanceursenprenantcommebaseslesplansdactiondelIGPetdelAMIGHA. DesinnovationssontprvuesdanslepackagingaveclacrationdebouteillesspcialesportantlamentionIGPArgane gravesenrelief,quelensembledescooprativespourrafaireleur. Leprojetadjpermisauxacteursdelafilire,dontlescooprativesetleursproductricesdeprendreconsciencedes vritablesenjeux.Cellesciontdmontrunecapacitsefdreretdcider,vite,bien,sansprcipitations.LaRgion lorigineduprojet,ajouunrledeleader,maisaussidecatalyseuretdetraitdunion,fournissantdesmoyens,dontla coopration. 45

L AO P S A F R A N D E T A L I O U I N E Le Maroc est le 4me producteur mondial de safran avec environ 3 tonnes produites par an, loin derrire lIran (200 tonnes)etlInde(9tonnes).Lesprixdeventeenvrac(producteurs)varientde400US$lekg(Iran)4000(Sardaigne).La venteaudtaildanslUEpeutallerde58euros/gramme.Laproductioneuropennenecessededclineralorsquela demandedpicessaccrot. LeterroirdeproductionauMarocestlemassifduSiroua(les2cerclesdeTaliouineetdeTaznakht),lesafrantantconnu souslenomdesafrandeTaliouine.Saculture,quiremonteaumoinsau18mesicle,constituelaclefdevotede lagrosystme traditionnel et de lconomie paysanne du Siroua. La culture se fait en terrasses construites laide de muretsenpierresdansleszonesmontagneusesaccidentesavecirrigationlocale.Lesafranestcultivenrotationavec lorge,parfoissousamandiers.Lemas,laluzerne,leblduretcertainescultureslgumiressontsouventdesprcdents culturaux.Lespaysagespeuventtredunebeautidyllique. Malgrunerellerputation,laproduction,essentiellementcollectesurlaparcelleetvenduepardesintermdiaires, estdemeuremalvaloriseavecdesprixpeurmunrateurspourlesproducteurs. Des innovations ont t inities en 2004 avec la cration par 11 jeunes agriculteurs de la cooprative Taliouine. Celleci contrairement lancienne cooprative Souktena, est une cooprative trs locale (centre surundouar)quibnficiedun apporttotaldelaproductiondes membres. La nouvelle cooprativeestunsuccs:ellea permis un accs rmunrateur aumarcheuropenetsonexempleafaitcole:unedizainedautrescooprativescomparablesonttdepuiscres. Lefacteurdclenchantduprogrsatlademandedappuiexprimeparcesjeunesproducteursetlarponsequiapu luitreapporteparlONGMigrations&Dveloppement.Celleci,creen1986enFrancepardesmigrantsmarocains poursoutenirledveloppementdansleursvillagesdorigine(AntietGrandAtlas),prsenteMarseilleetsurplaceau Maroc (Taroudant, Taliouine) est active depuis 20 ans dans le dveloppement local. Elle a donc pu comprendre les besoinsexprimsparlesjeunesagriculteursetleurapporterdesrponsesenmobilisantuneexpertiseeuropenneeten assurantuneanimationlocale.Elleaaidlegroupedejeunessestructurerencooprativeetinvestir(aveclappuide lAgencedeDveloppementSocial).ElleaaussiobtenulaccorddelaFAOpourfinancerunepremiretudedelafilire safran(2007),contribuaufestivalduSafrandeTaliouineorganisparlOffice rgionaldemiseenvaleuragricole,misencontactlesjeunesproducteursavec desacheteurseuropens(CTM,Slowfood.)etcraveclafondationSlowFood (2009)uneSentinelleSafranTaliouine. Ltude a notamment permis de conclure lexcellente qualit et typicit du safrandeTaliouine,justifiant,outreunecertificationbiologique,uneindication gographique et une vente au dtail. Passer la vente au dtail imposait cependantunematriseduconditionnementetdupackaging.Ainsids2006,50 kg taient vendus avec conditionnement en capsules et sachets de cellophane de 1 g, dont prs de 13 kg lentreprise OLIVIERS & CO. (Fr.) au prix de 1,50 EUR/g. Les perspectives de march sont la vente aux entreprises spcialises dans la distribution au dtail (Maroc et UE), une distribution par une centrale dachatducommercequitable(CTMAltromercato,Italie),lacommercialisation insitu(touristes)etlaventeaudtailonline. Lexprienceamontrlebnficepossible(confianceetdisciplinecollective)de groupements de producteurs lchelle du terroir de base (le douar) et dinnovationsdansleconditionnementetlamiseenmarch. 46

Dimportants progrs sont cependant encore raliser. En effet, la commercialisation des coopratives ne reprsente que 3% de la production (tude FAO 2009) et la structuration actuelle des acteurs de la filire tmoigne dintrts financiers souvent divergents et dun manque de confiance. En outre, les fonds de roulement sont inexistants. Il conviendraitparconsquentdemieuxfdrerlensembledesacteursduterritoire/filiredansunprojetcollectif.Ilfaut esprer que la reconnaissance en mai 2010 de lAOP Safran de Taliouine labore linitiative de la rgion Souss Massa Draa, laquelle agit galement comme organisme de dfense et de gestion de lAOP jusqu la reconstitution de lAssociationdesproducteursduSafranTaliouineetTaznakhtlepermettra.Lesobjectifsstratgiquesmisenavantpar largionpourlamiseenplaceduneAOPSafranonttlessuivants:laprotectioncontrelesusurpations,lacaptationau niveaulocaletnationaldelaplusvalue,lerenforcementdusafranmarocainsurlemarchinternational,lamlioration dustatutdelafemme,lerenforcementdelancragedusafrandansleshabitudesetlesmursdelargion. Une autre question se posera: celle de la capacit de la communaut locale concilier le bnfice dune vente plus rmunratrice et le maintien des valeurs culturelles du terroir. En effet, laugmentation rcente des prix laisse penser quelle pourrait menacer certaines habitudes alimentaires et certains aspects traditionnels lis lusage populaire du safran.

3.3.L A P R O V I N C E D E S S A O U I R A
LaprovincedEssaouiracomprenddeuxgrandeszones.Ausud,lazonedemontagneHahaapourproductionsdominantes largane,llevagecaprinassoci,maisaussilecaroubier,lapiculture,lesplantesaromatiques.Aunord,lazoneChiadma, deplainesetdeplateaux,estconsacrelacraliculture,llevagebovinetovinetloliculture.Presquetoutela zoneestcontrainteparlemanquedeauetparlariditetlesniveauxdepauvretsontrelativementlevs. LaprovinceatpionnireauMarocdanssonengagementpourlesproduitsdeterroirs.Elleledoitprincipalementsa Direction provinciale de lagriculture (DPA) qui, ds 2001, a organis des journes dtude de programmation par objectifs,aveclaborationdundiagnosticetdunevisionstratgique.LaDPAcomprendalorsquelavenirpasseparla valorisationdesproduitsdeterroirsassortiedesignesdorigine.Troisproduitssontidentifispourinitierunemobilisation collective:largane,lhuiledoliveetlechevreaudarganier. LHUILEDARGAN Larganeraiedanslaprovincereprsente136.000hapouruneproductionde70.000tonnesdefruitsetde2000tonnes dhuile dargan. La DPA, forte de sa nouvelle vision, sest beaucoup investie dans la mise en uvre du projet arganier, financ avec laide de lUE travers lADS: 1000 femmes rurales de la Province, regroupes en 26 coopratives en ont bnfici, 15 coopratives ont t mises niveau (alphabtisation, amnagement, quipement, appui la commercialisation), 10 siges de coopratives ont t crs (financs par lINDH), ainsi quun GIE charg dappuyer la commercialisationnotammentlexport.Lechiffredaffairedescooprativesaaugmentde40%de20052007etdes progrssignificatifsonttobtenusentermesdequalit(miseenbouteille,certificationbioetcommercequitable,prix Slowfood),defficacitdutravail,defficacitnergtiqueetdalphabtisation(500femmesbnficiaires). Lesprincipalesclefsdusuccsdansleprojetarganierontt: Lamiseenplacedunfrontoffice(sousformedecelluledappuiauxcoopratives)dequalit,constitude4 animateurs(2cadresdelaDPA/CT,2animateursfinancspleintempsparlADS)forms(68joursdeformation sur5ans)pourlappuilaformulationdesprojetsparlescoopratives. Unsystmedefinancementsoupleetquiresponsabiliselesbnficiairesenrenforantleurscapacits:appel projet, subvention accorde sur prsentation du projet aprs avis favorable dun comit dvaluation, financementduprojetpermettantderenforcerlescapacitsdescooprateurs(alphabtisation),cooprativeset groupements;30%ducotduprojetlachargedesbnficiaires;systmedecontractualisation. La forte dconcentration et le recours un back office qualifi (cadres DPA, expert international, experts nationaux) Laconcertationcontinueetletempsquiluiatconsacr. LaDPAetlescooprativesdelaProvinceontaussijouunrleactifauseindAMIGHA. 47

L H U I L E D O L I V E A O PT Y O U T C H I A D M A Loliveraie reprsente dans la province 15.000 ha pour une production de 15.000 tonnes dolives et de 2.000 tonnes dhuile.LhuiledeChiadmaestrputeauniveaunationalpoursongotfruitetsescaractristiquesorganoleptiques authentiques.Elleaobtenule1erprixOLEAen2006etle3meprixduSIAM2007. Ds 20022003, des tudes prliminairessurleshuilesdolive de la province dEssaouira sont ralises. Elles conduisent la dcision de mener une opration pilotesurleterroirdeTyoutun terroir limonosablonneux intressant 7 douars, formant espace de rencontre des tribus Haha et Chiadma et rput pour son huile. Tyout, primtre irrigu et oliveraie de 100 ha, est riche dune trs longue histoire et dune grande valeur patrimoniale, culturelle et paysagre. On y dnombre 12.000 oliviers centenaires. Comme dans bien dautres cas, la faible valorisation Dpt du dossier de reconnaissance et de protection Jan2009 Dpt du dossier de reconnaissance et de protection conomique du produit et de lhuile dolive Tyout chiadma de lhuile dolive Tyout chiadma latomisation foncire (on compte 120exploitantssurles100haetchaqueexploitationcomptedenombreusesparcelles)sonttellesqueloliveraiesouffre dun manquedentretien.En effet, siunpropritaire taille sa parcelle sans que sesvoisins fassent de mme enmme temps,ilseraperdant(lesarbresdesvoisinsprofiterontdusoleilauxdpensdessiens).Cependant,leterroirdeTyouta pourluilexistenceduneAUEA(associationdusagersdeauagricole)etlavolontdunnoyaudagriculteursvolontaires pourallerdelavantetsengagerdansleprojetdevalorisation.LlaborationduneAOPparatdoncjustifieetjouable. AveclappuiconstantduCentredeTravauxdHanchane(structuredeproximitduMinistredelagriculture),delaDPAet dunchercheurdelINRAdeMarrakech,cenoyaudunevingtainedagriculteursvaalorsmettreenuvreladynamique locale. Elle se traduira par la cration dune cooprative, et de 3 comits (technique, juridique, de contrle interne) chargsdellaborationducahierdeschargesdtailletdenombreusesautresmissions(encadr). Encadr15.Troiscomitspourunprogrscollectif

Le comit technique compos de la cooprative, du CT, du service comptent de la DPA et de lINRA de Marrakech, a eu pour missions de : organiser des journes de sensibilisation et de dmonstration, dterminer la date optimale de rcolte et organiser lopration de rcolte, transport et stockage, former sur les paramtres de qualit, encadrer la trituration et laborer le cahier des charges de lAOP.

Le comit juridique, compos des mmes membres, a eu pour mission de dlimiter la zone gographique de lAOP, mettre en place une structure de contrle, valider son niveau le cahier des charges.

La cellule de contrle interne compose dagriculteurs connaisseurs du site et de jeunes instruits a, avec lappui du CT, inscrits les agriculteurs souhaitant participer lopration, mis en place un calendrier de rcolte bas sur la maturit des olives, contrl la qualit des olives rceptionnes dans la masra, contrl le droulement de lopration de trituration, contrl la qualit de lhuile produite (acidit et valeur organoleptique).

48

Leprojetde1,2millionDH,financparlesbnficiairesaveclappuidespouvoirspublics(DPA,INDH,FREPE),apermisde construire une unit de trituration traditionnelle rpondant aux normes requises en matire de qualit et dhygine, damliorer le matriel de trituration et agricole, de raliser des emballages et tiquetages de qualit, de conduire les analyseschimiquesetorganoleptiquesetdemettreenplacedesformationsadaptes. Cestdonctoutuntravaildanimationlocaleconduitsurplusieursannes(depuis2004),aveclamiseenplacedegroupes professionnelslocauxetlatenuedetrsnombreusesrunionsquiestlabasedusuccs. LecahierdeschargesdelAOP,quiademand4annespoursonlaboration(20052008)atofficiellementreconnu enavril2009pardcisionduMinistredelagriculture.Ilgarantitdesconditionsdeproductionpourunehuiledehaute qualitavecmaintienduneforteauthenticitetdesavoirfairelocaux.Lecahierdeschargesimposenotamment:i)la ralisationdetravauxdusolaumoinsdeuxfoisparan,enhiver,pourfaciliterlinfiltrationdeseauxpluvialesdanslesol, ii)unevaluationdelamaturitdesolivesaudbutdechaquecampagne,lindicedematuritdevantsesituerentre2,5 et3,5;iii)unetailledefructificationannuelleaveccependantunetailledergnrationprogressivepourlesarbresgs, iv)unepriodedestockagecompriseentrelarcoltedesolivesetleurtriturationquinedoitpasexcder48heures;v) unbroyageetunmalaxagesimultanslaidedemeulesenpierre,vi)lelavagedesscourtinslafindechaquejourneet leur rnovation chaque mois; vii) la ralisation de la pression de la pte dolive dans des presses en inox, viii) le conditionnementdansdesbouteillesenverreneuves. LAOPTyoutChiadmasecaractriseparsacouleurjaunedoravecuneteintevertelgre;nontransparente,sonfruit moyen(34,5)etquilibrenamer(2,74)etenpiquant(2,53,7)etsonaromeprononcdetomateetdecardon. Elle prsente une trs faible acidit libre (< 0,4%) et un indice de peroxyde infrieur 15 milliquivalents dO2 des peroxydes/Kgdhuile.Lesteneursenacidesgrasmonoinsatursetpolyinsatursdoiventtrecomprisesrespectivement entre67%72%etentre15%18%. Audirederesponsablesagricoleslocaux,lobtentiondelAOPetlacrationdeplusvaluevaconduirelesjeunesrevenir aupays.Cesttouteunedynamiquederenouveaururalquisestainsiengage. LECHEVREAUDARGANIER Larganeraie nest pas quune fort naturelle, affaires de femmes rurales: cest aussi un espace agrosylvopastoral plurimillnairegrpardesagriculteursleveurs.Sillevagepeutcontribuer,parsurpturageoumauvaisegestiondes parcours, la dgradation de lcosystme, il est aussi une composante de celuici et les agropasteurs peuvent contribuersabonnegestion,ycompris,lecaschant,pardesactionsdebonentretiendesarbresetpardesrgles communautairesdemiseenrepos. Larganeraiepermetdoncdepuisdestempsimmmoriauxuneproductioncaprinetrsoriginaleetnaturelle.Onvalue autotalenviron1,2milliondettesleffectifcaprinpouruneproductiondeviandechevreaudarganierdenviron4.200 tonnes/an. Le cheptel se caractrise par des animaux grimpeurs, de profil droit et de petite taille. Lalimentation typique, base sur les produits de larganeraie, donne une viande singulire forte rputation dittique. Issue danimauxjeunes(de612mois)etdecarcasseslgres(de510kg),laviande,tendreetjuteuse,secaractriseparsa couleurrougeclair,satexturepeufilandreuse,saflaveur(gotsucretarmedevgtaux),sarichesseenacidesgras polyinsatursetsafaibleteneurenlipidestotauxetenmauvaischolestrol.Sansdistinctionsurlemarch,ellenestpas payesonvraiprix. Dansuntelcontexte,lamiseenplaceduneIGcorrespondtroisgrandsobjectifs:i)valoriser,reconnatreetprotgerla viandeduchevreaudelArganier,ii)responsabiliserlesleveursdanslagestiondurabledelcosystme,iii)consolideret prenniserlattractivitdecetlevagetypiqueetamliorerlesrevenusdesleveurs. La mise en place dune IG, justifie par la grande typicit que le terroir donne au produit, pourrait donc tre dune importancevraimentstratgique.

49

Aprslaralisationen20012002dunetudesurlacaractrisationdellevagecaprindelarganeraie,etlorganisation en2003dunsminairesurlachvredanslcosystme,unerflexionstratgiquesurlecheminversunsignedorigineet dequalitatengageen2004avec4tapessuccessives: Phase 1(20042005) : cration dun groupement dleveurs Essaouira Argane affili lANOC (association nationaleovins,caprins)etconstitutiondunecelluledanimationdugroupementcomposeduntechniciende laDPAetdunanimateurdelANOCainsiqueduncomittechniquedesuivi.Legroupementcompteenviron 160leveurs. Phase 2(20062007) : actions de renforcement des capacits des animateurs et des leveurs avec la clef la mise en place dun programme de slection gntique et une amlioration des conditions dlevage ayant permisunerductionconsidrabledelamortalitpassede252%. Phase3(20082009):ralisationdessaisdetransformationetdtudesdetypicitdelaviandeaveclUniversit deCatania,etformationdunjurydedgustation. Phase4(2010):laborationduncahierdeschargesetdptdelademandedereconnaissanceetdeprotection.

La DPA et ses partenaires ont impuls par ailleurs de nombreuses actions de sensibilisation et de communication en directiondesconsommateursetdesproducteurs:organisationdesminairesetfoires,concoursculinaires,participation auxsalonsagricoles,miseenplaceduncircuitdesproduitsdeterroiravecuneagencedetourismeetlescoopratives. Cest ainsi tout un faisceau dactions qui concourt progressivement crer un paniers de biens et de serviceset susciterunemulationetunesynergieglobales.

3.4 C H E F C H A O U E N /T A N G E R T E T O U A N
LargionTangerTtouan,lapointenordouestduMaroccompte5provincesetunepopulationtotalede2,6millions depersonnes.LecontrasteentreleszonesctiresetlintrieurmontagneuxestconsidrableetlavilledeTanger,avec lexode rural, a connu une trs forte croissance dmographique, plus rapide que celle de lconomie. Cette explosion urbaineestproblmatiquebiendestitres.Largionsecaractriseaussiparunetrsgranderichessebiogographique qui a justifi la cration de la rserve de biosphre intercontinentale de la Mditerrane occidentale (partage avec lEspagne),celleduparcnationaldeTalasemtaneetleprojetdeparcnatureldeBouhachem.Larichebiodiversitetle milieu naturel luimme, les sols, la vgtation, sont cependant trs dgrads par limportance de lrosion et par la dforestation. La vitesse denvasement des retenues des barrages, signe de la trs forte rosion, est considrable. La cultureducannabisyadirectementcontribu. Lencouragementdautresformesdegestionetdevalorisationdesressourceslocalesestdoncunencessit. LE PROJET D A Z U R LaRgionTangerTtouanasouhaitquesoitmisenplaceunprojetterritorialdedveloppementlocalenmilieurural, inspir par les principes directeurs des parcs naturels rgionaux franais. Ces derniers se dfinissent commedes territoires ruraux fragiles, reconnus au niveau national pour leurs fortes valeurs patrimoniales et paysagres et qui sorganisent autour dun projet concert de dveloppement durable, appel charte, fond sur la protection et la valorisationdupatrimoine. LaRgionTangerTtouanaargumentcettedcisionparlapriseencomptedestrsfortesvolutionssexerantsurses territoiresrurauxhabits,aupatrimoinenatureletculturelrichemaisfragileetmenacparcesmmesvolutions.Elle sest ainsi rapproche de la rgion Provence Alpes Cte dAzur, laquelle a, dans ce domaine, une grande exprience accumule puisquelle compte 5 parcs naturels rgionaux, 2 parcs nationaux et 3 rserves de biosphre (UNESCO), reprsentantautotal42%delasuperficiergionale.
DE PARC NATUREL DE

BOUHACHEM,

UNE COOPERATION AVEC

PROVENCE ALPES COTE

50

La coopration a conduit llaboration du projet de parc naturel de Bouhachem, sur le primtre de 6 communes (149 douars) situes au carrefour des 3 provinces de Chefchaouen, Larache et Ttouan, soit une superficie totale de 90.000 ha dont 50% relevant du domaine forestier et une population de 50.000 habitants (chiffres2001).Lapetitergionsecaractriseparuneagriculturedesubsistancepeuperformante(craliculture en baisse au profit de la culture illicite, levage caprin, oliculture, arboriculture fruitire) et par un fort accroissementdmographiqueaccentuantlespressionssurlesressourcesnaturelles. Lepatrimoinelocalestexceptionnelmaismenac.Onpeutnotammentciter: 33.000 ha de fort (zenaie, tauzaie, suberaie, pinde, cdraie) biodiversit floristique leve, 32 espcesdemammifresdont11espcesendmiques,raresoumenaces,91espcesd'oiseaux,dont 32sontendmiques,raresoumenaceset29espcesdereptiles; unpatrimoinehistoriqueetreligieuxtrsvivant(plerinages)etdessavoirfaireetpratiquesagricoles spcifiques:culture du chkalia, jusde raisin cuit(samet) tmoin de l'activit viticole passe. Le miel deBouhachemestunproduitapprcil'chellergionale; Un patrimoine architectural spcifique, un habitat traditionnel et 7 monuments remarquables datant me me duXVI etXIX sicles; Uneforteidentitculturelle; Unartisanatd'artetdeservicetraditionnels,diversifimaisendclin.

La coopration sest mise en place en 2001 avec une mission sur place du vice prsident de la rgion PACA, prsidentduparcnaturelrgionalduLubron.Elleaconduit:i)denombreusesmissionsdexpertsfranais, et une identification avec les acteurs concerns du patrimoine local, des axes prioritaires possibles dun dveloppement durable pour la zone et dorientations possibles pour la cration dun parc naturel. Des orientations et objectifs 20 ans ont ainsi pu tre dfinis en 20032004 et un conseil associatif et un conseil scientifique ont t crs. La proposition de charte a ainsi retenu 5 grands objectifs: protger, amnager, dvelopper, informer et exprimenter. En 20042008, les autorits locales (communes, provinces, rgion) et des servicesde lEtat etdes associations ont adhr la charteetune sriede microprojetsa putre initie au bnfice de la population. Enfin, en 20092011, a t mis en place un comit de pilotage du projet pour aboutirlacrationdelorganedegestionetlalabellisationduterritoireenparcnaturel,conformment cequedoitpermettrelanouvelleloiencoursdexamensurlesespacesprotgs. Uneprioritretenuepour20102011estlaidepourledveloppementetlavalorisationdusecteurolicole. L A P R O V I N C E D E C H E F C H A O U E N , D U P R O J E T MEDA A U F O R U M P L A N E T E T E R R O I R S LaprovincedeChefchaouenabnficidelappuidunprojeteuropenintitulprojetdedveloppementparticipatif deszonesforestiresetpriforestiresdelaprovincedeChefchaouen. 51

CeprojetatloccasionpourledirecteurdelaDPAdelpoque,lequelavaitinitilavalorisationdesproduitsdeterroirs surEssaouira,dedvelopperuneapprochetrspartenarialeassociantnotammentlesprofessionnelsetlesONGactives danslaprovinceetfaisantvoluerladministrationdunrledecommandandcontrolunrledepartenairebassur laresponsabilitpartageetletravailenrseauaveclesautresacteursduterritoire,tatiquesetnon.Lamiseenplace dquipesdanimateurs(4animateursparCentredeTravauxdont2financsparleprojet)apermisauprojetdesancrer localement. Leprojetanotamment: permisdesoutenirdenouvellesdynamiquesagricoleslocalesapiculture,cuniculture,oliculture,fromageriede lANOC,plantesaromatiquesetmdicinales(PAM),miel,fruitsschs,dansunezonepourtantdifficile. montr l'importance d'intgrer des activits de renforcement des capacits institutionnelles, ainsi que des capacits des diffrents acteurs locaux (formation et assistance technique ciblant des associations de dveloppementlocal,desgroupementsfminins,descooprativesdeproducteurs,etc)pourlamiseenmarch etlavalorisationdesproduitsagricoleslocaux, montrqueladurabilitdudveloppementagricoleenzonesdemontagnesnepeutseralisersansunevision territoriale,globaleetintgre,desactionsetdesacteurs,autourdunpanierdebiensetdeservices.

Cettedynamiquemultiacteurs,bienengage,atlunedesraisonsduchoixdeChefchaouenpourlorganisationdu me 3 Forum Plante Terroirs. La prparation du Forum, de dbut 2009 au printemps 2010, par les associations ATED (associationTalasemtanepourlenvironnementetledveloppement)etTerroirsetCulturesaveclappuiduncomitde pilotagelocalimpliquantfortementladministrationdelagriculture,atloccasiondallerbeaucoupplusloindansla rencontreentreacteursetdanslarflexionpartage.Elleapermisdesactionssur5axes(encadr16). Encadr16:Cinqaxespouruneapprocheterroir 1.Connaissanceetrechercheaction:untravaildecaractrisationdesproduits,filiresdeproduction,patrimoines bioculturels,patrimoinesjbala,culturesalimentaires,etc.aputremenbien. 2. Dynamique collective: le comit de pilotage du Forum, les nombreuses sessions dinformation et de sensibilisation,lesjournessurletourismerural,lesvisitesdchanges,laprsentationdesproduitsdeterroirsde Chefchaouenla35meconfrencegnraledelUNESCO,onttdoccasionsdesonanimation. 3. Formation et accompagnement: des rflexions sur les besoins et des sessions de formation/action pour le renforcement des capacits des acteurs locaux, notamment les organisations professionnelles agricoles et artisananlesonttmenesbien. 4. Commercialisation et accs au march. Cest une question importante car la plupart des coopratives ont des problmatiques daccs aux marchs et il est important dinnover, de trouver de nouvelles formules daccs aux marchs,dedciderlecaschantdesegmentationspouradapterloffreauxdiffrentstypesdeconsommateurs,et deFavoriserlasynergiepourcrerunpanierdebiensetdeservices 5.Visionpartage:ellesedveloppeautourdunidentifiantfort:lemondejebli,lesproduitsdeterroirsetle panierdebiensetservicesjbala. D E U X E X E M P L E S D E P R O D U I T S D U T E R R O I R J B A L A : L E S A M E T E T L E J B E N LESAMET LesametestunproduitdeterroirtypiqueprsentdanslargiondeChefchaouenaumoinsdepuisle16esicle.Produit desrgionsanciennementviticolesdeBabTazaetMokrisset,lesamettaitunmoyendeconserverlesderniersraisinsde larcolte,moinsprsentables. 52

Le samet, sirop de raisin issu traditionnellement de varits locales de vignes (le taferialte, le singu ou le boukhanzi), mobilise un savoir faire original. Aprs rcolte, nettoyage et lavage, le raisin est mis scher dans une corbeille, puis crasdansdessacsaveclespieds.Unefoisfiltretgoutt,lejusestmiscuirefeufortdansunemarmitependant 4h306h.Acestade,ilpeuttrevenduouamlior.Pourcefaire,lesametreposependantunesemaine,puisilest recuitunedemiheureetfiltrdenouveau. Le produit tient uneplace originale dans les traditionsalimentaires etmdicinalesde la rgion. Consomm comme du miel,aupetitdjeuner,avecdubeurre,ilestgalementuningrdientdelaassida(soupebasesemouleouvermicelles etdelait).Pourl'AidElKbir,ilestutilislaplacedumielpourfairelmrouzia(untaginesucrsalauxamandesetaux raisinssecs).Alimentnergtique,lesametestgalementutiliscommemdicament,encasderhumeoufivre;ilest administrauxfemmesaprslaccouchement. Cetteproductionoriginaleestcependantprogressivementtombedansloublipourntreaujourdhuilaborequedans quelquesdouarsdelargion.Lpidmiedephylloxeradanslesannes70adcimlesvignesdelargion,quiontt remplacespardautrescultures,moinsfragiles.Saproductionrestemajoritairementrservelautoconsommationet psepeusurlconomielocale.LesametestcependantvendudanslessoukslocauxetdanslaboutiqueChaouenRural Chefchaouen et il est propos dans quelques gtes de la rgion. Il prsente aussi des opportunits conomiques certaines,mmedimpulserunedynamiquedeterroircarlelitredesametestvenduauxalentoursde200Dh/Ldansles souks,contre310Dh/kglekgderaisin(ilfaut3litresdejusderaisinpourfaireunlitredesamet). Unestratgiederenouveaupourraitdonctrejustifie.Lesquestionsposesparlaproductiondesametsontcependant nombreuses.Auplandelaproductionderaisin,lesquelquesvignesaujourdhuiprsentesauxalentoursdeBabTaza,du muscatenprovenancedItalie,onttfinancespardiversprojetsaudtrimentdesvaritslocales.Larintroductionde varits locales pourrait contribuer la rhabilitation de la biodiversit, facteur essentiel dans une perspective de dveloppement local durable. Le dveloppement de la production de samet implique aussi une rflexion autour de la modernisationdesonmodedefabrication(semimcanisation)sanspertedetypicit.Ilconvienteneffetdemettreau pointlesmachinesqui,adapteslapetitetransformationartisanale,permettrontdeproduireunproduitauthentique enrduisantconsidrablementletempsetlapnibilitdutravail.Ilfaudraenfinorganisermieuxlaprofessionetlamise enmarch,etcrer,pourquoipasdemain,uneIG. LEJBEN Le fromage frais de chvre de Chefchaouen, ou jben, est fortement prsent et apprci en pays Jbala depuis une cinquantaine dannes. Issu dunetraditionfromagredela rgion TangerTtouan, o les fromages frais mlangs (lait de vache et de chvre) sont traditionnellement produits et consomms, le jben de chvre sest rcemment impos dans lalimentationdesChaounis.Ce fromage est profondment li au territoire de Chefchaouen, danslequelllevagecaprinest historiquement rpandu, avec un mode de conduite majoritairement extensif et 53

traditionnel.Consommaupetitdjeuner,parfoisaccompagndhuiledolive,avecdescrpes(msemen)oudupain,il faitpartieintgrantedelaculturealimentairelocale.Lefromagefermierdoittrelavavantdtreconsomm,car trssalpoursaconservation.Lejbenestaussiconnulchellenationaleetlesconsommateurslassocientclairement largiondeChefchaouen.Iltiresarputationdesonterritoireetdelimagenature,pleinairquildgage. Ontrouvedeuxtypesdejben: le jben fermier produit au sein de petites exploitations familiales Dans les petites exploitations familiales, les troupeauxsontdestinslafoislaproductiondeviandeetdelait.Latransformationfromagreconstitueun complmentderevenupourlesleveursquivendentleurfromagedanslessoukshebdomadairesdelargion. Lejbenfermierestproduitaveclelaitdechvreslocalesoucroisesdontlalimentationprovientdesparcours forestiersrputspourtrerichesenplantesaromatiquesetmdicinales,souventspcifiquesetendmiques largion.Sonmodedefabricationrsultedunsavoirfaireancestral:laborpartirdelaitcruetdeprsure naturelle gnralement issue de la panse dun jeune ruminant (ou parfois de la sve de figue), il se conserve grceunajoutdesel. Le jben de la fromagerie Ajbane Chefchaouen (gre par lANOC, Association Nationale Ovine et Caprine) produitenmajoritpartirdelaitderacescroisesetalpines,issulafoisdungroupementdleveurscaprins etduncentretechniquedlevagecapringrparlANOC.Leschvressalimententlafoisdefourragesetde complmentation. Llaboration de ce fromage rpond des standards dhygine et de qualit modernes (systme HACCP, agrment sanitaire). Le lait est pasteuris, et des ferments lactiques sont ajouts lors de la fabrication.Ledveloppementdecejbenabnficidappuispublicsimportantsavecdesrsultatspalpables: environ 36 leveurs ont une garantie de rmunration rgulire, et cinq ouvriers et techniciens qualifis sont employs. Cependant, la fromagerie ne fonctionne pas au maximum de sa capacit: environ 95% en haute lactationcontreseulement40%enbasselactation(plusde6moisparan). Les 2 types de jben peuvent tre considrs comme complmentaires. Le fromage de la fromagerie est demand par une clientle urbaine nationale (Tanger, Ttouan, Rabat et Casablanca), plus sensible aux mthodes modernes de fabrication. LANOC porte un projet de labellisation du Jben par un Signe Distinctif dOrigine et de Qualit notamment pour contrer des risques dusurpation par des produitsconcurrents de marques sans lien avec le terroir. Le fromage fermier doit pouvoir trouver aussi sa place dans le projet territorial, ainsi que la viande de chevreau. La demande localepotentielleestlevepourcesproduitsde terroirs trs authentiques et la nouvelle politique agricole de professionnalisation des leveurs, les travaux mens sur lorigine et la qualit, les savoir faire locaux, lancrage et la renomme du produit, un premier travail didentification de race locale 54

actuellementmenparungroupedechercheursdelINRAdeTangeretlesouhaitdelANOCdeservirundveloppement aubnficedetouslesleveurspourraiententreloccasion.

4. L ACONTRIBUTIONDELARECHERCHE
L E P R O G R A M M E D E R E C H E R C H E D E L INRA S U R L E S T E R R O I R S LeprogrammederecherchesurlesproduitsdeterroirsdelInstitutnationaldelarechercheagronomique(INRA)du Marocsestfix3objectifs:prserverlagrobiodiversit,valoriserdessavoirfairelocauxtraditionnelsetamliorerle revenudesagriculteurs. Lesaxesderecherchesontlaprservationdesressourcesgntiquesdesvaritslocalesetlavalorisationdes productionslocales. La recherche/action porte sur linventaire et ltude des procds traditionnels dlaboration des produits de terroirs pour lidentification et la mise en place des signes distinctifs dorigine et de qualit; la mise au point de nouveaux transforms base de produits de terroirs; lassistance et lencadrement des projets de valorisation des produits de terroirs(transfertdetechnologies,appuillaborationdecahiersdeschargesdesignesdistinctifsdorigineetdequalit, etc..);lacollecteetlvaluationdesressourcesgntiqueslocales.

Fruits

Nectar de figues

Gele de figues

Sirop de raisins (Essamet)

Grains de grenades en sirop

Jus de grenades

Nectar de grenades

Pte dolives tartiner Olives vertes sches

Clmentines de Berkane en sirop

Les actions de prservation des ressources gntiques ont djpermis:i)lacaractrisationdevaritslocalesdebl dur desterroirs de Ksiba, dImilchil, deRich et de Taounat (varitsAberyoun,Irks,IrdenNtiallalinetChkiria),dorges dAzilaletdeTaounat,dedattes(productiondevitroplants desvaritsMejhoul,BoufegousetBouzekri),ii)lacollecte des germoplasmes et la caractrisation et valuation de populations locales de cprier, cactus, arganier, amandier, figuier et plantes aromatiques et mdicinales, iii) des tudesrelativesausafran:optimisationdutraintechnique de conduite, tude de la variabilit gntique, analyse chimique des principales composantes par HPLC et par Spectrophotomtrie, tude biotechnologique pour lidentification des cultivars marocains prsentant des qualitssuprieures.

Lesactionsdevalorisationontpermispourleurpart: lamiseaupointdenouveauxproduitsbasedecactus(fruitsconfits,nectars,confitures,filets,farinesetsoupes deraquettes,huilesdegrainesdefigues),dedattes(confitures,nectar,ptetartiner,gele),defruitslocaux (nectaretgeledefigues;nectaretjusdegrenade,olivesvertessches,ptedolivetartiner,clmentinede Berkane en sirop), de crales (flocons dorge et de bl dur, soupe prprpare dorge), de prparations culinaires(tangiaenconserve,soupedefveprprpare), des partenariats avec lAgrotec Souss Massa Draa pour la mise en place de plusieurs unitsde productionde produitsbasedecactusetdedattespardescooprativeslocalesChtoukaAitBahaetZagoraetaveclAgence du Sud pour les oasis de Guelmine: montage de trois units de transformation et de conditionnement des dattes,duneunitdevalorisationdesolivesdetabledelargiondIfrane(antiatlas),duneunitpolyvalentede valorisation par transformation des varits du cactus, dun micro projet communautaire dlevage de poulet beldietdufs,duneunitdevalorisationdelorgelocale(MegliBelghmane)etdedeuxunitsdefabrication ducouscouslocalKhoumassiAssaetZag. unaccompagnementlamiseenplacedAOPpourdeshuilesdolivedeterroirsdeTyoutChidama(Essaouira)et dIfrane(WilayadeGuelmime). 55

Une recherche plus territorialise sorganise au niveau rgional. Ainsi par exemple, le centre de Tanger Ttouan dveloppe de la connaissance et des actions pour llevage caprin du pays Jbala pour un dveloppement durable. Les recherches et tudes portent notamment sur la caractrisation des systmes de production, lanalyse compare des performances, la prservation et la valorisation des ressources alimentaires locales: schmas de gestion des parcours, utilisation des grignons dolive pour la complmentation, caractrisation et recherche de voies damlioration des procdslocauxdefabricationdefromagefermierdechvre,utilisationdesplantesaromatiquesetmdicinalesdansles fromages,etc. U N E C O O P E R A T I O N E N T R E L E NF I E T L ENGREF LENFIdeSal,colenationaleforestiredingnieurs,adveloppdepuisunequinzainedannesdescooprationsavec destablissementsfranaisderecherche(IRD)etdeformation(ENGREFcolenationaledugnierural,deseauxetdes forts,deMontpellier)surlagestiondesterroirsfortevaleurenvironnementale.Lacooprationafavorisdenombreux rapprochements, mobilits denseignants, accueils rciproques, changes dtudiants, projets communs, thses et mmoires,etunPRADappuyparlesMinistresfranaisenchargedesaffairestrangresetdelagricultureatmen bien.Unlivreserabienttpubli. Des enqutes et tudes ont port sur le Moyen Atlas, le Haut Atlas et la rserve de biosphre de larganeraie. Elles sattachent mettre en vidence les dynamiques socitales et cologiques et dexplorer des scnarios possibles et invitentrflchirauconceptdeforesteriesociale.Une formationdiplomanteforestireaveclENGREFestencoursde dfinition. UNEINITIATIVEFRANCOMAROCAINENOVATRICESURLESTERROIRS Leschangementsquiaffectentlesconomiescontemporainestmoignentdundoublemouvement,crateurdetensions et dopportunits, entre la globalisation sans cesse plus importante des changes, et le retour vers les territoires, les produitslocaux,etlespratiquestraditionnelles.Lesterroirsetlesproduitsdeterroirs,lespatrimoinesnaturels,agraires oururaux,reconnuscommeintrinsquementporteursdunegrandediversitculturelleetbiologique,sontaujourdhui lobjetdenjeuxconomiquesmajeursetsontrigsenvritablesoutilsdudveloppementdurable.Danscecontexte,les approches territoriales de lamnagement et du dveloppement rural posent de nombreuses questions, dordre thoriqueetappliqu,laRecherche. Poursattacherrpondrecesquestionsetcontribueraumieuxlamiseenuvredepolitiquesdedveloppement rural durable, une initiative de coopration scientifique francomarocaine est en cours dengagement. Base sur des partenariatsdjconduits,elleassociedesquipesdelInstitutdeRecherchepourleDveloppement(IRD,France)etdes quipesdetroisinstitutionsmarocaines:UniversitMohammedVAgdalRabat,UniversitCadiAyyadMarrakech,Ecole NationaleForestiredIngnieurs.Dautrescollaborationspourronttreensuitenoues. Cette initiative consiste en la cration dun laboratoire mixte international traitant de la problmatique des terroirscommeoutilsdudveloppementdurabledeszonesruralesmarginales.Alidentiquedautreslaboratoiresmixtes rcemmentcrs,loccasiondappelsprojetslancsparlIRD,avecdesoprateursmarocainsdansdautreschamps scientifiques,celaboratoireapourobjectifderegrouperetrenforcerlescomptencesdquipesauseindunestructure visibleayantpourvocationdefdrer,surleMaroc,desthmatiquesderecherchesurlaquestiondudveloppement ruraletdelenvironnement. Ladmarcheadopteprvoitnotamment:

desapprochespluridisciplinaires,multithmatiquesetmultiscalaires; undialogueentresavoirsscientifiquesetsavoirslocaux; linscription de lanalyse scientifique dans le dbat public et en prise avec laide la dcisionet la gestion de
projets. Ce dispositif de recherche, avec sa dynamique de mutualisation des comptences et des moyens, devrait utilement contribuerauxrflexionsetactionsdveloppesenparticulierdanslecadreduPilier2duPlanMarocVert. 56

Mais lambition de cette initiative francomarocaine est galement de contribuer au dveloppement des rseaux de collaboration lchelle euromditerranenne sur ces questions de terroirs, de dveloppement rural et denvironnementquirecoupentdesenjeuxcommunsauxsocitsdupourtourmditerranen.

V. U NEETUDEDECAS : LESPRODUITSDETERROIRSDANSLA S TRATEGIEDEDEVELOPPEMENTDU S OUSS M ASSA D RAA 7


LePlanMarocVert,lancen2008,adonnuneforteimpulsionlarflexionetlinnovationentermesdeconception, dlaboration et dimplmentation des projets de dveloppement agricole. Certaines rgions, comme celle de Souss MassaDraa, avaient anticip sur cette nouvelle tendance en adoptant une conduite innovatrice et avantgardiste par ladoption dune politique rgionale spcialement oriente vers la valorisation et le dveloppement des produits de terroirs.Leprsentchapitre,commanditparleCGDA,tracelexpriencedecettergioninitieds2006,deuxansavant lelancementdelastratgienationalePlanMarocVert. 1 . L A R E G I O N S O U S S M A S S A D R A A E T S O N A G R I C U L T U R E LAREGIONSOUSSMASSADRAA Le SoussMassaDraa (SMD) stend sur une superficie de 72506 km et compte une population denviron 3,3 millions dhabitantdont60%sontdesruraux 8 .LconomiedelargionestparmilesplusdynamiqueduRoyaume,ellecontribue 12,3%duPIBtotalnational,soitunevaleurde76MilliardsdeDirhamscequiluipermetdeseclasseren2meposition derrireleGrandCasablancaquienregistreunepartdePIBde18,3% 9 .Leclimatgnraldesaffairesdanslargionestle meilleurquiexisteauMarocdaprsunetudedelaBanqueMondialeraliseen2008 10 . LAGRICULTUREREGIONALE Lesecteuragricoleestlemoteurleplusimportantdelconomiergionale.Ilemploie52,2%delamainduvreactiveet gnre une valeur ajoute annuelle de 24,7 milliards DH, soit 44% de la VA globale de la rgion. Son volution depuis lindpendance a connu une croissance double vitesse: une croissance lente et irrgulire au niveau des zones ou lagriculture reste traditionnelle cas de la valle du Draa; des zones montagneuses et des plaines arides et une croissance rapide et soutenue au niveau des primtres irrigus modernes cas des valles du Souss et du Massa. La superficieagricoleutile(SAU)danslargionestdenviron560.700hasoit0,2%delasuperficietotale,maislasuperficie qui est rellement alloue aux productions vgtales cultives ou spontane est denviron 1.265.000 ha dont 88% est
7 8 9

DocumentlaborlademandeduCGDAparM.LahcenKenny;IAVHassanII,CHA,Agadir Estimationsurbasedurecensementofficieldelapopulationde2004. DaprslaDEPF:DirectiondesEtudesetdesPrvisionsFinanciresMinistredesfinancesetdelaprivatisation BanqueMondiale,2008.Doingbusiness.AmliorationduClimatdesAffairesauMaroc.Ltudeenquestionmesurelescots,lesdlaisetlenombredeformalits

10

associescertainesdmarchesadministratives,tellesquelacrationdentreprise,letransfertdestitresfonciers,lobtentiondespermisrelatifslaconstruction,le recouvrementdecranceetlecommercetransfrontalier,larglementationdesentreprisesdeconstructionetlescontrleseffectusetc.

57

danslesecteurextensif.Malgrlesdisponibilitsenterreetenressourceshumaines,lesecteurextensifnecontribue quhauteurdenviron25%danslaproductionetmoinsde10%danslavaleurglobalergnreparlaproduction primaire dorigine vgtale (Tableau 3). Lactivit agricole dans le secteur extensif constitue la principale source de revenuspour51%delapopulationdelargion,soit1.680.000habitants. Tableau3.Productionvgtalesdanslessecteursintensif etextensifduSoussMassaDraa
Superficie (x 1000 ha) Secteur intensif Secteur extensif Total 83,37 152,35 235,72 % 35,37 64,63 100,00 Production ( X1000 Tonnes) 1385,67 71,28 1456,95 % 95,11 4,89 100,00 Valeur (Millions DH) 2458,13 267,13 2725,26 % 90,1979995 9,80200054 100

Lesprincipalesspculationsdanslesecteurintensifsontlesagrumes,labanane,lesculturesfourragresetlemaraichage primeur(tomate,melon,courgette,aubergineetc.).Quantausecteurextensif,onytrouveunegrandevaritdespces dontlesprincipalessontlepalmierdattier,lescrales,lefiguierdebarbarie,lerosier,lehenn,lamandier,lepommier, labricotier,larganieretcertainesplantesaromatiques,mdicinalesetcondimentaires. Lcart entre ces deux secteurs na jamais cess de se creuser que ce soit en terme dorganisation professionnelle, dencadrement, de mcanisation, dinnovation technologique et agronomique, ou tout rcemment en terme de labellisation et de certification. Les politiques publiques avaient toujours favoris le dveloppement du marachage intensifdanslargiondeSoussMassapourenfairelepotagerduRoyaume. Quilsagissedeculturesmaraichresprimeursoudevergersdagrumes,lesperformancesentermesdeproductivitet derentabilitlhectaresontparmilespluslevesauMarocalorsquepourlesculturesditestraditionnelles,ycompris certainsproduitsdeterroirs(datte,rose,safran),lesrendementsrestentfaiblesetlarentabilitpastoujoursassure. LedynamismequaconnulesecteurdelagricultureintensivedansleSoussMassaestdlapolitiquelibralepratique par le Gouvernement depuis lindpendance et lagressivit du secteur priv qui a su pleinement profiter de celle politique marque par lexonration fiscale, louverture sur les capitaux trangers et loctroi de subventions orientes particulirementverslintensification(semencesslectionnes,mcanisation,gouttegoutteetc.).Lespetitsetmoyens producteursnontquerarementprofitdecesavantagesetnontdecefaitjamaispuamliorerlacomptitivitdeleurs agriculturesvisvisdesgrandesentreprises.Cettatdefait,quiadureplusde50ans,aentranunappauvrissement 11 et une pauprisation continue des populations rurales vivant dans larrire pays du SoussMassaDraa contre un enrichissementetuneprogressionfulgurantedanslesprimtresmodernesetlescentresurbainsetpriurbains.Ilen rsulteuncontrastesocioconomiqueflagrant:unergionquiaffichelundesPIBlespluslevsduRoyaume(12,3% du PIB national) et des taux de pauvret parmi les plus alarmants (33,8% Zagora et plus de 22% Taroudant et Ouarzazate) 12 . LESPRODUITSDETERROIRSDANSLESOUSSMASSADRAA La particularit du climat de la rgion et la diversit de ses reliefs et de ses paysages lui confre un statut avanc en termesdebiodiversit.EnallantdelacteatlantiquelOuestverslesespacesoasienslextrmitEstenpassantpar
11 12

Pararrirepaysonsousentendleszonesmarginalesdanslesmontagnes,lesoasisetlesplateauxaridesdeTiznit. LargionSMDuntauxdepauvretquiavoisineles20%,untauxquirestesuprieurlamoyennenationalede14%.

58

leschanesmontagneusesduhautatlasauNordetleschanesdelAntiAtlasauSudEst,ontraverseunemultitudede microclimatsetdeterroirsolonpratiquedepuisdessiclesdeslevagesetdesculturesbasederaces,dematriel vgtal et de savoirfaire locaux. Lventail ce stade didentification des produits de terroirs dans la rgion compte plusieursspculationsdecrales(3espces);delgumineuses(1espce),delgumes(3espces),defruits(4espces), deplantesaromatiquesetmdicinales(4espces),desolagineux(2espces)etdesplantescondimentaires(2espces) sansparlerdesraceslocalescaprinesetbovines.Certainsdecesproduitssonttrsconnuscommecestlecasdelhuile dargane et du safran, dautres le sont moins comme likiker (une lgumineuse haute valeur nutritionnelle) et le tafsouateoulassemoune(descralesconsommeslocalementettrsapprciesparlespopulationslocales).Letrait commundecesproduitscestquilssonttousissusdezonesmarginalesisoles(montagne,oasis,etc.),moyennantdes techniquestraditionnellesetunsavoirfairelocal. Surleplanconomique,lesproduitsdeterroirscontribuenthauteurde92%lavaleurajoutedgagedanslesecteur extensif (Tableau 1), cette contribution ninclue pas les valeurs des productions annuelles et saisonnires des rgions montagneuses comme celle dAskaoune et des plateaux des Mgoun. En excluant les crales qui ne sont pas ncessairementdesproductionsdeterroirs,lavaleurdes11produitsrestantslvequelque3,1milliardsdhavecune contributionconsidrabledelafiguedebarbarie,desdattesetdelhuiledargane(Tableau4). Tableau4.ImportancesconomiquedesproduitsdeterroirsdansleSMD Productions Olivier Amandier Palmierdattier Arganier Pommier figuierdebarbarie Caroubier Cprier Henn Roseparfum Safran Total Valeur production (Million Dh) 68,6 128 620 347 53,5 1808 1 1 21 32 38 3118,1 2 . L A S T R A T E G I E R E G I O N A L E D E V A L O R I S A T I O N E T D E D E V E L O P P E M E N T D E S P R OD U I T S D E
TERROIRS

% 2,20 4,11 19,88 11,13 1,72 57,98 0,03 0,03 0,67 1,03 1,22 100,00

LASTRATGIE La valorisation des produits de terroirs au sens large du terme 13 , a t depuis longtemps pratique par les petits et moyens producteurs petite chelle et avec les moyens du bord. Dans la valle de Draa comme dans le Souss, les agriculteurs pratiquent depuis longtemps les techniques artisanales de schage, de broyage, de transformation, de conditionnementetdemballage.Lobjectiftantdassurerunemeilleureconservationetsurtoutuneamliorationdela pntration de leur production dans les marchs des villes riveraines. Les exemples sont nombreux ou la valeur marchandedunproduitdeterroiratconsidrablementamlioregrceauxtechniquesartisanalesdetransformation
Parvalorisationausenslargeonsousentendlavalorisationtechnologique(transformation,schage),commerciale(emballage,conditionnement, tiquetageetc.)ousocioculturelle(cotourismeetc.)
13

59

(ex. procds dextraction de lhuile dargane ou de prparation de tahlaouite partir des dattes), de conservation (utilisationdescourgescommemoyendeconservationdesprparationsmdicinales)oudeschage(schagedefigues, dusafranetdecertainsfruitscommelapche). A partir de 1996, la Rgion a connu de nouvelles formes de valorisation faisant rfrence aux notions de qualit, de durabilit et de traabilit. Ainsi, le label biologique a t introduit pour larganier dans le cadre dun projet de collaborationbilatraleentreleMarocetlaRpubliqueFdraledAllemagne.Ceprojetavaitintroduittroisinnovations majeures dans la production et la commercialisation de lhuile dargane: la mcanisation de certaines oprations dextraction, lamlioration du conditionnement et de lemballage et la certification biologique selon les normes europennes. Ces innovations avaient permis un groupe de femmes de sorganiser dans le cadre de lUnion des CooprativesFmininesdArgane(UCFA) 14 ,damliorerlimagedemarquedelhuilesurlesmarchseuropensdune faongnraleetsurlemarchallemanddunefaonparticulire.Ceciapermisuneaugmentationconsidrabledansles revenus 15 et dintroduire les notions dhygine et de propret dans les procs dextraction et demballage de lhuile dargane.Enplusdesonimpactconomiqueetcommercial,cettepremireinitiativeavaitgalementlavantagedinitier les femmes, en majorit des analphabtes, au concept de labellisation/certification et ses exigences en termes de traabilit,dorganisationetderespectdesnormes.CettepremireinitiativeatpiloteparunDpartementcentralen loccurrenceleHautCommissariatdesEauxetForts,traverssadirectionrgionaleAgadir. Jusqu 2005, la Rgion, comme entit politique, tait peu ou pas implique dans les programmes de dveloppement agricolequecesoitdanslesecteurintensifoudanslesecteurextensif.Apartirde2006,lavisionpolitiquedelargion allait prendre un tournant dcisif avec ladoption dune approche pragmatique base sur la ralisation des tudes de diagnostic,llaborationdeplansdactionetdesuivivaluation,letoutaccompagnparunedynamiquedemobilisation defondsetderessources.Unetelleinitiative,lapremireensongenreauMaroc,allaitcompltementbouleverserles murs et habitudes administratives et bureaucratiques qui faisaient que seuls les dpartements ministriels centraux avaientlalatitudedeconcevoir,implmenter,etcontrlerlesprogrammesdedveloppementagricole. Ainsi,enjanvier2007,leConseilRgionaldeSoussMassaDraa(CRSMD)commanditaauprsduncabinetinternationalla ralisation dune tudeglobale pour dresser un tat des lieux de lconomie rgionale, diagnostiquer ses forces et ses faiblessesetproposerlesaxesstratgiquesetlesvoiesdamliorationsuivredansuneperspectivede10ans 16 . Cette tude a mis en exergue la ncessit de redynamiser le dveloppement volontariste travers 3 moteurs de croissance:letourisme,lagricultureetlapche.Cestroissecteursdevront,lhorizon2015,contribuerplusde80%du PIBdelargion.Pourcequiestdelagriculture,troisorientationsstratgiquesonttrecommandes: Bilanhydrique:Renforcerlapolitiquedconomiedeauenrtablissantlquilibreentrelaconsommationetles ressourceshydriquesavant2015etceafindassurerundveloppementagricoledurable; Agriculture intensive: Confirmer le rle de lagriculture intensive dans lconomie de la Rgion qui doit permettreauMarocdeconquriruneplaceparmilesdeuxoutroisacteurslesplusimportantssurlemarch europenavant2015et, Agricultureextensive:Conduitede50%despetitsagriculteurspratiquantuneagriculturetraditionnelleversdes nichesdecroissanceplusmodernesetprometteusesavant2015.

Outreledveloppementdestroismoteursdecroissanceprcits,lastratgiedelargionaprvugalement la cration dune plateforme qui veillera promouvoir lexcellence et dynamiser la collaboration et le

14

LUCFAtaitlapremireuniondecooprativeconstituedanslaRgiondanslecadredelacollaborationinternationaleentreleMarocetunpaysde
Leprixdulitredelhuiledarganealimentaireavaitpasslpoquede5060dhplusde120dh.

lUnionEuropenne.
15 16

LtudeatraliseparlecabinetMcKenzieetaportsurtouslessecteursconomiquesdelaRgion(agriculture,pche,tourismeetc.) 60

partenariat entre les institutions publiques et prives oprant dans le secteur de lagriculture. Cette recommandationatconcrtiseparlacrationdelAssociationAgrotechnologieSMD(SoussMassaDraa).
Cette premire tude a t suivie pour une seconde tude commandite auprs dun organisme national afin dapprofondirlavisionsurlagriculturetraditionnelleetplusparticulirementsurlanalysedesfiliresdesproductionsde terroirs. Lobjectif principal de cette deuxime tude tait didentifier les principales contraintes qui se posent leur valorisationetdenproposerlesissuesetvoiesdamlioration(voireencadr17). Encadr17:SynthsedesrsultatsdeltudesurlesProduitsdeTerroirsdeSMD

En 2006, le Conseil Rgional de Souss-Massa-Draa avait commandit auprs dun cabinet priv la premire tude en son genre au Maroc portant sur la Mise en place dune agriculture durable ayant pour objectif de structurer la filire production et commercialisation de produits issus du terroir . En partant de critres cologiques (consommation en eau, consommation en nergie, conservation des sols, apports dintrants synthtiques, maintien de la biodiversit), conomiques (valeur ajoute, stabilit des revenus, ractivit et adaptabilit aux marchs) et sociaux (cration demploi, conditions de travail, amlioration du statut de la femme), ltude a permis de mettre en vidence limportance de six filires de terroirs parmi une vingtaine analyse, il sagit de lhuile dargane, safran, rose, dates, figue de barbarie et miel. Les autres produits comme le henn, lamandier, le pommier, lolivier, le rosier, le cprier et les plantes aromatiques et mdicinales ont t jugs moins prioritaires. Le potentiel des sites de production a t valu sur la base de critres climatiques, daphiques et gographiques. Ensuite, un recoupement avec les exigences des cultures proposes a permis laffectation des produits aux sites qui les conviennent. Dans un esprit de diversification, ltude a galement proposs de nouvelles cultures introduire dans la rgion comme lacacia Sngal, lagave, lalo, larbre savon, larbre soie, le chanvre, le guayule, le jatropha, le jojoba, le quinoa etc. Des donnes sur lanalyse des filires et des marchs avec un benchmarking international a t propos. LAPOLITIQUEDEMISEENUVRE Lamiseenuvredesrecommandationsmanantdeltudeprciteatconcrtisepartroisactionsmajeures: 1. La cration de lAssociation AgrotechnologieSMD comme plateforme rgionale pouraccompagner le CRSMD danslamiseenuvredesapolitiqueagricole, 2. LamobilisationdefondsetderessourcesinternesauCRSMDet; 3. Le renforcement de la coopration internationale et son orientation vers lappui des programmes de dveloppementtracsdanslecadredelastratgieglobale. L E R O L E D E L A S S O C I A T I O N A G R O T E C H N O L O G I E S S MD Lassociation Agrotechnologie SMD, a t cre le 29 mars 2006. Elle se dfinit comme une plateforme rgionale regroupantlesdiffrentsacteursdelafilireagricoleoprantdanslargion(entreprisesprives,institutsdeformations etderecherche,collectivitslocales,organisationprofessionnelles,institutionsbancairesetc.).Ilsagitduneassociation but non lucratif dote dun conseil dadministration et dun bureau excutif qui gre les fonds et veille la mise en uvredelapolitiquededveloppementtraceparleCRSMD. 61

LamissionquiluiestattribuestdaccompagnerleCRSMDdanslamiseenuvredesonprogrammededveloppement agricoleenpartenariatavecdesinstitutionsprovinciales,rgionalesetnationales.Ceprogrammecomporteactuellement troisvoletsdontunestrelatiflavalorisationetaudveloppementdesproduisdeterroirsdanslaRgion. Lesobjectifstracssontde: Soutenir lintgration des producteurs et des coopratives dans les filires de production pour la restructurationdecesfilires; Encouragerlatransformationetlavalorisationdesproduitsdeterroirsafindecrerlavaleurajouteetlagarder auniveaudelaRSMDauprofitdesproducteurs; Assurer une rpartition quitable des richesses et des marges de bnfices de ces filires au profit des producteurs. Figure5.ComposantesduprogrammedelAssociation AgrotechnologieSMDpourlaleDveloppement desfiliresdeproduisdeterroirs

3 . L E S A C Q U I S E T L E S R E AL I S A T I O N S C O N T R I B U T I O N F I N A N C I E R E A U X P R O J E T S D E D E V E L O P P E M E N T 62

En se basant sur les tudes de diagnostic ralises par Mackenzie et Rsilience, Agrotech a choisi de concentrer ses actionsetsoninterventionsurlessixfilireslesplusimportantesdelaRgionsavoirlefiguierdebarbarie,lepalmier dattier, larganier, le safran, le rosier et le miel. Un plan daction en 7 axes a t programm et se trouve en cours dexcutiondepuis2007: 1. Contributionfinancireauxprojetsdedveloppement; 2. Encadrementetsuivitechniquedesprojetsparlebiaisdunecelluletechniquequiregroupelescomptencesdes institutionspartenaires(IAV&INRA), 3. Appuilamiseenplacedessignesdistinctifsdequalit, 4. Conseil en communication et marketing: choix du packaging, recherche de nouveaux concepts de marketing, positionnementetcrationdeplansdemarketing, 5. Formationdesoprateurs, 6. RechercheetDveloppement, 7. Partenariat. La contribution financire aux projets a commenc par une analyse dtat des lieux pour les filires prcites en concertation avec les partenaires. Elle a permis de dgager les priorits exprimes par les oprateurs euxmmes (Tableau5). Tableau5:Diagnosticetactionsprioritairespourledveloppement desfiliresdesproduitsdeterroirsdansleSMD. Lacunesetdfaillances Actionsetmesuresprendre
Lesecteurdesfiliresproduitsdeterroirestpeuorganis; Lexistence dune forte spculation et dune chane des intermdiaires; Lamconnaissancedesprocduresdegestionadministrativeet financiredecertainescoopratives; Lenclavementdeslieuxdesprojetsdevalorisationdesproduits deterroir; Les locaux des porteurs des projets ne rpondent pas aux conditionsdhyginesalimentairesetdescurit; Certains locaux ne sont pas quips en eau potable et au raccordementlectrique; Les porteurs des projets de dveloppement des produits de terroir ne matrisent pas les procds technologiques de transformationdecesproduits; Le packaging des produits transforms est mal prsent et qui nestpasattractif; Les circuits de commercialisation ne sont pas tudis et dfinis..etc Appui et renforcement des organisations professionnellesfigurantdanslesecteurdesproduits duterroir; Soutien lintgration des producteurs et des coopratives dans les filires de production pour la restructurationdecesfilires; Encourager la transformation et la valorisation des produitsduterroirafindecrerlavaleurajouteetla garder au niveau de la Rgion Souss Massa Dra au profitdesproducteurs; Assurerunerpartitionquitabledesrichessesetdes marges de bnfices de ces filires au profit des producteurs, en particulier dans les milieux semi arides; Apporter de nouvelles activits, daccroitre les revenus des populations et de combattre les discriminations et la pauvret au niveau local et rgional; Crer lemploi et amliorer la qualit et la prsentabilitdesproduitsofferts

Laidefinancireoctroyeauxporteursdeprojetspassepardesappelsprojetlancsdanstouteslescommunesdela rgion. Pour bnficier de laide loprateur doit rpondre des critres dligibilit dordre gnral et spcifiques (Tableau6). Tableau6.CritredligibilitauxaidesfinanciresdelAssociationAgrotechSMD Critresdordregnral Critresspcifiques 63

1.

2.

3.

4.

Etre conformes aux principes du dveloppement durable: promouvoir en mme temps lefficacit conomique, lquit socialeetlintgritenvironnementale; Promouvoir lorganisation et la solidarit conomique des territoires,desvillagesetdeleurspopulationstraverstoutes les formes possibles de partenariat, de coopration et dassociation; Avoir pour objectif dapporter de nouvelles activits, daccroitre les revenus des populations et de combattre les discriminationsetlapauvretauniveaulocaletrgional; Crerlemploi, prsenterdesrsultatsconcretscontribuantau dveloppementdesfiliresdesproduitsduterroiretmaintenir lavaleurajoutedanslargion;

1.

2.

3.

4.

Le projet doit figurer dans lune des six filires suivantes: Figues de barbarie, datte, Argan, safran, roseetmiel; Un projet prsentant une innovation dans la production, la transformation, la valorisation et la commercialisationdecessixproduitsduterroir; Un projet structurant permettant de regrouper les diffrents intervenants de la filire dans une structurefdratricepourunemeilleureorganisation et intgration de la filire qui permettra de bien rpartirlesrichessesetmargesgnres; Un projet de valorisation de ces produits de terroir pour une plus value dont profitera la population locale;

Lesappelsprcisentgalementquelesporteursduprojetdoiventtreuneentitconomique(cooprative,groupement dintrtconomique,entreprise)ouuneassociationexerantuneactivitpouvantcontribueraudveloppementdela filireetayantsonsigeetlelieuderalisationdesonprojetdanslargionSoussMassaDraa; LacontributionfinancireoctroyeparAgrotechestproportionnelleaumontantglobalselonlagrillesuivante: Unmaximumde70%pourlesprojetsdontlecottotalnedpassepas200.000,00dirhams; Un maximum de 50% pour les projets dont le cot total est compris entre 200.000,00 et 400.000,00 dirhams Un maximum de 30% pour les projets dont le cot total est suprieur 400.000,00 dirhams avec un plafond de subvention 300.000,00 dirhams. Encadr18:RalisationdelAgrotechdanslefinancementdesprojetsdevalorisation DanslecadredelastratgiededveloppementetdevalorisationdesproduitsdeterroirdelargionSouss MassaDra,leConseilRgionalSMDaoctroylassociationAgrotechunfondsde9millionsdedirhamspour lappuiauxprojetsdedveloppementetdevalorisationdesfiliresdesproduitsdeterroir(Arganier,Figuier debarbarie,Safran,Palmierdattier,MieletRose)enmatiredelatransformation,leconditionnementetla commercialisation,etceuxvisantlarestructurationdecesfilires. Entrejanvier2008etmars2009,troisappelsprojetsonttlancspourlescooprativesetlessocits.Sur un total de 143 projets reus 57 ont t slectionns sur la base de critre arrts par lAssociation. Lenveloppefinancireallouecesprojetsestde8,3Millionsdedirhamscequiapermisuninvestissement global de 21,9 Millions de dirhams et la cration de 464 postes de travail. La rpartition par filire et par provinceestillustreparlesfigurescidessous.

64

STRUCTURATIONETMOBILISATIONDESFONDS LamobilisationdesressourceshumainesetfinancirestaitlunedespremiresactionsengageparleCRSMDdansle plan de mise en uvre. A partir de lexercice 20062007 et pour la premire fois dans lhistoire de la Rgion, un fond propre dun montant de 9 millions de DH a t accord lAssociation Agrotech pour raliser son programme de dveloppement. Des fonds supplmentaires ont t mobiliss dans le cadre des programmes de collaboration entre le MarocetlUnionEuropennedunepartetlaRgionetcertainesDpartementsetRgionsfranaisesdanslecadredela cooprationdcentralise. LeCRSMDsestdotgalementdunecelluletechniqueresponsabledusuividesprogrammesdevalorisationnotamment lamiseenplacedesIndicationsgographiques.LepersonnelmobilisdansleCRSMestcomposdecadresrecrutspar leCRSMDoumobilispartirdautredpartementsnotammentlaWilaya. ROLEDELACOOPERATIONINTERNATIONALE Le CRSMD sest engag depuis 2006 dans des programmes de coopration internationale avec plusieurs partenaires (UnionEuropenne,FranceetEspagne).Lobjectiftantdemettreprofitlexpriencedespaysvoisinsdanslamiseen uvredesprogrammesdedveloppementconomiquesetnotammentdansledomainedelavalorisationdeproduisde terroirs. LacooprationdcentraliseaveclaRgiondAquitaineatlanceen2006danslecadredelacooprationmaroco franaise,"Programmed'AppuilaDcentralisationauMaroc,PAD",pourunmontantde175000Euros.Leprogramme delacooprationaportsurlaprparationdecahiersdecharge,lasensibilisation,laformationetlamiseenpacede lIG.LacooprationentrelAquitaineetleCRSMDserasoutenueen2010parunfinancementeuropende145000Euros danslecadreduprogrammeEuropAid.Cenouveauprojetintitul"Projetintgrdelamiseenuvredel'IGPArgane", apourobjectifderenforcerlamiseenplacedelIG.

