Professional Documents
Culture Documents
Formation of secondary structures ! Alpha helices Beta Sheets Characterized by- main chain NH and CO groups participating in H-bonds to each other. Formed when a number of consecutive residues have the same phi and psi angles.
Alpha Helices
The C=O (or N-H) of n residue is hydrogen bonded to NH (or C=O) of n+4 residue Every 3.6 residues make one turn The distance between two turns is 5.4 Alpha helices are formed when a stretch of consecutive residues all having the phi,psi angle pair approax -60 & -50 , corresponding to the allowed region of Ramchandran plot.
a-helices
H bond between residues i, i+4
The dipole of a peptide unit. Numbers in boxes give the approximate fractional charges of the atoms of the peptide unit
The Dipoles of peptide units are aligned along the helical axis
Helical Wheel: Each residue can be plotted every 360/3.6=100 around a circle or spiral
Alpha helix can be Right-handed or Left Handed. BUT, left handed helix not possible for L-aminoacids due to close approach of the side chains and CO group.
a-helix from one continuous region; b-sheet from several regions of the chain. b-strands, 5-10 residues long
b-sheet
Antiparallel: HBs perpendicular to strands, narrowly spaced bond pairs alternated with widely spaced pairs
Parallel sheet
Mixed sheet
EF Hand
Consists of two perpendicular 10 to 12 residue alpha helices with a 12-residue loop region between Form a single calcium-binding site (helix-loop-helix). Calcium ions interact with residues contained within the loop region. Each of the 12 residues in the loop region is important for calcium coordination. In most EF-hand proteins the residue at position 12 is a glutamate. The glutamate contributes both its side-chain oxygens for calcium coordination.
Tertiary structure refers to the spatial arrangement of amino acid residues that are far apart in the sequence and to the pattern of disulfide bonds.
Quaternary structure
Proteins containing more than one polypeptide chain exhibit a fourth level of structural organization. Each polypeptide chain in such a protein is called a subunit. Quaternary structure refers to the spatial arrangement of subunits and the nature of their interactions. The simplest sort of quaternary structure is a dimer, consisting of two identical subunits.
Complex Quaternary Structure. The coat of rhinovirus comprises 60 copies of each subunits
Domain structures core comprises of antiparallel sheets, usually two sheets packed against each other / Domain structures made from combinations of -- motifs that form a predominantly parallel sheets surrounded by helices
Human plasma retinol binding protein. Retinol molecule vitamin A bound inside the barrel
Triosephosphate isomerase
QHTAWCLTSEQHTAAVIWDCETPGKQNGAYQEDCA HHHHHHCCEEEEEEEEEEECCHHHHHHHCCCCCCC
First X-ray crystallographic structure Myoglobin (1958, Sir John Kendrew, MRC) Remarkable features: Complexity & Asymmetry
10
Atomic resolution structures of biomolecules are stored at the Protein Data Bank
PDB contains 75000 structures mostly determined by X-ray crystallography and NMR. About 3-5 new structures per day
Using electrophoresis, Pauling showed that individuals with sickle cell disease had a modified form of Hb
sticky patch causes hemoglobin S to agglutinate (stick together) and form fibers which deform the red blood cell
Protein folding
Consider a small protein with 100 residues. Cyrus Levinthal calculated that, if each residue can assume three different conformations, the total number of structures would be 3100, which is equal to 5 1047. If it takes 10-13 s to convert one structure into another, the total search time would be 5 1047 10-13 s, which is equal to 5 1034 s, or 1.6 1027 years. Clearly, it would take much too long for even a small protein to fold properly by randomly trying out all possible conformations. Theenormous difference between calculated and actual folding times is called Levinthal's paradox.
Hydrophobic effect Conformational entropy Electrostatics Hydrogen bonding van der Waals interaction
Most important featureThe interior of proteins is hydrophobic ! The main driving force for folding water soluble globular protein molecules is to pack hydrophobic side chains into the interior of the molecule , thus creating a HYDROPHOBIC CORE and a HYDROPHILLIC SURFACE. Problem- How to create such a hydrophobic core from a protein chain ???
Classes of Proteins Based on structure and solubility, proteins can be grouped into three large classes:
Fibrous
Globular
Membrane
Tandem Mass-Spectrometry
Which two proteins will interact? AND, which will not? The ANSWER lies in the nature of the interacting surfaces
A-B, A-C forms poorly matched surfaces, few weak bonds are formed, broken apart by thermal motion A-D offers well matched surfaces, enough noncovalent bonds are formed to create a stable interface
Other factors: