Professional Documents
Culture Documents
Team members: Ensy Caroline Farhath Jabien Felly Melisa Nishachand Vohreh
In contrast to Modern medicine TCM fewer and less severe side effects than single pure drugs.
Imperial herb
Ministerial herb Assistant herb Servant herb Changes in composition and different imperial herb different pharmacological action.
Acupuncture inserting fine needle to specific points increase circulation and balance energy of the body.
Qigong- slow movement and relaxation exercise circulate energy and overall health.
Cinnamon
Ginger Licorice
Qi All manifestations of energy, from the most material aspects of energy (such as the earth, flesh and blood) to the most immaterial aspects (light, nerve impulses, thought, and emotion).
TCM
WESTERN MEDICINE Use Hi-tech machine more expensive. Have high standardization
Use more conventional and simple method and machine less expensive.
Lack of standardization
GINSENG
INTRODUCTION
The name ginseng comes from the Chinese term called renshen which literally means man root. The most commonly used species are Asian ginseng, called Panax ginseng In Greek, panax means heal all
Evolutionary history
Plantae Plants Tracheobionta Vascular plants Spermatophyta Seed plants Magnoliophyta Flowering plants Magnoliopsida Dicotyledons Rosidae Apiales Araliaceae Ginseng family Panax L. ginseng Panax ginseng C.A. Mey. Chinese ginseng http://plants.usda.gov/java/profile?symbol=PAGI2 Kingdom Subkingdom Superdivision Division Class Subclass Order Family Genus Species
Moreover, these active gene is know to produce 124 various proteins with this sequence:
>gi|31455578|gb|AAP55852.1|AF485332_1 GBR5 [Panax ginseng] MGSNKAFLLLGLSLAIVLLISSEVAARELAEAQTTTTNKNTEAATVDGRSGYNGYGGGGYHGGGGYHGGG GYHGGGGYHGGGGYHGGGGHGGGGCSHGYCRYRCCNYAGEVVDAETTGVKPQN
Chemical Structure
-Ro
-Ra1
-Ra2
-Rc
http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=100018&loc=ec_rcs
Uses of Ginseng
for stimulating the mind strengthening the body improving memory increasing vitality extending endurance cleansing the body of stress fighting fatigue to control diabetes etc
DRUG DESIGN
Ginsenoside Rb2 which is one of the components of ginseng saponin, also exhibits the effect of lowering blood sugar level. Firstly tested in a diabetic rat (Mus musculus)
In this study, when diabetic rats were treated with ginsenoside Rb2 of Panax ginseng, there was a significant reduction in blood glucose.
(Ramawat,K.G.etal.(2008) Biotechnology of Medical Plants: Ginseng. France:Laboratories et Biotechnologie)
http://www.ncbi.nlm.nih.gov/sites/entrez?db=gene&cmd=retrieve&dopt=full_rep ort&list_uids=19651
http://www.ncbi.nlm.nih.gov/sites/entrez?db=gene&cmd=retrieve&dopt=full_re port&list_uids=19651
Basic Facts
The only living species of the genus Ginkgoaceae Can be traced back to the Jurassic Era Native in China
Its leaves and seeds are of medicinal values and have been used by traditional medicinal practitioners since 1974
Has a long history of fossils
Evolutionary History
Began during Jurassic era The genus changed very little for than 80 million years Can be seen that the leaves changed from many lobes to single The seeds also from being clumped together to a single seed
Phylogenetic Tree
FOSSILS
Ginkbilobin-2, GAFP, The Novel Antifungal Protein From Gingko Biloba Seeds
ANTAFVSSACNTQKIPSGSPFNRNLRAMLADLRQNTAFSGYDYKTSRAGSGGAPTAYGRATCKQSISQSD CTACLSNLVNRIFSICNNAIGARVQLVDCFIQYEQRSF
Drug Design
Many organic and inorganic components present in Gingko Most important are terpenes and flavoids that causes the leaf extracts to be used as traditional remedies for issues like fungal infections. The protein Ginkbilobin-2, GAFP found in extract binds to Benzodiazepine receptors of mitonchondria.
http://upload.wikimedia.org/wikipedia/commons/9/99/Bilobalide.png
http://www.scielo.br/img/revistas/rbfar/v17n3/02x01.gif
Acts as antioxidant
Laboratory studies have shown that GBE improves blood circulation by dilating blood vessels and reducing the stickiness of blood platelets (terpenes) Acts as an anti-fungal herb
GKBL_GINBI DYR_LACCA
Results:
No significant differences were observed when a person takes one or both or none of the herb supplement. Ambiguity: Researchers conducted the test to find out what happens to the drug after being consumed but did not take into account the effect of drug on the body.
Conclusion:
Based on the test conducted, it can be observed that, consuming both TCM and western medicine together does not enhance the effect of the modern drugs. both TCM and western medicine have similarities on curing a common ailment. Our stand: it is solely an individuals right to choose which treatment he wishes to have. However, the responsibility lies in his hands to outweigh the benefits and losses of which ever treatment he chooses.