65

4.L E XP E R IE N C E D E L A R E G I ON D AN S L A M I S E E N P L A C E D E S L A B E L S D E Q U A L IT E
INTRODUCTION Leconceptdecertificationetdelabellisationatintroduitdanslargionen2000parlesproducteursexportateursde fruits et lgumes qui taient contraints renforcer les mesures sanitaires et hyginiques par ladoption des divers systmesdecertificationcommeleGlobgap,leBRC,leNatureschoiceetc.Cettedynamiquedevalorisationparlebiais de la certification des procdures de productions et de fabrication navait cependant pas touch les produits de lagricultureextensivedunefaongnraleetcellesdesproductionsdeterroirsadunefaonparticulire,vuqueces productionssontdestinesessentiellementaumarchlocalquinestpasaussiexigententermedequalitquelamarch europen. Lautre handicap, cest que les systmes prcits coutent cherset ncessitent la mise en place et la gestion dunsystmedecollectedinformationtropcompliqupourdespetitsagriculteurspeuoupasorganissetquisonten majoritdesanalphabtes. L E C A S D E L IG PA R G A N E Lhuile dargane est produite dans les valles et montagnes de SoussMassa et celle Chiadma (Province dEssaouira) depuisle9mesicle 17 .Inspir desprocdsdextractiondelhuiledolive,lesusagersdelaforetde larganieravaient dveloppunprocdetunsavoirfairelocaltypiquesquiontfaitdecettehuileunproduitlocalprofondmentancr dans la culture des communauts qui peuplent laire dextension de larganier qui stend surune superficie denviron 830000 Ha couvrant 6 provinces (Tiznit, Taroudant, ChtoukaAitBaha, InezganeAit melloul, Agadir Idaoutanane et Essaouira) 18 . Lide de dvelopper une IGP pour lhuile dargane a t aborde ds 2004 loccasion des assises de lOrganisation OriGintenueAlicanteEspagne 19 .LeCRSMDsestofficiellementsaisidudossieren2006enpartenariatavecleConseil RgionaldAquitaine 20 etdelaFdrationRgionaledesCooprativesAgricolesdAquitaine.Cettecooprationajouun rledterminantdanslaprparationducahierducharge,lastructurationdelafilirearganeetlamiseenplacedelIGP. Leffort a culmin par la cration en janvier 2008 de lAssociation Marocaine de lIndication Gographique de lHuile dArgane(AMIGHA)quisrigeacommegroupementinterprofessionnelporteurduprojet.AMIGHAprocdaaudptla demande de reconnaissance auprs des instances officielles en janvier 2009 pour avoir la reconnaissance officielle en Avril 2009. La coopration avec lAquitaine a permis galement daider la cration dun organisme de certification marocainetsonaccrditationparunorganismefranais(LeCOFRAG). Encadr19:LAssociationMarocainepourlindication GographiquedelHuiledArganeAMIGHA

Cre le 26 janvier 2008 Agadir linitiative du LesmembresfondateursdelAssociation: Conseil Rgional du Souss Massa Dra, Amigha Le Conseil Rgional Sous Massa Dra concrtise la volont de lensemble des LUnion des coopratives Fminine de production partenaires de la filire huile dARGANE ainsi que dArgane (UCFA) le travail de rflexion et de concertation de Le groupement dintrt conomique Argan lindication gographique protg (IGP) ARGANE NTaroudant (GIE AragnN Taroudant) avec lappui de la coopration (PAD) entre la
17 18

Kenny.L.2008.Histoiredelarganier.In.Atlasdelarganieretdelarganeraie.Pp:1336.IAVHassanII. Cettesuperficietaitjadisdenviron1,5millionsdhectare.UnecinquantainedhectaresetrouvegalementdanslargiondOujdaetdespieds ProfZoubidaCharoufdelUniversitMohammedVtaitlunedespremirespersonnessouleverlaquestiondabordauprsduMinistrede Lesdeuxrgionstaientdjenpartenariatdejumelagedepuis2005.

parpillsdanslesrgionsdeSafi,RabatetKhemisset.
19

lAgricultureetensuiteauprsduConseilRgionalduSoussMassaDraa.
20

66

rgion Souss Massa Dra et la rgion dAquitaine (France). Elle a pour mission de faire reconnaitre etdemettreenuvrelIGPARGANEdanslecadre de la loi 25/06 relative aux signes distinctifs dorigineetdequalit(SDOQ). Cesobjectifssont: De protger le nom dARGANE ; De valoriser le produit et le savoir faire ; Dfendre les intrts des producteurs ; Une meilleure organisation de la filire.amigha.org

Le groupement dintrt conomique Targanine (GIE Targanine) Le groupement dintrt conomique Vitargane (GIE Vitargane) Association Nationale des Coopratives dArgane (ANCA) Le groupement dintrt conomique Tizargane (GIE Tizargane) Le collge des Industriels, reprsent par les entreprises suivantes : Les Aromes du Maroc (SA) Abondance et simplicit Maroc, ABSIM (SARL) Les laboratoires Azbane (SA) Entreprise fminine rurale de lconomie sociale EFAS (SARL) Les Huileries du Souss (SARL)

LexprienceduCRSMDdanslecasdelIGPArganeestinstructiveplusduntitre:

Elleadabordactivlaprparationetlapublicationofficielledelaloimarocaine25/06surlesSDOQquinavule
jourquenjanvier2008.En fait,lundesobstaclesquiseposaitladoptiondecetypedelabelsauMaroctait labsencedunerglementationnationaleenlamatire 21 ;

LamiseenplacedelIGPaeuunimpact considrabledanslastructurationdelafiliredanslamesureoellea
pu mobiliser plus de 2500 femmes adhrentes 56 cooprative regroupes en 4 Groupements dIntrt Economiqueetenuneuniondecooprative,letoutchapotdanslAMIGHA(Encadrno19).

Lemouvementcoopratifdanslargionaconnuunprogrsnotabledepuislelancementdeladynamiquede
lIGP.Commelemontrelafigureplushaut,entre2005et2008,lenombredecooprativesfmininesestpass de39150;

Ladhsiondescommerants,desindustrielsetdesexportateurslAMIGHAarenforclepouvoirngociateur
etdelAssociationvisvisdesinstancespubliquesetdesmarchs;

LamiseenplacedessystmesdetraabilitetdecontrledequalitdanslecadredelamiseenuvredelIGP
arenforcleseffortsdamliorationdelaqualitdeshuilesproduitesetcommercialiss.Enfait,lamiseenplace delIGarganeatloccasiondellaborationdunguidedebonnepratiquedextractionetdelhuiledargane etdunplandecontrledesprescriptionducahierdecharge.

IncitationetencouragementdelacrationdesocitnationalespcialisedanslacertificationIG.Lorganisme
decontrleataccrditparunorganismefranais(COFRAG)

ParmilesbnficiairesdelIGP,onconstatelexistencede cooprativesimplantesdanslaprovincedEssaouira
quifaitpartiedelaRgiondeMarrakechTensiftHaouz.Lesoprateursdelafilireimplantsdanslaprovince dEssaouiraparticipentetcollaborentaveclesoprateursdesautresrgionsrelevantdelargionSMD.Cecas de figure montre limportance de lIG comme outil de dveloppement territorial qui transcende le dcoupage administratifetquipeutouvrirdesperspectivesdecollaborationetdepartenariatsinterrgions.
21

Laprparationetladoptiondelaloi25/06surlesSignesDistinctifsdeQualitonttaccompliesenuntempsrecord(moinsde2ans).Lefaitquele 67

MinistredelAgricultureoccupaitenmmetempslepostduPrsidentdelargionavaitindniablementfacilitlaprocdure.

Encadr20.Organisationdelafiliredescooprativesfmininesdelargane

Figure6:EvolutiondescooprativesdanslaRgiondeSoussMassaDraaentre1998et2008

LexprienceduSMD,quienestencoresesdbuts,amontrquelamiseenplacedelIGetlappropriationduprojet parlesbnficiairesestunetachedelonguehaleinequincessiteunappuicontinuetsoutenudelapartdestructures publiques nationales et rgionales. Lintgration du label dans les systmes de productions et de commercialisation ncessite un effort soutenu en termes de sensibilisation, de formation et daccompagnement technique et organisationnel. Entre avril 2009, datte de la reconnaissance officielle de lIGP argane, et avril 2010, seulement 4 cooprativesparmiles56membresdAmighaontpumettreenplaceetrespectelesexigencesduplandecontrolede lIGP.LenouveauprojetentrelUnioneuropenneetleCRSMDenpartenariataveclaRgiondelAquitainementionnci hautapourobjectifdegnraliserlappropriationduprojetparlesbnficiairesetdacclrerlacadencedecertification descooprativesmembresdAmigha.

68

Pour les quelques coopratives qui sont habilites faire usage du label IG, les questions poses actuellement sont relativeslimpactconomique,commercialetcologiquedecelabel.Desquestionstrslgitimesmaispourlesquellesil estcertainementtropttpouryapporterdesrponses. L E C A S D E L A O PS A F R A N Le safran est lune des cultures traditionnelles les plus anciennes de la Rgion. Son introduction dans la commune de Taliouine remonte au 17me sicle. Elle est actuellement rpandue sur une superficie denviron 400 Ha dans 14 communes rurales reprsentant deux cercles (Taliouine et Taznakhte). La production du safran marocain repose sur le principedelatransmissionintergnrationnelledelapropritdessolscultivs,desdroits(etdesdevoirs)dirrigation correspondants,dumatriauvgtal(bulbesdeCrocussativusconsidrscommeuncapitalfamilial)etdusavoirfaire (perucommeuncapitaldexprience).Cettetransmissionsopredeuxniveauxtroitementlis:lchelledechaque familledeproducteursetlchelledechaquedouardessitesdeproduction.Sagissantdunavoircollectif(etnondune possession individuelle), elle sorganise dune faon codifie et tient compte des usages en vigueur au sein des divers lignagesquiconformentlapopulationdunterroirpaysan. LessafraneraiesdeTaliouinecouvrentunesuperficiede650harpartissurplusde3000parcellesetexploitespar1.370 producteurs.Laproductionannuelleestestime3tonnescequireprsentepeine1%delaproductionmondiale(250 t), largement domine par lIran (200 tonnes /an). le safran de Taliouine a cependant une excellente rputation 22 lchelleinternationaleenraisondesaforteteneurensafranal,uncompossecondaireresponsabledelasaveur . Surleplanconomie,laventedusafrancontribue80%auxrevenusdesfamillesruralesquilecultivent.Cependant,la filiretoutentirechappeauxproducteursetsetrouveentrelesmainsdengociantsexportateurs.Toutrcemment, destentativesdefraudesetdefalsificationonttenregistresltrangeretdansplusieursvillesduMaroc 23 . VulimportancedusafranentantqueproduitdeterroirtypiqueetaprslesuccsdelIGPArgane,leCRSMDavaitlanc lAOPdusafranaveccommeobjectifsstratgiques: ProtgerlesafrandeTaliouinedesusurpationsetfraudes; Maintenirlaplusvalueraliseparlesventesdusafransurlemarchnationaletinternationaldanslesrgions deproduction; Renforcerlepositionnementdusafranmarocainsurlemarchinternationalvulaforteconcurrenceimposepar lIranetdautrespaysasiatiques; Amliorerlestatutdelafemmedansles rgionsdeTaliouineetTaznakhtenlimpliquantdanslebusinessdu safranet; Renforcerlancragedusafrandansleshabitudesetmursdelargion,

LeprojetdemiseenplacedelAOPsafranatmontencollaborationavecuneinstitutiontatique(OfficeRgionalde MiseenValeurAgricoledOurzazate),uneorganisationinternationale(OrganisationMondialedelAlimentationFAO) etuneorganisationnongouvernementale(AssociationMigration&Dveloppement).Lesquatreinstitutionscollaborent danslecadredunprojetFAO24 dansllaborationducahierdecharge,lasensibilisationetlaformationetlorganisation delafilire. La dmarche suivie, depuis le lancement du projet en avril 2008, consistait mener des campagnes de sensibilisation auprs des producteurs du safran dans toutes les communes relevant des deux cercles de Taliouine et Taznakht en parallle avec la collecte de donnes techniques, agronomiques, historiques et sociologique sur la production, la
22
23

LateneurdusafrandeTaliouineensafranalestdenviron3040contre1520pourlesafrandespaysconcurrents.

lesaltrationsetfraudesontdiversesetpeuventcomporterlacolorationdelapartiestylaire,lajoutdesproduitstrangers(filamentsdelaviande

schedupouletetcolorsenrouge),ladjonctiondesrestesfloraux(styleettamines),lajoutdeproduitschimiquespouraugmenterlepoids(Sels, sucreglac,huilevgtaleetc.),lajoutdesstigmatesducarthame,lesouci,oulesbarbesdemas.
24

ProjetFAO/TCP/MOR/3201,RenforcementdescapacitslocalespourdvelopperlesproduitsdequalitdemontagneCasdusafran

69

commercialisationetlesusagesdusafran.Lecahierdechargeatlaborpartirdesdonnesdtudesetdexpertises menesdanslecadreduprojetFAO 25 . Enattendantlaconstitutionduneentitprofessionnellergionale,leCRSMDsestportporteurduprojetet adecefait accompli toute les dmarches administratives pour la demande de lAOP safran qui a t accepte par la commission nationaleenavril2010. Bien que rcente, la dynamique de valorisation par le biais de la labellisation lance par le CRSMD, lamlioration du conditionnement et de lemballage lancs par les producteurs et commerants et la communication par lorganisation dun festival annuel spcialement ddi au produit a permis damliorer considrablement la commercialisation de lpicedanslesprixsontpassdemoinsde10000dhleKgplusde25000dhen2009commelemontrelafigureci aprs. Figure6:EvolutionduPrixdusafranPrixProducteurSouldeTaliouine(19912009)

5. C O N C L U S I O N
LactionpionniredelaRgiondeSoussMassaDraadansladoptionetlamiseen uvredunepolitiquergionalede valorisationetdveloppementdesproduitsdeterroirsestsuivieparbonnombredobservateursetdedveloppeursau Marocetltranger.Lapprocheadopteestsusceptibledinsufflerunedynamiquenouvelledanslacollaborationetle partenariatnonseulemententrelesorganismespublicsetleprivmaisaussientrelesorganismespublicseuxmmeset entrecesderniersetlesorganisationsnongouvernementales(coopratives,associationetc.).Lesretombesetlesleons dunetellevisionneserontpasseulementdordresconomiques,sociauxetcologiquesmaisaussipolitiques.LeSouss MassaDraa semble ainsi sriger comme le laboratoire national pour le grand projet de rgionalisation dune faon gnraleetdudveloppementagricoledunefaonparticulire.

25

LaFAOaralispourlecomptedelORMVAOquatretudesdanscesens:unetudedulesaspectsagronomiques,unesecondesurlabiodiversit

associeausafraneraies,unetroisimesurleconditionnementetlesmanipulationsdepostrcoledusafranetunequatrimesurlesaspects sociologiques.

70

VI. L ES TERROIRS POUR UN M AROC ET UNE M EDITERRANEE DURABLES : UNE LECTURE CROISEE DES EXPERIENCES DU M AROCET DELA F RANCE

1. D E S H O M M E S D E P R O G R E S , D E N O U V E L L E S V I S I O N S P O U R L A P E T IT E A G R I C UL T U R E , E T P O U R L E S M O N T A G N E S , O A S I S E T Z O N E S A R I D E S
PERSONNESDEPROGRESETNOUVELLESVISIONS QuecesoitauMarocouenFrance,lexpriencemontrequelenclenchementdesnouvellesdynamiquesdeterroirstient toujours quelques personnes de progrs, acteurs de terrain, qui ont su se donner de nouvelles visions pour leur territoire. Cest vrai des ex prsident du Conseil rgional Souss Massa Draa, directeurs des DPA dEssaouira et de Chefchaouen,commedudirecteurdelAgenceduSud,etdesprsidentsdelacooprativeJeunemontagneenAubrac oudescooperativesdeTaliouineetdeTyoutChiadma. Tous,leursniveauxrespectifs,onttlcoutedeleurterritoireetilsontsuimpulserunmouvementcollectif,souvent avecdesmoyenslimits. Cesnouvellesvisionsseforgentgalementchezdeshommesdesciencequicontribuentalimenterledbatdideset aider la dcision publique. Leur engagement travers la rflexion prospective, lanalyse stratgique, lanalyse internationale compare (le benchmark), les nouvelles ouvertures proposes par la recherche, sont le complment ncessairedelengagementsurleterrain. Le retournement de vision est dune importance fondamentale pour lavenir du Maroc, pays qui doit passer dune agriculturedualeuneagricultureplurielle.Ilinviteeneffetunchangementderegardsurlapetiteagricultureetsurles montagnes. Il justifie ainsi le nouveau cap fix par le Plan Maroc Vert, c'estdire celui du million dentreprises agricolesquisuccdeainsiceluidumilliondhectaresirrigus.Lesmontagnesetlapetiteagriculture,invites entrerdansunepostmodernit,celledunenouvelleagricultureetdunenouvelleruralit,nedoiventdonc plustreconsidresdabordcommedeszonesderefugeoudagriculturesociale. L E M A R O C A U N T O U R N A N T H I S T O R I Q U E , L A N E C E S S A I R E C O N S O L I D A T I O N D E S A C Q U I S Commelontremarqupplusieursintervenants,larichessedescontributionsauSminairedu10marsamontrquelon est aujourdhui un tournant, un moment daboutissement de toute une srie de rflexions et dactions qui demeurentencoreisolesmaisquiformentunensemblededmarchesquicommencentrendrevisibleslesmontagnes, lesoasisetleszonesdagriculturesche.Touscesespaces,bienqueregroupantles4/5medespopulationsagricoleset rurales,taientjusquprsenteneffetinvisibles. Ilsagitdoncdunervolutionsilencieusedontonnemesurepasencorelimpactetdontlaboutissementnestpassr. Eneffet,lactiondequelqueslocomotivespolitiques,intellectuelles,administrativesouprofessionnelles,nepeutsuffire intgrer toute la population potentiellement concerne dans un processus de dveloppement global. La priorit essentielle doit donc devenir la consolidation des acquis, ceuxci ne restant ni visibles ni gnraliss dans lesprit des gens. Lexpriencefranaisemontredailleursquedesterritoiresdemontagnemditerranennesche,toutfaitcomparables ilya50ans,ontconnuensuitedestrajectoirestrsdiffrentes.Victimesdetoutesformesdrosions,desmontagnesont perduvie,patrimoineetnergie.Lexoderuraletladpriseagricoleenontfaitdesespacesendshrence,laisssaux broussaillesetauxincendies,etlachargedelasolidaritnationale.Inversement,dautresterritoires,entranspardes hommesdevision,ontrussileurrenouveaurural. 71

2. L A C O M P L E X I T E E T L A D I V E R S I T E D E S O B J E C T I F S , POSSIBLES
DENOUVELLESPRISESDECONSCIENCE

D E S Q U E S T I O N S E T D E S R E P O N S E S

Lesexemplesmarocainscitsplushautmontrentquelesnouvellesdynamiquesobservessurleterraintrouventsouvent leuroriginedansunedoubleprisedeconscience:celledelimpassecologiqueetcelledupotentieldeprogrspossibles. Laquestiondeleauestcentraledanslaprisedeconscience.CestellequiimposeparexempleauSoussMassaDraaune nouvellevisiondedveloppement.Danscettenouvellevision,lesproduitsdeterroirsontdautantplusleurplaceque, nsbienavantlesgrandsamnagementshydrauliques,ilssontadaptslcosystmeetdeplusenplusdemandsparle marchpourleurvaleurmultifonctionnelle.DansleSudtunisien,cestaussilaprisedeconsciencedelaquestioncentrale desressourcesnaturellesquiconduitaunouveauregardsurlescommunautstribalesetsurleurrlepossibledansla restaurationdelcosystme. Laprisedeconsciencedelavaleurpotentielledesproduitsdeterroirsestlautredclencheurdelanouvellevision.Le produitdeterroir,demandparlemarchgrcesarputationetsaqualit,peutpermettreunecrationimportante devaleurajoute.Leprogrspotentielestconsidrablecommelemontrelvolutionrcenteduprixdusafranpayau producteur. En effet, la valeur ajoute des produits forte notorit comme lhuile dargan et le safran de Taliouine, chappepourlessentielaupays.Bienvaloriss,lesautresproduitspourraientacqurirleurtouruneforterputationet permettredesprogrsderevenussignificatifs.Lesnouvellesvaleurs,sensorielles,motionnelles,culturelles,esthtiques etthiquespeuventfairelamoitiduprix. Grce la reconnaissance de lorigine comme un bien public et aux synergies positives qui se crent entre les diffrents produits et services, la nouvelle conomie de terroir, condition de ne pas senfermer dans une approche simplisteetrductricedequelquesfiliresdeproduitsIG,peutpermettredegnrernonpasseulementdelavaleur ajoutecaptablelocalementmaisaussidelquit,delarsilienceetungaincollectifmajor.Danslconomiedeterroir, grceaupaniersdebiensetdeservices,1+1fonteneffetbeaucoupplusque2. Lesterroirsensadressanttouteslesdimensionsdeladurabilitlaculture,lconomieetledveloppement,lquit, lesquilibresurbain/rural,latransmissiondessavoirs,lescosystmessontdoncunsujetaucurdesnouveauxdfis mondiaux.Ilsinvitentdenouvelleslecturesetdenouvellesapprochesscientifiques,ycomprisauplandelconomie oilssupposentdesanalysesdetypemsoconomique. UN E D I V E R S I T E D A T T E N T E S E T D O B J E C T I F S , U N E N J E U D E D E V E L O P P E M E N T D U R A B L E LesmotifsvoqusparleurspromoteurspourlamiseenplacedIGauMarocconfirmentunegrandediversitdattentes. Ilssontrvlateursdelacomplexitetdeladiversitpossibledesquestionsetdesenjeuxetdescontributionspossibles desterroirsaudveloppementdurable.Sixgrandstypesdobjectifssonteneffetvoqus. La lutte contre lusurpation et contre les fraudes. Ce motif a souvent t en France la premire raison de la demandedereconnaissanceenIG.IlestnotammentinvoquauMarocdanslescasdelaclmentinedeBerkane etdelhuiledargan,produitsquiontdjacquisuneforterputation.PourlArgane,ilsagitlafoisdelutter contre lusurpation et de permettre aux acteurs de la rserve de biosphre de se rapproprier le nom et la notoritduproduit. Lastructurationdelafilireetlapromotiondedmarchescollectivesdevalorisationetdemiseenmarch.Ce motif est clairement exprim pour lIGP Argane et il a justifi la cration dAMIGHA, organe de dfense et de gestionquiregroupelensembledescooprativesetuncollgedindustriels.LAOPTyoutChiadmaataussi loriginedunestructurationprofessionnellepuisquesonlaborationaconduitlacrationdelacooprative. OnpeutendireautantdanslecasdelAubracpourlecasdufromagedeLaguiole. Larussitedanscedomainenevacependantpasdesoietpeutprendredutemps.LecasdusafrandeTaliouine lemontre:ladynamiquedevalorisationapermislacrationdepetitescooprativesfortedisciplinecollective, 72

maislessentielrestefaire.EtlimpulsiondonneparlargionpourlamiseenplacedelAOPvadevoirtrouver satraductiondansuneorganisationprofessionnelleinclusive.Lexpriencefranaiseconfirmedesonctquele succs ncessite des organes de dfense et de gestion (ODG) trs bien structurs et agissant dans la dure: lobtentionduneIGPouAOPnestquunetape. Linformation duconsommateur.Lapolitiquedoriginepermetdapporterauxconsommateursdesgarantiesde traabilit et dorigine, et donc aussi des garanties sur des modes de production spcifiques et une certaine authenticit,qualitetquit.CemotifestclairementmisenavantdanslescasdelaclmentinedeBerkane,de lIGPArgane,duchevreaudelarganier.Ilvautenfaitpourtouslesproduits. Le dveloppement rural et le dveloppement local, la fixation sur le territoire de la valeur ajoute, laugmentationdesrevenusdescommunautslocalesetlasortiedelapauvret.Cetobjectifvientengnral enttedetousceuxaffichspourlesproduitsduPilierIIduPlanMarocVert.CestlecasnotammentpourlIGP Argane, les AOP Tyout Chiadma et safran de Taliouine, ainsi que pour les projets dIGP ou dAOP relatifs aux chevreauxdarganier,lagneauBeniGuil,ladatteAziza.Cestaussilemotifpremierdetouslespetitsprojets devalorisationlocaledesnouveauxproduitsbasedecactusoudedattesmollesdveloppsaveclappuide lINRAparlAgenceduSud,lOfficergionaldemiseenvaleuragricoleduTafilaletetlaplateformeAgrotecdu SoussMassaDraa. La valorisation des produits de terroirs et de lorigine reprsente donc pour le pays un outil essentiel de dveloppementruraletdesortiedelapauvret.Cetobjectifdevraitinviterdonnerunegrandeattentionla question de la valorisation des ovins et caprins de parcours qui font vivre des millions de personnes et permettentdesproduitsdehautequalit.LesdmarchesencoursrelativeslagneauBeniGuiletauchevreau darganiersontdoncimportantes. Laprservationdesparcoursetlagestiondurabledesressourcesnaturelles.Cetobjectifestclairementaffich parlesprojetsdIGPviandedagneauBeniGuiletchevreaudarganier.Lacontributionpossibledesindications gographiques une restauration et une gestion durable et responsabilise des parcours, est une question dimportance centrale pour tout le Sud et lEst mditerranen. Elle mrite une grande attention et le soutien dunerecherche/actionmultidisciplinaire. Laconservationetlapromotiondupatrimoinedesterroirs:sessavoirfaire,lespaysages,labiodiversit.Ce motif,affichpourlaclmentinedeBerkane,ladatteAzizaetlhuiledeTyoutChiadma,estgalementimportant pourtouslesautresproduits.LIGPArganemetenavantlenjeudelaprservationdelabiodiversitdusystme arganeraie.

LesapprochesterroirstellesquactuellementimpulsessurChefchaouenvoientencorepluslarge.Partantduterritoireet nonduproduit,ellesinvitentladcouverteducahierderessourcesterritorialdanstoutesadiversit,ycomprispar exemplelepatrimoineculinairelocal.Ellespermettentaussiunerencontredesacteurs,notammentdelagriculture,du tourismeetdelartisanat,autourdunenouvellevisionterritorialepouraidergnrerundveloppementpluscohrent autourduconceptdepanierdebiensetdeservices. Les attentes lies aux terroirs et lorigine sont donc nombreuses et peuvent inviter en faire les moteurs dune agriculture,dunpastoralismeetdundveloppementterritorialdurablesdanslesterritoiresquipeuventlejustifier. LACOMPLEXITEETLANECESSITEDAPPRENTISSAGE Lesterroirsetloriginervlenttouteunecomplexitdenjeux,dequestionsetderponsespossibles.Ilnyapasen effetdesolutionstoutesfaites!Chaquecasestcomplexeetinviteunerponseappropriequiseconstruitetstoffe dans la dure. A travers les produits, les terroirs sont aussi des hommes, et des savoirs spcifiquesdans les modes de gestion,deproductionetdeconsommation.Lestechniquesmisesenuvreontdoncunfortcontenucultureletsocialet laquestiondupartagedessavoirsetcelledeleurtransmissionauxgnrationssuccessivespeuventetgagnenttoujours treposes. La rponse une situation donne pour tre pertinente, doit ainsi intgrer la notion du temps en y intgrant les changementspossibles.Letempsesteneffetuneconditionderussitedeladmarche.LesdmarchespourlIGPArgane etpourlAOPTyoutChiadmaonttlongues.Letempsconsacrapermisuneappropriation,ilestungagedusuccs. 73

Larflexionetlactionsurlesterroirsdoiventaussiintgrerlespossibilitsdechangementsglobaux.Notresiclevaen effettremarquparlescrisescologiques(changementclimatique,rarfactiondeleau),nergtiquesetalimentaires. Lamontedesrisquessystmiquesimposedebienmesurertoutelavaleurdesgisementsdesavoirscontenusdans les terroirs qui sont autant de grandes richesses que lon aurait tort de laisser de ct. Les savoirs relatifs au commentonconduitdesanimauxdansunmilieutrshostilequimanquedeauvontparexempletreprcieuxpour notreavenir.Lesavoirfaireesticiinsparabledessavoirsrelationnels:quiaaccslaressource,commentonlarpartit, commentongre?LesacquisduprojetagropastoraldelaTunisieduSudEstsontcetgardprcieux.Leprojetnous montrequelessavoirstraditionnelsnesontpasforcmentperdusetquilsgardenttouteleurvaleurpourpeuquede nouvellesapprochesdeprojets,semettantlcouterelledulocal,soprent. Lespolitiquesdeterroirsinvitentainsilacomprhensiondesrelationstrsintimesquisesonttabliesavecletemps entre les populations et les milieux naturels et crer de nouveaux ponts entre les sagesses anciennes menaces de disparitionmaistoujoursvivantesetladministrationpourfairefaceauxnouveauxdfisdeladurabilit.Ilnesagit pasiciquedereconnatredessavoirsetdessagessesanciennescarlescommunautsetleursrelationsauxressources onttfragilisesparlesvolutionsmodernes.Lesacteurstantdevenushtrognes,denouvellesrglesdoiventtre construitesetlautoritpubliqueadoncaujourdhuiunrleessentieljouer. Lesdiffrentesdmarchesetactivitssurunterroirdonnpeuventaussiposerlaquestiondeleurcomptabilitavecla conservationetlavalorisationlongtermedesressourcescollectivesetdesquilibressociauxquienrsultent.Dsque loninitieunedynamique,queloncreungroupe,etquelonreconnatunproduit,onexclueaussi.ReconnatrelIGP Argane va favoriser les femmes rurales mais lcosystme est aussi fait dhommes et de produits animaux trs forte typicit.Quellevoiepeutalorstrechoisiepourunprogrsgagnant/gagnantauprofitdetous(lesfemmes,leshommes etlcosystme)? Les approches terroirs invitent par consquent prendre en compte la complexit des questions et innover dans la recherchederponsesappropriespourrussirdesjeuxdetypegagnant/gagnant.Lesrservesdebiosphre,qui,au Maroc, sont particulirement importantes puisquelles recouvrent toute larganeraie, les oasis du Sud et une grande partieduRifdevraientavoirvocationdevenirleslieuxprivilgisdecesnouvellesrecherches. Laquestionseposeaussiauniveaudechaquecahierdescharges:endcidantcecietpascela,questcequonperdet questcequongagne?Quefaitondes133varitsdefiguesdeChefchaouen?EnArdcheetenCvenneslechoixa t fait de slectionner un certain nombre de varits locales. La question des groupes humains, de leurs tailles et contours,desrisquesdexclusion,estdonctoujourspose. La dmarche terroirs invite par consquent de lapprentissage: comment on se comprend, comment construire des accordsentrenous?Ellepeutainsijustifierdemobiliserdesexpertisesenaccompagnementetenamontdelagestionde projetspouraiderladcisionpublique.Lancessitdelapprentissagepourraitinviterreconsidrer,parexempletous les5ans,lesIGmisesenplace.

3. L I M P O R T AN C E

D U P A R T E N A R I A T I N T E L L E C T U E L DECENTRALISEEENTRELEMAROCETLAFRANCE

ET

DE

LA

COOPERATION

LescooprationsfrancomarocainesengagescesderniresannessurlePilierIIduPlanMarocVertetsurlesterroirs sontconsidrescommeextrmementimportantes.Ellesonteneffetaiddynamiserunerflexionsurunethmatique dlaissedepuislongtempsetleMarocserattrapersurleszonesmarginales. L I M P O R T A N C E D U P A R T E N A R I A T I N T E L L E C T U E L Coupler partenariat et intellectuel permet dintroduire la complexit. Cest important car dans le pass, on sest trop content de vouloir appliquer dans les projets des techniques toutes faites et trs simples et qui nont pas march. Lchec sexplique par le fait que lon a trop pens techniques, produits et filires et pas assez les hommes, leur organisation collective et les territoires et cosystmes. Il rsulte galement de la discontinuit dans la rflexionetdanslactionetdelabsencedecapitalisationetdaccumulation.

74

CouplerpartenariatetintellectuelestparticulirementimportantsagissantdelarflexionsurlePilierIIduPlan MarocVertetdelapolitiquedeterroirs.LexpriencedelINAOatfortutileauMarocpourllaborationdesaloisur lessignesdistinctifsdorigineetdequalit.LeMarocabiensutirerprofitdesexpriencesaccumulesenEuropetouten innovantpourtenircompteducontextenational:lanouvelleloiestdevenueunfacteurdclenchantdcisifdeprogrs pourlepays. Lesrflexionspartagesentreles2ConseilsrelativesauPilier2duPlanMarocVertontaussitimportantescarelles ontmontrlacomplexitdesenjeuxetdesrformesetellesontpuaiderleMarocprcisersadoctrinedaction. Tout ce qui prcde dmontre par ailleurs la complexit des terroirs, des approches, des produits. La rflexion prospective sur les dfis et sur les politiques, et celles sur le comment de la mise en uvre des politiques et les approches,surlesmthodologiesdesprojetsetdesformations,surlecontenudonnerauxcahiersdescharges,etc., doiventainsisimprgnerdecettecomplexitetdesexpriencesdeterrainpourvenirutilementaiderladcisionet accompagnerefficacementlaction. LesdeuxConseilsgnraux(CGDAetCGAAER)doiventainsipouvoircontinuerjouerunrledeplateformecapables de mobiliser des experts et acteurs des 2 pays pour des analyses partages qui ne se limitent pas au dveloppement agricolestrictosensumaisrestentouvertessurlesquestionsdalimentation,deterritoires,dedveloppementruraletde gestiondesressourcesnaturelles.Etlesdiversesinstitutionsqualifies,notammentlefuturcentrederessourcesduPilier II(CRP2),lINAO,laCommissionnationaledessignesdorigineetdequalit,lesdirectionscentralesdesdeuxministres etlesdiffrentsorganismesderechercheetdeformationpouvoirapporterleurcontribution. ETDELACOOPERATIONDECENTRALISEE Les dernires annes montrent aussi limportance stratgique de cooprations dcentralises bien conduites. Les cooprationsentrelesrgionsChampagneArdenneetOrientaletentreAquitaineetSoussMassaDraaontnotamment permis ltablissement de la confiance rciproque et elles ont obtenu des rsultats tangibles et apprciables. Celles intressantlargionTangerTtouanetProvenceAlpesCtedAzurnesontpasmoinsimportantescarellessmentdes grainesimportantespourlefuturdansunedirectionfondamentale:celledupanierdebiensetdeservices. Leursuccstientbeaucoupladure,lasouplesseetlapossibilitdemettreenrapportdesacteursdeterraindes2 paysenfonctiondesbesoinseffectivementressentis.Ellespermettenteneffetdemobiliserentantquedebesoindes professionnelsouorganisationsprofessionnellesdes2pays(lexempledelafdrationdescooprativesdAquitaine); des lus; des centres de formation, laboratoires spcialiss, administrations de terrain et organismes certificateurs (commeChampagneArdenneasulesmobiliser),desexpertsendgustation,transformateursetrestaurateurs(commela DPA dEssaouira a pu y faire appel); des responsables de parcs et experts du patrimoine (Lubron); tous acteurs qui, chacunsonchelle,auneexprienceconcrtedudveloppement. Ces cooprations, sagissant des terroirs et de lorigine, ont eu un double mrite important. Elles ont dabord pu contribuerunemeilleureprisedeconscienceparlesacteursmarocainsdelagrandevaleurdeleursproduitset,plus globalement,deleursterroirs.Ellesontaussi,paruneactionpartageaboutissantdesrsultatsconcrets(uneIGP,un projet de parc naturel, un forum international,), permis un rel renforcement des capacits des acteursterritoriaux : administrations,organisationsprofessionnelles,ONG,agriculteurs,etc. Ellesapportentainsiunecontributionsignalelamiseenuvredelanouvelleloisurlessignesdorigineetdequalit etduPilierIIduPlanMarocVert. La poursuite et le renforcement des divers partenariats bilatraux, avec la France mais aussi avec dautres pays de lEuropeouduSudetdelEstdelaMditerrane,sontextrmementsouhaitablespouraiderleMaroctransformer lessaietgnralisersesrussitesdedveloppementdeterroirs.TouteslesrgionsoupresqueduMarocetdetrs nombreuxterroirslocauxpourraienteneffetjustifierdecooprationscomparables. Lescooprationsfrancomarocainesgagneraientaussidvelopperdenouvellessynergiesentrerechercheetactionsur leterrain,danslecadreounondepartenariatsentrergionsdes2pays,lesquelsenseraientdailleursgagnants. Unegrandeattentiondevraitnotammenttredonneparlesacteursdelacooprationauxjeunesrurauxdeszonesde montagne, arides et dagriculture pluviale. La transmission intergnrationnelle des savoirs est en effet menace et lmergencedenouveauxleadersprofessionnelsagricoleslocauxdanslesrgionsduPilierIIseradterminantedune 75

miseendynamiquedesterroirsetdunemiseenuvrerussieduPlanMarocVert.Desactionsderecherche/actionsur leterrain,intgrantladiversitdessituations,associantlesjeunes,etpermettantlaccueiletlaformationenEuropedun certainnombredentreeuxseraientminemmentsouhaitables.

4. C O N S O L ID E R E T G E N E R A L I S E R L E S S U C C E S
LaprioritessentiellepourleMaroc,ceciatditplushaut,doittrelaconsolidationdesacquisetlagnralisationdes dynamiquesderenouveauagricoleetruralparlesapprochesterroirs. LeMarocdesterroirsneselimitepasquelquesproduitssur3ou4provincesourgionsetlesacquisnesontnivisibles ni gnraliss dans lesprit des gens. Le Maroc tant un pays trs divers et complexe, et la population concerne importante,latcheconduireestconsidrable.Professionnaliserplusieurscentainesdemilliersdepaysans,crerdela valeur ajoute et mieux grer les ressources naturelles, implique pratiquement datteindre chaque douar et de promouvoirintelligemmentprobablementplusde300produitsetautantdepaniersdebiensetdeservices.Cesont doncdescentainesdeprogrammesetdesdizainesdemilliersdeprojetslocauxquilfautpouvoirimpulser! Ledfireleverestdautantplusconsidrable,quelescontraintesdevanttresurmontessontmultiples. Lapremireestcelledelapertedaccumulation.Ilyaeneneffetsurleterrainunnombreincalculabledeprojets, appuysparungrandnombredebailleursdiffrents,maissedveloppantsanscohrencelesunsaveclesautres,sans accumulation,etsanscapitalisationdesacquis.Ilestdoncimpossiblepourlepaysdentirertouslesenseignementsutiles pourfaireconnatrelessuccessstories,affinerlesmthodologiesdesprojetsdedveloppementetenassurerparla formation,lepartageetlinformation,labonnediffusionpourrussirleffetbouledeneige.Lacrationencoursdu CRPII (centre de ressources du Pilier II) qui sera charg de la capitalisation des acquis est donc dune importance dterminante. Unedeuximecontrainteestlafaibledcentralisationetdconcentration.Lapolitiqueagricolemarocaineestlongtemps demeuretropstandardiseettropdescendante.Lvolutionencoursverslargionalisationreprsentedecepointde vue un changement trs important. Limplication de la rgion Souss Massa Draa, prsente plus haut, montre toute limportance potentielle de la dcentralisation pour faire merger des visions adaptes aux diffrents contextes rgionauxetinitierdesdynamiquessurlesterroirs.LenouveauPlanMarocVert,quiaconduitpourlapremirefoisla crationdedirectionsrgionalesdelagriculturedotesduneforteautoritetllaborationdunepremiregnration de programmes agricoles rgionaux reprsente un changement dapproche considrable. Cependant, il ya encore beaucoup faire pour que ladministration russisse la rvolution culturelle que suppose la mise en uvre dune approche de dveloppement de type bottom up, planifie au niveau rgional mais mise en uvre localement et pertinentepourlamiseendynamiquedesterroirs. LafaiblessedutissuprofessionnelagricoleauMaroc,dansleszonesduPilierIIestune3 contrainte.Cettefaiblessea justifiauxyeuxdesesrdacteurs,ladiffrenceentrelaloimarocainesurlesIGetlaloifranaise.EnFranceeneffet, lorganismedemandeurdoittreunorganismeprofessionnelalorsquauMaroc,ladministrationouuneautoritlocale peuttreaussiloriginedelademande.Auxyeuxdesrdacteursdelaloimarocaine,lEtatetlesrgionsdoiventdonc, le cas chant, pouvoir intervenir plus fortement pour impulser en amont les nouvelles dynamiques dans le cadre de dmarchesdeprojets.Lexpriencercentesembleenmontrerlebienfonddumoinslorsquelimpulsiondonne parlehautaeffectivementconduitunerelleappropriationdeladmarcheparlesacteursprofessionnelsconcerns. CestlecassembletildeplusieursIGrcentesmaispeuttrepasdetoutes.MaintenantqueleconceptdIGacommenc tre compris, expriment et mis en uvre au Maroc, la multiplication des russites va supposer une appropriation beaucoup plus large. Les producteurs et leurs groupements locaux vont donc tre appels devenir euxmmes des forces de propositions et dimpulsion des projets et ils vont pour cela devoir tre appuys quil sagisse ou non de produits justifiant des IG. Ainsi lexprience des coopratives de Taliouine et de Tyout Chiadma ou des ateliers de transformationdeladattemolledansleTafilaletpourraitinspirerdesmilliersderussiteslocales. Le Maroc dispose par contre dun atout fort grce au maintien de communauts locales encore relativement peu dstructures.Cestunechancecarilexisteainsiencoredeslmentsporteursdesolidarit,detravailencommun.Les mthodes ancestrales de partage de leau, toujours vivantes, ont introduit la ncessit dapprendre avec les autres, et doncunequalitderapportetunedignitdespersonnes.Pourdenombreuxexperts,cestdoncloilfauttravailler pour russir la nouvelle rvolution agricole. Lchelle du douar est notamment incontournable pour permettre une meilleuregestiondesressourcesnaturelles.Cependant,lanonreconnaissancejuridiquedescommunautsdebaseetde leurs droits coutumiers sur leur espace dusage, c'estdire la non reconnaissance du douar, llment de lien local 76
me

comparablelacommuneenFrance 26 ,estunedifficultdjsouligneparlaStratgie2020dedveloppementrural. Les nouvelles approches contractuelles de gestion des terroirs villageois impliqueront une rinterprtation des tutelles des terres collectives par le Ministre de lintrieur et de la gestion patrimoniale de ladministration forestire. Des oprations testsdelecturesociofonciredesterroirs sont mettreenplaceetdesformulespeuventtretrouves en relation avec les communes rurales, les jmaa des douars et les associations de dveloppement local pour aller de lavant. Le projet agropastoral du sud est de la Tunisie montre que des approches comparables fondes sur les communauts,peuventtrestructuresavecsuccslchelledairespastorales. Pourquelarussitesoitaurendezvous,celuidunemeilleuregestiondesressourcesnaturellesoudelavalorisationdes produits locaux, laction danimation sera dune importance fondamentale. Toutes les expriences cites plus haut le dmontrentdailleursparfaitement.Cesteneffetlactiondanimationquiapermislesavancesdesprojetsarganieret RifappuysparlUE,duprojetFIDAenTunisieoudesprojetsdIGPetAOPlexempledelIGPagneauBeniGuiloude lAOPTyout. Desanimateursdeterrain,aucontactdespopulationslocales,formsauxnouvellesapprochesdeterroirs,quilsagisse de la valorisation et commercialisation des produits ou de la gestion participative des ressources naturelles, voire du dveloppement du tourisme rural, et capables par consquent de se mettre lcoute des acteurs locaux et professionnels pour les aider exprimer leurs attentes et entrer dans la logique de projet, sont donc la clef dune gnralisationrussie. Lexistence au Maroc de structures de proximit (CT centres de Travaux et CMV, centre de mise en, valeur agricole) reprsentecetgardunatout.Cependantleurfaiblesseactuellequiarsultdesplansdajustementstructurelsetdu nonrenouvellementdeleursmissionsetdeleurscadresestunecontrainte.Leurtransformationenfrontofficesde qualit, c'estdire la mise en place dune vulgarisation agricole charge de nouvelles fonctions et capables de faire appel toutes les ressources des back offices spcialiss de lagriculture (experts des DPA, plateformes Agro tec, centres de formation, expertise multidisciplinaire, etc.) doit donc tre considre comme le maillon stratgique dune miseenuvre russieduPilierII.Larformedelavulgarisationagricole,prvuecetteanne,estdoncimportantepour le pays. La russite passera par un renouvellement des cadres et des missions et elle ncessite un important renforcementdecapacits.Laformationdoitaussiviserdejeunesrurauxavecpourobjectifsunappuilmergencede nouvellesgnrationsdeleadersprofessionnelslocauxdansleszonesduPilierII.LamiseenplaceduCRPII,institution quiseragalementchargedaffinerlesmthodologiesdesprojetsdedveloppementetdeformationetdappuyerle renforcementdescapacitsestdoncgalement,pourcetteraison,duneimportancestratgique. Cettevolutiondevratreappuyepardeschangementsauniveaudelenseignementagronomiqueetdelarecherche. LeCRPII,tantconstitusousformedeGIP(groupementdintrtpublic)avecles4grandesinstitutionsderechercheet deformationagronomique(INRA,ENAMekns,IAVHassan2,ENFI),doittreloccasiondunevolutiondescursuset dun rapprochement entre formations initiales et continues. Etre capable de relever les nouveaux dfis de lenvironnement et du dveloppement suppose notamment de mieux initier aux approches de sciences sociales les ingnieursdeformationsurtouttechnique. Commelesexpriencesfranaiseetmarocainelemontrentamplement,larecherchepeuttredunapportdcisifpourla miseendynamiquedesterroirs.LengagementduCNRSsurlAubracoulesactionsrcentesdelINRAMaroc(delamise aupointdenouveauxproduitslocauxtransformslappuilacrationdepetitesunitsdeproductionoulamiseen placedelAOPTyoutChiadma)sontlpourleconfirmer La complexit des enjeux relatifs aux terroirs invite cependant aller plus loin. Des approches pluridisciplinaires (agronomie, foresterie, sociologie, gographie, conomie, histoire, cologie), territorialises en jonction autant que possibleaveclesdynamiquesdeprojetsdedveloppementetunemiseendialoguedessavoirsacadmiquesetlocaux simposent.Destravauxtrslocalissderecherche/action/formation(lexempledecequiaputreinitidanslecadre delacooprationdcentraliseCorse/Maroc)enpartantdessituationsconcrtesdeconstructionengensedesterroirs mritent dtre multiplis. La recherche doit pouvoir appuyer les ncessaires apprentissages des approches terroirset aiderladcisionpublique:commentonsecomprend,commentconstruiredesaccordsentrenous,quellesexpertises mobiliser?Elledoitaussireconnatrelescomptenceslocales,ycomprisculinaires,etinnoverpouradapterlapproche terroir aux spcificits marocaines (existence des communauts et jmaa, habitudes de consommation de produits bildi,etc).
26

LacommuneauMaroccorrespondpeuprslchelleducantonenFrance. 77

Une rflexion bilatrale plus approfondie serait souhaitable pour prciser ces besoins et construire des partenariats institutionnalissdetypegagnant/gagnant,financsencommun.CrerunespacecommunTerroirsTec,espacede concertation,forumdediscussionetlieudemobilisationdelexpertisepourappuyerdesprojetsconcretsestunepiste approfondir. Le CRPII qui jouera un rle de middle office entre le terrain et les 4 grandes institutions marocaines devra pouvoir initier des actions de recherche/action penses spcifiquement terroirs. Sa cration pourrait donner demainloccasiondecelledunespacecommunderecherche/actionaux2pays.Lesprojetscommunsderecherche,en coursdemontage,pourraientytrouverunancrageutile. Les terroirs pourraient donc donner loccasion dune rflexion beaucoup plus large sur les options possibles dun dveloppementterritorialdurable.Ilssontpotentiellementuneopportunitetunechanceuniquedeprogrs.

5. F A I R E D E S T E R R O I R S UN O B JE T F OR T D E C O O P E R A T I O N E U R O M E D I T E R R A N E E N N E
CequiestvraiduMarocetdesesrgionsruralesdifficileslestaussidenombreuxautrespaysetrgionsruralesduSud et de lEst de la Mditerrane. Partout, la Mditerrane rurale ncessite de crer plus de valeur ajoute et plus de durabilit. Il en va de la prosprit et de la stabilit partage de tout lespace euromditerranen. Cest pourquoi la question du dveloppement rural durable, des terroirs et de lorigine tient une bonne place dans les rflexions et les analyses dorganisations rgionales comme le Plan Bleu, le CIHEAM (centre international des hautes tudes agronomiquesmditerranennes)etleFEMISE(forumeuromditerranendesinstitutsconomiques). La fragilit de la rgion au changement climatique et aux risques de crises alimentaires en renforce limportance et la dimensionstratgiques.CestpourquoilUnionpourlaMditerrane(UPM)asouligndanssadclarationfondatriceles enjeuxdescuritalimentaireetretenudanssonvoletagricole3prioritsdactionenplusdesnormesSPS(sanitaireset phytosanitaires)quiintressentdirectementlesterroirs,savoir:lesproduitsdequalit,ledveloppementruraldurable etunespacecommunderecherche LexprienceduMarocetcelledescooprationsfrancomarocainessurlesterroirsetlorigine,etleslecturescroisesque lont peut aujourdhui en faire invitent faire beaucoup plus pour consolider les acquis et russir leffet boule de neige.CestvraiauMarocetcepeutltreaussidansdenombreuxautrespaysdelcorgion.Ladmultiplicationdes partenariatsintellectuels,derechercheetdactionlchelleeuromditerranenne,auprofitdesrgionsruralesetdes terroirs du Sud et de lEstqui pourraient,en lien avecdes rgions et terroirs europens, enbnficier, permettrait un effetdentranementconsidrable. EllepermettraiteneffetdemobiliserensembledesacteursdiffrentsdesterritoiresdelEuropeetduSudetdelEstde la Mditerrane dans des cooprations de long terme pour des objectifs de rsultats cibls. Elle pourrait toucher de nombreuses rgions et de trs nombreux terroirs. Elle permettrait dapprendre les uns des autres et une meilleure comprhension mutuelle sur les voies daction adaptes au dveloppement agricole et rural durable en Mditerrane. ElleauraitaussilimmensemritedepermettreunemeilleurerappropriationparlaMditerranedesesressourceset de ses savoirs. Celleci pourrait alors y trouver les fondements de nouvelles fierts partages pour lmergence dune conomieruraleinscritedanslapostmodernit. LaMditerraneaquelquesatoutsencommun.Lesoleilenestunimportantdontlavalorisationpeutaiderfaireface la crise nergtique qui sannonce. Ses terroirs, sa diversit et ses savoirfaire en sont un autre sur lequel on peut construireunprojetcommun.

78

A NNEXE 1 R EMERCIEMENTS
SEMINAIRE Organisation Mme Sophie Villers (prsidente de la section prospective, socit et international du CGAAER, ex directrice de lINAO) ; ainsi que MM. Guillaume Benoit (ex directeur du Plan Bleu) et Khalid Bouchama (conseiller CGDA), Intervenants : administrations centrales et INAO Mme Kahdija Bendriss et M Ahmed Khannoufi (chefs des divisions labellisation et dveloppement des produits de terroirs au Ministre de lagriculture et de la pche maritime du Maroc DDFP), ainsi que Mme Vronique Fouks (responsable du service international de lINAO) et M Philippe Vinon (sous directeur au Ministre de lalimentation, de lagriculture et de la pche). Rgions Oriental et Champagne-Ardenne MM. Abderrahmane Mejdoubi (vice prsident ANOC), Mohamed Zaoui (dlgu ARCOD), et Yahia Rhomari (chef de service ORMVA de la Moulouya), ainsi que MM. Michel Durand (directeur des affaires internationales de Champagne-Ardenne) et El Khantour (responsable du ple coopration dcentralise). Rgions Souss Massa Draa et Aquitaine MM. Mohamed Ouras, prsident de lAMIGHA, et Lahcen Kenny (IAV Hassan 2, Agadir) ainsi que M. Jacques Weill, directeur de la Fdration rgionale des coopratives agricoles dAquitaine Migration et dveloppement (appui au safran de Taliouine) M Tarik Outrahe, dlgu Maroc de Migration et Dveloppement Taroudant, ainsi que M. Gil Garin expert auprs de Migration et Dveloppement France Province dEssaouira M Mohamed Boudra, chef du centre de travaux dHanchane. Rgions Tanger Ttouan et Provence Alpes Cte dAzur ; ONG ATED et Terroirs et Cultures MM. Abdelila Tazi (vice-prsident de lAssociation Talasemtane pour lenvironnement et le dveloppement), Guilhem Calvo (expert auprs de lUNESCO et de Terroirs et Cultures rsident Chefchaouen), Rachid Mrabet (INRA directeur CRRA Tanger-Ttouan) ; ainsi que M. Arnoul Hamel (Provence Alpes Cte dAzur, responsable international du Parc du Lubron) et Mme Karine Lagarde (Terroirs et Cultures Montpellier). ANOC M Fagouri, directeur gnral, ainsi que MM Jouad Kansari et Mohamed Bouaisa, Institutions de recherche MM Mohamed Badraoui, directeur INRA, Mohamed Sabir, directeur ENFI Sal, Aderghal (universit de Rabat) : ainsi que MM Franois Casabianca et Thierry Linck (INRA Corse), Mme Genevive Michon (IRD Marseille), Mme Hlne Ilbert (IAMM Montpellier), Autres experts M. le professeur Mohamed Naciri (Rabat), M Dominique Chardon, prsident de Terroirs et Cultures, M. Abdeslam Chriqi, directeur rgional de lagriculture, membre de Terroirs et Cultures,
DU

ET REFERENCES
:

10 M A R S ( O R G A N I S A T I O N

ET INTERVENANTS)

79

REDACTION,

RELECTURE ET APPORTS AU DOCUMENT DE SYNTHESE

Rdaction : M. Lahcen Kenny de lIAV Hassan 2, Agro-tec dAgadir, auteur du chapitre relatif au cas du Souss Massa Draa, Mlle Zineb Fahsi, lve de Sciences Po Paris, stagiaire au CGDA, auteur dun premier avant-rapport (dc 2009) et M. Guillaume Benoit, rdacteur de la synthse. Relecture et/ou contributions : MM Mohamed Naciri et Grigori Lazarev ; ainsi que MM. Claude Branger et Jacques Lefort (secrtaires gnraux de Terroirs et Cultures) et M. Henri Guillaume (IRD Rabat). ACCUEIL
DE LA MISSION MAROCAINE EN

FRANCE

SUR LES TERROIRS

( F E V R I E R 2010) :

MM. Dominique Chardon (prsident de Terroirs et Cultures), Andr Valadier (vice-prsident) et Eric Barraud (dlgu gnral) : visites dans le Gard, les Cvennes et lAubrac, M Jean-Louis Ber, Directeur, Mme Vronique Fouks et Mme Sabine Eddeli, charge de mission projets : accueil lINAO, Paris. Sous direction des changes internationaux (MAAP/DGPAAT). AUTRES
EXPERTS

Autres contributeurs aux travaux du panel dexperts terroirs du CGDA MM. les professeurs Mohamed Beriane et Abdallah Laouina (Universit de Rabat), MM. Abderhamane Hilali, Mostafa Hassani (directeurs rgionaux de lagriculture), Abdelkarim Rahali (conseiller au CGDA), Mme Zineb Benkhamoune Idrissi (professeur lENFI), ainsi que MM Henri Guillaume (directeur de lIRD Rabat, Youssef Filali Meknessi (UNESCO, Rabat), Jean Nol Roulleau (AFD Rabat) et Grigori Lazarev (ex directeur la FAO). Autres contributeurs aux analyses du CGDA relatives au Pilier II du Plan Maroc vert et aux montagnes De nombreux experts et acteurs marocains et internationaux ainsi que MM. Herv Bichat ex directeur gnral de lenseignement et de la recherche, directeur de lINRA et du CIRAD, Sophie Villers et Jean-Yves Ollivier, ingnieurs gnraux au CGAAER, Grard Viatte (ex directeur de lagriculture lOCDE) et Thomas Rger (responsable coopration internationale ASP). SOUTIEN AUX ACTIONS D U 10 M A R S ) :
DE COOPERATION BILATERALE

(PARTENARIAT

INTELLECTUEL, SEMINAIRE

Service de coopration et daction culturelle (SCAC) de lAmbassade de France Rabat, M. Nicolas Frelot, Conseiller adjoint, Direction Gnrale des Politiques Agricoles, Agro-alimentaire et des Territoires (DGPAAT) du Ministre franais de lAlimentation, de lAgriculture et de la Pche.

QUELQUES

DOCUMENTS DE REFERENCES

FAO, 2009. Territoires, produits et acteurs locaux : des liens de qualit Terroirs et Cultures, 2005. Rencontres internationales Plante Terroirs (et de nombreux autres documents : se reporter au site web de terroirs et cultures) CIHEAM, 2009. Les produits de terroir, les indications gographiques et le dveloppement local durable des pays mditerranens . Options mditerranennes, n 89. INAO (en collaboration avec la SOPEXA), 2005. Le got de lorigine . Hachette Haut Commissariat au Plan (en collaboration avec le CGDA), 2007. Agriculture 2030 : quel avenir pour le Maroc ? Ministre de lAgriculture et de la Pche Maritime, CGDA, Octobre 2009. Pilier II du Plan Maroc Vert : de la stratgie laction (pour un dveloppement solidaire et durable de la petite agriculture prenant en compte les spcificits des montagnes et des oasis) . Plan Bleu (sous la direction de G. Benoit et A. Comeau), Novembre 2005. Mditerrane : les perspectives du Plan Bleu sur lenvironnement et le dveloppement . Editions de lAube, la Tour dAigles. Grigori Lazarev et Mouloud Arab, 2002. Communauts Rurales et Dveloppement Local . Karthala, Paris. CNRS, Brard,L et Marchenay,P. 2007. Produits de terroirs : comprendre et agir . 80

A N N E X E 2 :M I S E E N U V R E D U D E U X I E M E P I L I E R D U P L A N M A R O C V E R T D A N S
L E S E S P A C E S M O N T A G N A R D S E T O A S I E N S .P R O P O S I T I O N S D ' A C T I O N 27


27

Tableauralisendcembre2008suiteauSminaireinstitutionnelduCGDAsurlePilierII,Ifrane,25Novembre2008.N.B.Plusieursdcisionsderformesonttprisesen2009. 81

Engagementfortdansquatregrandeslignesd'action
Rponsesauxdfis Justificationsetobjectifs Lesmontagnesetairesoasiennesontdetrs nombreusesnichespourdesproduitsdeterroirs spcifiques(fruitsfraisettransforms,fleurs,produits marachers,plantesaromatiquesetmdicinales,viandes, miel,fromages,etc.)demandsparlesmarchs rgionaux,nationaux,internationauxettouristiques Investirsurleconditionnementetlatransformationen avalcredesvaleursajoutesquipeuventstimuler lamliorationdelaproductionenamont,dansles exploitations ModalitsetMesures Identifierlademandeetlepotentieldoffrepourdes produitshautevaleurajoute. Promouvoirungrandnombredepetitsprojetsdiversifis lchellenotammentcommunaleencapitalisantsurles acquisdesexpriencesl'trangeretauMaroc(exemples: arganier,safran,confiturededattes,...)etenveillantla russitedelamontedchelle Plansdeprogrsdesexploitationstiresparlesstructures deconditionnementetdetransformation Valorisationdelamaind'uvrelocalepardesformations techniques Mesuresfinesd'amnagementfoncier,deconservationdes eauxetdessols,plantationsetintensificationculturaledans lesterroirsetlesexploitations. Reconnatrelesterroirsd'usagedescommunauts,y comprislesespacescollectifsoudestatutforestier(hors fortsindustrielles).Gestioncollectiveconcertedes systmesdeproductionpastoralesurterrescollectiveset forestires Mettreenplaceuneapprochedepaiementdesservices rendusl'environnement(compensationstransitoirespour lesmoinsvaluesdesdisciplinesenvironnementales, incitationspourdesbnficesenaval) Prioritsd'action Identifierdesporteursdeprojetspotentielspour linvestissementenaval(coopratives,partenariatavec priv,communesrurales) Elaborerunprojetnationaldecommercialisationdesproduits deterroir(Crationd'espacesdeventes,dveloppementde partenariatsavecdesacheteursinstitutionnelscommeAccor etRAM). Coordinationspcifiqueauseindel'Agencede DveloppementAgricole(ADA)

1. Valorisationdes produitsparla miseenplacede petitesunitsde regroupementde loffre,de conditionnementet detransformation etpardenouveaux canauxde commercialisation

2. Gestiondes ressources naturellesetde l'environnementet intensificationdes systmesde productionparla responsabilisation desexploitationset descommunauts rurales

Perspectivededveloppementdurable.Possibilitdune augmentationimportantedelaproductionetdes servicesenvironnementauxetduneamliorationdes conditionsdeviedesfemmesrurales. Lesimportantssavoirfaireetcapacitslocalesdegestion communautairepeuventtrevalorissetamplifis. Labonnegestiondesressourcesnaturellesestdintrt public,cequijustifieunertributiondesagriculteurs. Conditiondesuccsdesprojetsdansladure

Promouvoirdesoprationsconcertesd'amnagementet gestiondesterroirsetdedveloppementagricoledurable Dispositionspourreconnatrelaresponsabilitetla capacitcontractuelledescommunautsdebase(jmaa)et pourcontractualiserlagestionintgredeleursterroirs (Chartesdeterroir) ArrangementstransitionnelsavecMin.IntrieuretEauxet Fortspourinitierdesoprationstestsdegestion contractuelledesterroirs Utiliserlesoprationstestspourlamiseaupointdes mthodesetdesprocduresprvoirdansdestextes rglementairesetpourformerdesagentsexpertsen amnagementparticipatifdesterroirs Elaborerdesdocumentsdemthodeetlaformationd'une expertisedontlerseaupourraittreanimparleCentrede RessourcesPilier2 Ledveloppementterritorialsupposeunenvironnement avancenmatirededcentralisationetdconcentration.Les rformesencourssontencorecomplter.Elles pourraientdonnerauxcercleslesfonctionsdes"petites rgions" Ledveloppementterritorialimpliqueunsoutienfourni pardesanimateursquijouentlerledemdiateurs territoriaux,quiestdanslagricultureceluiduFrontOfficedu 82 dveloppementagricole. LesapprochesdeDveloppementTerritorialse gnralisentactuellementdanslespaysduNord. Possibilitsderaccourcispardescooprations dcentralises(Catalogne,Andalousie.)

3. Miseenuvre proactiveet raisonnedune politiquedesignes dequalit 4. Promotionen liaisonavecles dpartements ministriels concernsd'une approchede dveloppement territorial

Uneapplicationrussiedelanouvelleloisurlessignes dequalitestdimportancestratgiqueetdemande beaucoupdattentionetunedoctrineadapte Veillersonapplicationexemplairedanslesprojetspour stimulerlarplication Ledveloppementterritorial: marqueuneruptureparrapportauxapproches actuellesetimpliqueuneprisedeconscience collectivedespossibilitsdedveloppement agricoledurableduterritoireetdesrisqueslong terme, valoriselesproduitsouservices"phare" susceptiblesdepolariserl'identitduterritoire soutientunprocessusdeconstructionduterritoireet encouragel'identificationdesacteursleur territoire, constitueuneapprocheralistepourmettreen synergieetencohrencelesexigences contradictoiresdelaproductionagricoleet

Inventairergionaldesproduitssusceptiblesdesignede qualit Miseenplaced'untablissementpublicnationalspcialis Laparticipationaudveloppementterritorialse construitautourdesdiagnosticscollectifs,puisdans l'laborationd'unevision,puisdansdessynthses sousformedechartesd'actionlongterme,enfinsous formedeprojetsindividuelsetcollectifs. Ledveloppementterritorialsedclineplusieurs chelles(exploitations,villagesdouars,valles,aires pastoralescommunes,communesrurales,petites rgions,rgions) L'chelledela"petitergion"etcelledes"communauts debase"constituentdesniveauxd'action d'importancestratgique.La"petitergion"s'articule auxautresniveaux(hirarchieterritoriale,structures transversalesdesfiliresetdesorganisations professionnelles)selondesprincipesdesubsidiarit

83

Rorganisationetmobilisationdesmoyensetpolitiquesdesoutien
Rponsesauxdfis Justificationsetobjectifs Ncessitabsolued'unerestructurationdelafilire technologique(filiredu"progrs",du"savoir") Sonpremierniveau,leFrontOffice,structurede proximitmandateparladministration,doitdevenirle chanonstratgiquedelamiseenuvreduPilier2.Au contactdesproducteurs,desgroupements professionnelsetdescommunauts,leFrontofficea pourrledeconnatreleterritoireetlesacteurs, dinformerlensembledesagriculteursdelapolitique gouvernementale,dereprerlesagriculteurset groupementsprtssengagerdanslesprojets,defaire mergeretdaccompagnerlamiseenuvredesprojets, demobiliserlexpertisedubackoffice Ncessitd'assurerunsoutienstratgiqueet oprationneletdeformerdesmassescritiquespar rapprochementdelafiliretechnologiqueauniveau provincial:BackOffice(formation,expertise multidisciplinaire) Ncessitdedvelopperdespartenariatsavecleslus, lesresponsablesprofessionnelsetassociatifs,les oprateursetlesautresservicesdeladministration contribuantaudveloppementrural. Ncessitduneplusfortedconcentration administrativeauniveauprovincialetrgional Ncessitdunemobilisationetanimationdelafilire technologiqueauniveaunational:capitalisation, ingnieriedeformation,mthodologiede dveloppement,animationexpertisePilierII ModalitsetMesures UnfortconsensusrecommandederhabiliterlesCTetCMV pourenfairedesCentresdedveloppementagricole organisslchelledescercles Ncessitd'unegrandecomptenceprofessionnelle,donc deformationd'unenouvellegnrationdedveloppeurs agricolesdeterrain.Mettreenplacedesprogrammesde renforcementdescapacits.Prioritsauxjeunesdiplms avecslectionsvre(aumoins35agentsparCentre) Mettreenplacedespartenariatsaveclesassociationset ONGlocalespourcrerunrseauetdesrelaiscapable d'atteindremassivementlesagriculteursetlesterritoires descommunauts RedfinirlesmissionsdesDPA.Evaluerlescomptences requisesetlesbesoinsdeformationouderecyclageetles cots. Amoyenterme,envisagerleregroupementorganiquedes servicesnonrgaliensdesDPA,desCentresdeQualification AgricoleetdesFrontOffices. Donnerunefortemissiondeplanification,impulsionet contrleauxfuturesdirectionsrgionales CrationdunCentredeRessourcesddilamiseen uvreduPilierII. Prioritsd'action Donnerprioritlamiseenplacedefrontofficesde qualitdanslechantierencourspourlarformedu Ministre.RhabilitationetadaptationdesCT/CMV leursnouvellesfonctionsdeFrontOffice DfinirlesindicateursdeperformancedesFront Offices:nombreetqualitdesprojetscollectifset individuelslaborsetmisenuvre,partenariats tablis,qualitdubackofficemobilis,.Engager desactionstestspourmettreaupointlesprocdures, lesmthodesdetravail;et,del,lesbesoinsen formation PrparerdesContratsProgrammesaveclesnouvelles Chambresrgionalesd'agricultureutilisantlesFront Officescommerelaisdeformation/informationdes agriculteurs,sanslesyrattacher ConforterlerledesDPAenleurdlguantdes responsabilitsdanslexamenetlavalidationdesprojets( territoiresetexploitations).Yrattacherlesfrontoffices pourformerunemassecritique. Dvelopperuneoffredeformationadapteauniveau local(CentresdeQualificationAgricole,Maisons familialesrurales)etleurrapprochement fonctionnelaveclesservicesnonrgaliensdesDPA. Crerdesdirectionsrgionalesdotesdunfort pouvoirdedcision(ElaborationdesPlansagricoles rgionauxetplansrgionauxdeformation. Allocationsdesressources,statistiquesetsystmes dinformation;plateformesagritech.) Dfinirleprojetetsapremirephaseenyassociant lesinstitutsnationauxdeformationetrechercheet dveloppement.Lancerleprojet RformerleFDAetmobiliserlessynergiespossibles avecleFDR Organiserunetablerondedesbailleurspourle financementdu2mepilier. Mandaterl'AgencededveloppementAgricolepour organiserlanimationetl'ingnieriesocialeet financiredelamiseenuvredu2PilierduPlan MarocVertenrelationaveclesdiffrentspartenaires concerns Fixerlesrglesdesrelationsquidevronts'tablirentre lesDirectionsrgionales,lesDPA,lesORMVAetles chambresrgionales.Dfinirlesmissionsetles

Rorganiserlafilire technologiqueet ladministration dconcentrede lAgriculture

Lesfinancementsactuelssontinadapts Amliorationdes mcanismesde Lesexpriencesdmontrentlancessit: financementet dinformationet - Deprendreletempsncessairepourprparer gnralisationdela lesprojetsavecleursacteurs contractualisationetdes - Dedisposerdefinancementssouplesadapts approchespartenariales, ladiversitdesprojetsetbesoinsidentifis notammentpublicpriv - Desystmesd'accsrapideauxressources financiresaprsvalidationdesprojets - Dedisposerdenveloppespluriannuelles permettantdefinancerlesprojetsconformes

Crerdeslignesbudgtairessouples.Rformerle FDApourprendreencomptelesbesoinsdes exploitationsdemontagneetoasiennes,etsortiren partiedelapprocheguichetpourfinancerdesplans deprogrsdesexploitations,notammentsousforme dedotationspourlesjeunesagriculteursforms (passagelapprocheprojet) Ngocieraveclesbailleursdesenveloppes pluriannuellespourcontribueraufinancementdes projetsconformesauxPARaveclasouplesserequise: soutienauxprojetsenfonctiondeleurvalidationet avancementdansletemps,contrlesposteriori Validationdesprojets(territoiresetexploitations)au

84

85